F437871

General Info

Members Datasets Scaffolds Average Seq Length
412 243 824 471

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0000224|Ga0466966_0000224_26375_27901
Length 508
Sequence MAMAASVQAKTQGPKIPGKRLSDLLRRDLDQDPVVTGVTADSRKVAEGTLFCALPGTAGDGRDYIPQALAQGAAAILAPDDGARKDLDGIDGLLVKVSDVRRAYALAAKAFYGAQPRTCVAVTGTNGKTSVATFCRQIFARLGHASASMGTLGVVTSMPDGTETAVTGPGLTTPDAGDLARYLAGLAESGVTHLCMEASSHGIDQRRLDGITLTAAGFTNLTQDHLDYHTTMEAYRAAKLRLFEQLLPRGRTAVLNADSDAYNAFAAMSIMSGLNVMGVGERARNLCLTGRDLTVDGQILYLDYQGRSYETKLPLAGLFQASNALVAAGLCIAAGENPDDVIPALSALKGARGRLERVGSRHNAAEVYVDYAHTPDGLETVLKALRPHTQGKLVCVFGCGGDRDRTKRPLMGAIAEKLADRVYVTDDNPRTEDPKDIRADILRGMATAGKKGGPVEIGDRRKAIIEAVHSLKTGDVLVVAGKGHEQGQIVGDRVLPFDDVTVVRQALA

Samples

Sample ID Description Type Environment
1 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
167 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
205 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
213 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
219 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
220 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
225 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
226 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
227 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
233 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
234 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
237 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
238 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
239 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
240 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
241 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
242 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
243 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0.97
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.44
Nodule 0.24
Rhizoplane 2.67
Rhizosphere 76.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466966_0000224 3300044684 Bacteria 37988
2 JGI24752J21851_1002151 3300001976 Bacteria 2633
3 JGI24739J22299_10008705 3300001989 Bacteria 3784
4 JGI24737J22298_10002788 3300001990 Bacteria 6187
5 JGI24748J21848_1000100 3300002074 Bacteria 21322
6 JGI24738J21930_10003176 3300002075 Bacteria 4197
7 JGI24744J21845_10002891 3300002077 Bacteria 3510
8 JGI24034J26672_10000040 3300002239 Bacteria 72195
9 JGI24742J22300_10000716 3300002244 Bacteria 5028
10 rootH1_10100126 3300003323 Bacteria 2293
11 Ga0006562J51391_1043939 3300003578 Bacteria 8126
12 Ga0006562J51391_1043943 3300003578 Bacteria 6466
13 Ga0055524_1005006 3300003775 Bacteria 6000
14 Ga0055536_1001275 3300003781 Bacteria 15519
15 Ga0055536_1015832 3300003781 Bacteria 2557
16 Ga0055531_10008174 3300003794 Bacteria 5573
17 Ga0070658_10000720 3300005327 Bacteria 28643
18 Ga0070658_10060404 3300005327 Bacteria 3087
19 Ga0070690_100000035 3300005330 Bacteria 62497
20 Ga0070670_100000471 3300005331 Bacteria 32572
21 Ga0070666_10000015 3300005335 Bacteria 208372
22 Ga0070666_10008646 3300005335 Bacteria 6331
23 Ga0070680_100004706 3300005336 Bacteria 10268
24 Ga0070660_100002279 3300005339 Bacteria 13174
25 Ga0070660_100025190 3300005339 Bacteria 4420
26 Ga0070660_100051804 3300005339 Bacteria 3162
27 Ga0070689_100029303 3300005340 Bacteria 4165
28 Ga0070668_100001199 3300005347 Bacteria 18394
29 Ga0070668_100001581 3300005347 Bacteria 16465
30 Ga0070668_100012891 3300005347 Bacteria 6225
31 Ga0070668_100014041 3300005347 Bacteria 5990
32 Ga0070668_100111509 3300005347 Bacteria 2177
33 Ga0070669_100000896 3300005353 Bacteria 21674
34 Ga0070669_100021443 3300005353 Bacteria 4616
35 Ga0070669_100113331 3300005353 Bacteria 2060
36 Ga0070671_100005026 3300005355 Bacteria 10547
37 Ga0070671_100014205 3300005355 Bacteria 6430
38 Ga0070688_100003113 3300005365 Bacteria 8481
39 Ga0070659_100004390 3300005366 Bacteria 10071
40 Ga0070659_100026361 3300005366 Bacteria 4472
41 Ga0070659_100066256 3300005366 Bacteria 2862
42 Ga0070667_100000024 3300005367 Bacteria 191216
43 Ga0070667_100000134 3300005367 Bacteria 94286
44 Ga0070667_100005697 3300005367 Bacteria 10403
45 Ga0070714_100000415 3300005435 Bacteria 31292
46 Ga0070678_100020454 3300005456 Bacteria 4343
47 Ga0070662_100006546 3300005457 Bacteria 7516
48 Ga0070662_100049469 3300005457 Bacteria 3031
49 Ga0070681_10003940 3300005458 Bacteria 13989
50 Ga0070685_10000102 3300005466 Bacteria 53800
51 Ga0068853_100004178 3300005539 Bacteria 11131
52 Ga0068853_100012110 3300005539 Bacteria 7016
53 Ga0068853_100077657 3300005539 Bacteria 2901
54 Ga0070686_100000006 3300005544 Bacteria 243316
55 Ga0070686_100000123 3300005544 Bacteria 55299
56 Ga0070665_100000353 3300005548 Bacteria 69165
57 Ga0070665_100000510 3300005548 Bacteria 55798
58 Ga0070665_100001877 3300005548 Bacteria 23874
59 Ga0068855_100006658 3300005563 Bacteria 14034
60 Ga0068855_100036569 3300005563 Bacteria 5844
61 Ga0068855_100141125 3300005563 Bacteria 2746
62 Ga0068852_100000314 3300005616 Bacteria 32834
63 Ga0068859_100017316 3300005617 Bacteria 7237
64 Ga0068864_100000089 3300005618 Bacteria 97458
65 Ga0068864_100000690 3300005618 Bacteria 28244
66 Ga0068861_100003623 3300005719 Bacteria 10287
67 Ga0068861_100036449 3300005719 Bacteria 3650
68 Ga0068863_100000082 3300005841 Bacteria 105688
69 Ga0068863_100000084 3300005841 Bacteria 104480
70 Ga0068863_100000109 3300005841 Bacteria 86619
71 Ga0068863_100000137 3300005841 Bacteria 77716
72 Ga0068863_100035931 3300005841 Bacteria 4719
73 Ga0068858_100002755 3300005842 Bacteria 17660
74 Ga0068858_100002853 3300005842 Bacteria 17371
75 Ga0068860_100000050 3300005843 Bacteria 208372
76 Ga0068860_100000051 3300005843 Bacteria 208179
77 Ga0068860_100001312 3300005843 Bacteria 27012
78 Ga0068860_100001415 3300005843 Bacteria 25996
79 Ga0068862_100000062 3300005844 Bacteria 126792
80 Ga0068862_100000112 3300005844 Bacteria 97458
81 Ga0068862_100116435 3300005844 Bacteria 2351
82 Ga0081455_10004233 3300005937 Bacteria 16179
83 Ga0081539_10004462 3300005985 Bacteria 15427
84 Ga0075370_10018317 3300006353 Bacteria 3800
85 Ga0068865_100003352 3300006881 Bacteria 9596
86 Ga0097620_100017316 3300006931 Bacteria 7237
87 Ga0079104_1012182 3300006946 Bacteria 2722
88 Ga0105251_10000545 3300009011 Bacteria 35537
89 Ga0105250_10007961 3300009092 Bacteria 4526
90 Ga0105240_10003415 3300009093 Bacteria 24672
91 Ga0105240_10009203 3300009093 Bacteria 14007
92 Ga0105240_10018606 3300009093 Bacteria 9316
93 Ga0105240_10027104 3300009093 Bacteria 7508
94 Ga0105240_10052335 3300009093 Bacteria 5134
95 Ga0105240_10098138 3300009093 Bacteria 3568
96 Ga0105240_10134773 3300009093 Bacteria 2958
97 Ga0105247_10078364 3300009101 Bacteria 2078
98 Ga0105248_10000012 3300009177 Bacteria 333963
99 Ga0105248_10000708 3300009177 Bacteria 37708
100 Ga0105248_10049206 3300009177 Bacteria 4727
101 Ga0105248_10115126 3300009177 Bacteria 3033
102 Ga0105238_10017239 3300009551 Bacteria 7337
103 Ga0105238_10074198 3300009551 Bacteria 3395
104 Ga0105238_10088862 3300009551 Bacteria 3076
105 Ga0105249_10000034 3300009553 Bacteria 208378
106 Ga0105249_10000257 3300009553 Bacteria 57683
107 Ga0105148_100222 3300009978 Bacteria 8158
108 Ga0105239_10203263 3300010375 Bacteria 2220
109 Ga0157373_10004562 3300013100 Bacteria 10417
110 Ga0157373_10032412 3300013100 Bacteria 3761
111 Ga0157373_10048399 3300013100 Bacteria 3031
112 Ga0157371_10023284 3300013102 Bacteria 4529
113 Ga0157371_10138825 3300013102 Bacteria 1731
114 Ga0157370_10001841 3300013104 Bacteria 26158
115 Ga0157370_10015013 3300013104 Bacteria 7896
116 Ga0157370_10079572 3300013104 Bacteria 3086
117 Ga0157370_10139460 3300013104 Bacteria 2259
118 Ga0157369_10011166 3300013105 Bacteria 10211
119 Ga0157378_10019601 3300013297 Bacteria 5945
120 Ga0163162_10017982 3300013306 Bacteria 6918
121 Ga0163162_10072511 3300013306 Bacteria 3499
122 Ga0157372_10043859 3300013307 Bacteria 4955
123 Ga0157380_10000567 3300014326 Bacteria 22679
124 Ga0157379_10017761 3300014968 Bacteria 6267
125 Ga0183365_10001 3300015684 Bacteria 2090444
126 Ga0163161_10000051 3300017792 Bacteria 122360
127 Ga0206354_10375922 3300020081 Bacteria 3904
128 Ga0206353_10137184 3300020082 Bacteria 5396
129 Ga0213873_10000039 3300021358 Bacteria 32971
130 Ga0213876_10000455 3300021384 Bacteria 32971
131 Ga0213876_10046680 3300021384 Bacteria 2290
132 Ga0213875_10002725 3300021388 Bacteria 10430
133 Ga0209148_1000243 3300025254 Bacteria 86896
134 Ga0209455_1001436 3300025272 Bacteria 10774
135 Ga0209676_1000038 3300025292 Bacteria 449305
136 Ga0209676_1000089 3300025292 Bacteria 260196
137 Ga0209676_1000644 3300025292 Bacteria 50062
138 Ga0209050_1009729 3300025298 Bacteria 4868
139 Ga0209050_1014016 3300025298 Bacteria 3498
140 Ga0209257_1000060 3300025304 Bacteria 372267
141 Ga0207713_1005138 3300025735 Bacteria 8281
142 Ga0207710_10005429 3300025900 Bacteria 5490
143 Ga0207680_10000007 3300025903 Bacteria 623574
144 Ga0207680_10008070 3300025903 Bacteria 5158
145 Ga0207647_10000929 3300025904 Bacteria 22603
146 Ga0207647_10001020 3300025904 Bacteria 21763
147 Ga0207647_10002196 3300025904 Bacteria 14888
148 Ga0207705_10001039 3300025909 Bacteria 22567
149 Ga0207705_10011087 3300025909 Bacteria 6534
150 Ga0207705_10013158 3300025909 Bacteria 5972
151 Ga0207654_10005269 3300025911 Bacteria 6532
152 Ga0207695_10000922 3300025913 Bacteria 52650
153 Ga0207695_10012672 3300025913 Bacteria 10100
154 Ga0207695_10018957 3300025913 Bacteria 7936
155 Ga0207657_10009934 3300025919 Bacteria 9526
156 Ga0207657_10026279 3300025919 Bacteria 5352
157 Ga0207657_10035350 3300025919 Bacteria 4481
158 Ga0207657_10084510 3300025919 Bacteria 2660
159 Ga0207649_10073925 3300025920 Bacteria 2185
160 Ga0207652_10005315 3300025921 Bacteria 10446
161 Ga0207681_10000133 3300025923 Bacteria 60815
162 Ga0207681_10027063 3300025923 Bacteria 3705
163 Ga0207694_10003105 3300025924 Bacteria 13288
164 Ga0207694_10083849 3300025924 Bacteria 2507
165 Ga0207694_10108529 3300025924 Bacteria 2205
166 Ga0207650_10000502 3300025925 Bacteria 32604
167 Ga0207664_10002026 3300025929 Bacteria 13337
168 Ga0207644_10012775 3300025931 Bacteria 5583
169 Ga0207690_10005646 3300025932 Bacteria 7393
170 Ga0207706_10005699 3300025933 Bacteria 11604
171 Ga0207670_10017128 3300025936 Bacteria 4374
172 Ga0207704_10002803 3300025938 Bacteria 7865
173 Ga0207691_10028807 3300025940 Bacteria 5196
174 Ga0207711_10000004 3300025941 Bacteria 870636
175 Ga0207711_10000275 3300025941 Bacteria 55533
176 Ga0207711_10010062 3300025941 Bacteria 7861
177 Ga0207711_10075335 3300025941 Bacteria 2937
178 Ga0207667_10000024 3300025949 Bacteria 355874
179 Ga0207667_10022228 3300025949 Bacteria 7011
180 Ga0207667_10072833 3300025949 Bacteria 3571
181 Ga0207667_10081120 3300025949 Bacteria 3361
182 Ga0207667_10131518 3300025949 Bacteria 2578
183 Ga0207712_10000004 3300025961 Bacteria 614655
184 Ga0207712_10000324 3300025961 Bacteria 43682
185 Ga0207668_10000018 3300025972 Bacteria 158577
186 Ga0207668_10000405 3300025972 Bacteria 27108
187 Ga0207668_10005050 3300025972 Bacteria 7766
188 Ga0207668_10048896 3300025972 Bacteria 2904
189 Ga0207658_10000022 3300025986 Bacteria 191235
190 Ga0207658_10000082 3300025986 Bacteria 105161
191 Ga0207658_10000711 3300025986 Bacteria 28834
192 Ga0207703_10000146 3300026035 Bacteria 83180
193 Ga0207703_10000732 3300026035 Bacteria 32270
194 Ga0207639_10004404 3300026041 Bacteria 9503
195 Ga0207639_10004629 3300026041 Bacteria 9262
196 Ga0207639_10212014 3300026041 Bacteria 1668
197 Ga0207678_10010547 3300026067 Bacteria 8115
198 Ga0207702_10010522 3300026078 Bacteria 7737
199 Ga0207641_10000010 3300026088 Bacteria 402193
200 Ga0207641_10000019 3300026088 Bacteria 295899
201 Ga0207641_10000139 3300026088 Bacteria 105740
202 Ga0207641_10000274 3300026088 Bacteria 65428
203 Ga0207641_10003604 3300026088 Bacteria 13666
204 Ga0207676_10000051 3300026095 Bacteria 132645
205 Ga0207676_10000310 3300026095 Bacteria 41722
206 Ga0207676_10001959 3300026095 Bacteria 15001
207 Ga0207674_10016393 3300026116 Bacteria 8112
208 Ga0207674_10030417 3300026116 Bacteria 5676
209 Ga0207675_100002781 3300026118 Bacteria 17189
210 Ga0207675_100076219 3300026118 Bacteria 3140
211 Ga0207683_10034503 3300026121 Bacteria 4396
212 Ga0207698_10001824 3300026142 Bacteria 12452
213 Ga0207698_10019730 3300026142 Bacteria 4622
214 Ga0268266_10000009 3300028379 Bacteria 1097737
215 Ga0268266_10000062 3300028379 Bacteria 253490
216 Ga0268266_10000816 3300028379 Bacteria 40977
217 Ga0268265_10000026 3300028380 Bacteria 246653
218 Ga0268265_10000086 3300028380 Bacteria 119049
219 Ga0268265_10014515 3300028380 Bacteria 5369
220 Ga0268264_10000003 3300028381 Bacteria 1141976
221 Ga0268264_10000021 3300028381 Bacteria 481580
222 Ga0268264_10001117 3300028381 Bacteria 26438
223 Ga0268264_10005009 3300028381 Bacteria 11209
224 Ga0265337_1005633 3300028556 Bacteria 4938
225 Ga0307515_10001559 3300028794 Bacteria 51153
226 Ga0265338_10026890 3300028800 Bacteria 5789
227 Ga0265327_10000708 3300031251 Bacteria 52766
228 Ga0265327_10001672 3300031251 Bacteria 26634
229 Ga0307513_10097729 3300031456 Bacteria 2970
230 Ga0307408_100123244 3300031548 Bacteria 2011
231 Ga0265314_10059317 3300031711 Bacteria 2618
232 Ga0307516_10000010 3300031730 Bacteria 229720
233 Ga0307405_10007479 3300031731 Bacteria 5467
234 Ga0307413_10058921 3300031824 Bacteria 2356
235 Ga0307406_10078009 3300031901 Bacteria 2193
236 Ga0307412_10000643 3300031911 Bacteria 20314
237 Ga0307414_10000068 3300032004 Bacteria 100925
238 Ga0307414_10000296 3300032004 Bacteria 29101
239 Ga0307414_10013943 3300032004 Bacteria 4800
240 Ga0373943_0092074 3300035170 Bacteria 1572
241 Ga0373927_0000350 3300035695 Bacteria 36173
242 Ga0395899_0000125 3300037312 Bacteria 120964
243 Ga0395899_0000311 3300037312 Bacteria 62323
244 Ga0395899_0022037 3300037312 Bacteria 4830
245 Ga0395900_0002234 3300037418 Bacteria 21588
246 Ga0395900_0010176 3300037418 Bacteria 9621
247 Ga0395900_0068719 3300037418 Bacteria 3641
248 Ga0395900_0157690 3300037418 Bacteria 2317
249 Ga0395898_0007885 3300037466 Bacteria 11295
250 Ga0395898_0017388 3300037466 Bacteria 7346
251 Ga0395905_0000644 3300037471 Bacteria 46542
252 Ga0395905_0000867 3300037471 Bacteria 39452
253 Ga0395905_0005044 3300037471 Bacteria 13597
254 Ga0395905_0054218 3300037471 Bacteria 3752
255 Ga0395905_0056573 3300037471 Bacteria 3669
256 Ga0395905_0146379 3300037471 Bacteria 2222
257 Ga0395901_0015981 3300038443 Bacteria 7647
258 Ga0395901_0094443 3300038443 Bacteria 3133
259 Ga0237819_00349 3300038705 Bacteria 16648
260 Ga0237816_00215 3300039145 Bacteria 4772
261 Ga0436365_0328398 3300039437 Bacteria 22219
262 Ga0436365_0372655 3300039437 Bacteria 3822
263 Ga0436365_0559582 3300039437 Bacteria 3758
264 Ga0436361_0220258 3300039447 Bacteria 13725
265 Ga0436363_0699823 3300039450 Bacteria 1891
266 Ga0436363_1495817 3300039450 Bacteria 1714
267 Ga0436362_1186234 3300039453 Bacteria 18309
268 Ga0451793_1883390 3300041452 Bacteria 2089
269 Ga0439448_0012816 3300042005 Bacteria 2513
270 Ga0439455_0000352 3300042012 Bacteria 5972
271 Ga0439455_0002998 3300042012 Bacteria 3170
272 Ga0439458_0000132 3300042157 Bacteria 15763
273 Ga0439458_0000162 3300042157 Bacteria 14900
274 Ga0466961_0006388 3300044693 Bacteria 7483
275 Ga0466963_0000618 3300044694 Bacteria 17054
276 Ga0466964_0002809 3300044706 Bacteria 6268
277 Ga0466971_0004991 3300044719 Bacteria 5742
278 Ga0466968_0056291 3300044735 Bacteria 1689
279 Ga0466957_0003600 3300044842 Bacteria 8548
280 Ga0466957_0103419 3300044842 Bacteria 1798
281 Ga0466959_0000130 3300045049 Bacteria 48736
282 Ga0495627_000769 3300046453 Bacteria 23843
283 Ga0495592_0207226 3300046454 Bacteria 1319
284 Ga0495629_0103921 3300046459 Bacteria 1981
285 Ga0495638_0021594 3300046460 Bacteria 4240
286 Ga0495650_0000237 3300046471 Bacteria 110872
287 Ga0495650_0001141 3300046471 Bacteria 28788
288 Ga0495583_0000023 3300046506 Bacteria 280019
289 Ga0495606_0002673 3300046507 Bacteria 20226
290 Ga0495610_0032300 3300046512 Bacteria 2721
291 Ga0495620_0045392 3300046515 Bacteria 1903
292 Ga0495643_0016403 3300046522 Bacteria 4350
293 Ga0495654_0001314 3300046530 Bacteria 17382
294 Ga0495597_0001524 3300046542 Bacteria 16474
295 Ga0495622_0003827 3300046557 Bacteria 7030
296 Ga0495633_0002890 3300046558 Bacteria 11772
297 Ga0495668_0003961 3300046616 Bacteria 10794
298 Ga0495668_0006244 3300046616 Bacteria 7863
299 Ga0495668_0030138 3300046616 Bacteria 3065
300 Ga0495625_0009397 3300046660 Bacteria 8184
301 Ga0495669_0000004 3300046684 Bacteria 208878
302 Ga0495669_0000273 3300046684 Bacteria 29493
303 Ga0495669_0045481 3300046684 Bacteria 1957
304 Ga0495649_0000649 3300046694 Bacteria 28270
305 Ga0495604_0092142 3300047317 Bacteria 2245
306 Ga0495672_0030479 3300047320 Bacteria 3382
307 Ga0495687_016226 3300047443 Bacteria 3751
308 Ga0495687_022873 3300047443 Bacteria 2994
309 Ga0495686_0000383 3300047472 Bacteria 70528
310 Ga0495686_0007830 3300047472 Bacteria 7947
311 Ga0495686_0022614 3300047472 Bacteria 4159
312 Ga0495686_0023394 3300047472 Bacteria 4075
313 Ga0496101_0026315 3300048904 Bacteria 4045
314 Ga0496101_0149075 3300048904 Bacteria 1788
315 Ga0496102_0001152 3300048905 Bacteria 24155
316 Ga0496103_0120237 3300048906 Bacteria 1672
317 Ga0496105_0021819 3300048908 Bacteria 5184
318 Ga0496106_0006952 3300048909 Bacteria 8365
319 Ga0496106_0034170 3300048909 Bacteria 3797
320 Ga0496107_0000914 3300048910 Bacteria 17392
321 Ga0496115_0001819 3300048918 Bacteria 15255
322 Ga0496115_0070870 3300048918 Bacteria 2826
323 Ga0496116_0033888 3300048919 Bacteria 3615
324 Ga0496117_0008907 3300048920 Bacteria 9456
325 Ga0496118_0000946 3300048921 Bacteria 45410
326 Ga0496121_0004530 3300048924 Bacteria 18596
327 Ga0496121_0038270 3300048924 Bacteria 4251
328 Ga0496121_0054977 3300048924 Bacteria 3321
329 Ga0496122_0000990 3300048925 Bacteria 50743
330 Ga0496122_0002487 3300048925 Bacteria 26053
331 Ga0496122_0010157 3300048925 Bacteria 9756
332 Ga0496122_0031895 3300048925 Bacteria 4371
333 Ga0496123_0000097 3300048926 Bacteria 173894
334 Ga0496123_0001967 3300048926 Bacteria 26671
335 Ga0496123_0012208 3300048926 Bacteria 7350
336 Ga0496123_0013645 3300048926 Bacteria 6797
337 Ga0496124_0008552 3300048927 Bacteria 10685
338 Ga0496124_0159338 3300048927 Bacteria 1761
339 Ga0496125_0007215 3300048928 Bacteria 11846
340 Ga0496126_0084015 3300048929 Bacteria 2809
341 Ga0496126_0087365 3300048929 Bacteria 2747
342 Ga0501031_0004036 3300049568 Bacteria 9472
343 Ga0501033_0001862 3300049570 Bacteria 18338
344 Ga0501033_0004550 3300049570 Bacteria 11100
345 Ga0501033_0071740 3300049570 Bacteria 2543
346 Ga0501034_0004687 3300049571 Bacteria 15140
347 Ga0501034_0012456 3300049571 Bacteria 8783
348 Ga0501034_0025334 3300049571 Bacteria 6039
349 Ga0501034_0044866 3300049571 Bacteria 4468
350 Ga0501036_0011877 3300049572 Bacteria 7218
351 Ga0501037_0038715 3300049573 Bacteria 3512
352 Ga0501038_0116644 3300049574 Bacteria 2206
353 Ga0501039_0018355 3300049575 Bacteria 5368
354 Ga0501039_0061445 3300049575 Bacteria 2910
355 Ga0501043_0007123 3300049579 Bacteria 8897
356 Ga0501043_0121829 3300049579 Bacteria 2046
357 Ga0501046_0136693 3300049580 Bacteria 1856
358 Ga0501047_0013009 3300049581 Bacteria 7879
359 Ga0501047_0076686 3300049581 Bacteria 3217
360 Ga0501223_000093 3300049663 Bacteria 26242
361 Ga0501224_000009 3300049664 Bacteria 107191
362 Ga0501233_000579 3300049668 Bacteria 5959
363 Ga0501225_0001826 3300049705 Bacteria 6672
364 Ga0501079_0069235 3300049741 Bacteria 2724
365 Ga0501035_0000584 3300049822 Bacteria 40265
366 Ga0501035_0003152 3300049822 Bacteria 15845
367 Ga0501035_0005742 3300049822 Bacteria 11705
368 Ga0501035_0043341 3300049822 Bacteria 4055
369 Ga0501044_0016725 3300049823 Bacteria 7874
370 Ga0501045_0004265 3300049824 Bacteria 9857
371 Ga0501226_000067 3300049853 Bacteria 34043
372 Ga0500635_0000020 3300053080 Bacteria 110196
373 Ga0500635_0000453 3300053080 Bacteria 11803
374 Ga0500643_000137 3300053087 Bacteria 74194
375 Ga0500643_000992 3300053087 Bacteria 17440
376 Ga0500643_001088 3300053087 Bacteria 16349
377 Ga0500651_0023416 3300053093 Bacteria 3868
378 Ga0500641_0001998 3300053096 Bacteria 7231
379 Ga0500555_001023 3300053103 Bacteria 9470
380 Ga0500555_001171 3300053103 Bacteria 8595
381 Ga0500556_0023542 3300053104 Bacteria 2013
382 Ga0500562_000475 3300053108 Bacteria 9718
383 Ga0500592_000561 3300053116 Bacteria 6146
384 Ga0500595_000693 3300053119 Bacteria 20109
385 Ga0500595_038046 3300053119 Bacteria 1566
386 Ga0500608_000238 3300053122 Bacteria 21650
387 Ga0500608_001156 3300053122 Bacteria 9390
388 Ga0500614_001841 3300053123 Bacteria 4896
389 Ga0500559_0000002 3300053136 Bacteria 262002
390 Ga0500559_0001044 3300053136 Bacteria 16941
391 Ga0500559_0002861 3300053136 Bacteria 8722
392 Ga0500573_0031565 3300053140 Bacteria 3057
393 Ga0500577_0039110 3300053142 Bacteria 1717
394 Ga0500619_056363 3300053154 Bacteria 1284
395 Ga0500622_0000627 3300053156 Bacteria 31781
396 Ga0500627_0000417 3300053158 Bacteria 11494
397 Ga0500636_0140116 3300053177 Bacteria 1339
398 Ga0500637_0010595 3300053178 Bacteria 4731
399 Ga0500637_0034437 3300053178 Bacteria 2833
400 Ga0500596_002430 3300053735 Bacteria 3671
401 Ga0500661_000216 3300055283 Bacteria 10325
402 Ga0501082_0161037 3300060353 Bacteria 1950
403 Ga0466962_0000478 3300061719 Bacteria 17336
404 Ga0466962_0004178 3300061719 Bacteria 6920
405 2643884315 2643221574 Bacteria 2789653
406 2644352790 2643221663 Bacteria 3425771
407 2644548735 2643221699 Bacteria 5731501
408 2739790602 2739367756 Bacteria 4553612
409 2928972903 2928972540 Bacteria 3058286
410 2941486785 2941485952 Bacteria 3591484
411 2977242683 2977240413 Bacteria 3191065
412 8054568609 8054563764 Bacteria 5592885
413 Ga0466966_0000224
414 JGI24752J21851_1002151
415 JGI24739J22299_10008705
416 JGI24737J22298_10002788
417 JGI24748J21848_1000100
418 JGI24738J21930_10003176
419 JGI24744J21845_10002891
420 JGI24034J26672_10000040
421 JGI24742J22300_10000716
422 rootH1_10100126
423 Ga0006562J51391_1043939
424 Ga0006562J51391_1043943
425 Ga0055524_1005006
426 Ga0055536_1001275
427 Ga0055536_1015832
428 Ga0055531_10008174
429 Ga0070658_10000720
430 Ga0070658_10060404
431 Ga0070690_100000035
432 Ga0070670_100000471
433 Ga0070666_10000015
434 Ga0070666_10008646
435 Ga0070680_100004706
436 Ga0070660_100002279
437 Ga0070660_100025190
438 Ga0070660_100051804
439 Ga0070689_100029303
440 Ga0070668_100001199
441 Ga0070668_100001581
442 Ga0070668_100012891
443 Ga0070668_100014041
444 Ga0070668_100111509
445 Ga0070669_100000896
446 Ga0070669_100021443
447 Ga0070669_100113331
448 Ga0070671_100005026
449 Ga0070671_100014205
450 Ga0070688_100003113
451 Ga0070659_100004390
452 Ga0070659_100026361
453 Ga0070659_100066256
454 Ga0070667_100000024
455 Ga0070667_100000134
456 Ga0070667_100005697
457 Ga0070714_100000415
458 Ga0070678_100020454
459 Ga0070662_100006546
460 Ga0070662_100049469
461 Ga0070681_10003940
462 Ga0070685_10000102
463 Ga0068853_100004178
464 Ga0068853_100012110
465 Ga0068853_100077657
466 Ga0070686_100000006
467 Ga0070686_100000123
468 Ga0070665_100000353
469 Ga0070665_100000510
470 Ga0070665_100001877
471 Ga0068855_100006658
472 Ga0068855_100036569
473 Ga0068855_100141125
474 Ga0068852_100000314
475 Ga0068859_100017316
476 Ga0068864_100000089
477 Ga0068864_100000690
478 Ga0068861_100003623
479 Ga0068861_100036449
480 Ga0068863_100000082
481 Ga0068863_100000084
482 Ga0068863_100000109
483 Ga0068863_100000137
484 Ga0068863_100035931
485 Ga0068858_100002755
486 Ga0068858_100002853
487 Ga0068860_100000050
488 Ga0068860_100000051
489 Ga0068860_100001312
490 Ga0068860_100001415
491 Ga0068862_100000062
492 Ga0068862_100000112
493 Ga0068862_100116435
494 Ga0081455_10004233
495 Ga0081539_10004462
496 Ga0075370_10018317
497 Ga0068865_100003352
498 Ga0097620_100017316
499 Ga0079104_1012182
500 Ga0105251_10000545
501 Ga0105250_10007961
502 Ga0105240_10003415
503 Ga0105240_10009203
504 Ga0105240_10018606
505 Ga0105240_10027104
506 Ga0105240_10052335
507 Ga0105240_10098138
508 Ga0105240_10134773
509 Ga0105247_10078364
510 Ga0105248_10000012
511 Ga0105248_10000708
512 Ga0105248_10049206
513 Ga0105248_10115126
514 Ga0105238_10017239
515 Ga0105238_10074198
516 Ga0105238_10088862
517 Ga0105249_10000034
518 Ga0105249_10000257
519 Ga0105148_100222
520 Ga0105239_10203263
521 Ga0157373_10004562
522 Ga0157373_10032412
523 Ga0157373_10048399
524 Ga0157371_10023284
525 Ga0157371_10138825
526 Ga0157370_10001841
527 Ga0157370_10015013
528 Ga0157370_10079572
529 Ga0157370_10139460
530 Ga0157369_10011166
531 Ga0157378_10019601
532 Ga0163162_10017982
533 Ga0163162_10072511
534 Ga0157372_10043859
535 Ga0157380_10000567
536 Ga0157379_10017761
537 Ga0183365_10001
538 Ga0163161_10000051
539 Ga0206354_10375922
540 Ga0206353_10137184
541 Ga0213873_10000039
542 Ga0213876_10000455
543 Ga0213876_10046680
544 Ga0213875_10002725
545 Ga0209148_1000243
546 Ga0209455_1001436
547 Ga0209676_1000038
548 Ga0209676_1000089
549 Ga0209676_1000644
550 Ga0209050_1009729
551 Ga0209050_1014016
552 Ga0209257_1000060
553 Ga0207713_1005138
554 Ga0207710_10005429
555 Ga0207680_10000007
556 Ga0207680_10008070
557 Ga0207647_10000929
558 Ga0207647_10001020
559 Ga0207647_10002196
560 Ga0207705_10001039
561 Ga0207705_10011087
562 Ga0207705_10013158
563 Ga0207654_10005269
564 Ga0207695_10000922
565 Ga0207695_10012672
566 Ga0207695_10018957
567 Ga0207657_10009934
568 Ga0207657_10026279
569 Ga0207657_10035350
570 Ga0207657_10084510
571 Ga0207649_10073925
572 Ga0207652_10005315
573 Ga0207681_10000133
574 Ga0207681_10027063
575 Ga0207694_10003105
576 Ga0207694_10083849
577 Ga0207694_10108529
578 Ga0207650_10000502
579 Ga0207664_10002026
580 Ga0207644_10012775
581 Ga0207690_10005646
582 Ga0207706_10005699
583 Ga0207670_10017128
584 Ga0207704_10002803
585 Ga0207691_10028807
586 Ga0207711_10000004
587 Ga0207711_10000275
588 Ga0207711_10010062
589 Ga0207711_10075335
590 Ga0207667_10000024
591 Ga0207667_10022228
592 Ga0207667_10072833
593 Ga0207667_10081120
594 Ga0207667_10131518
595 Ga0207712_10000004
596 Ga0207712_10000324
597 Ga0207668_10000018
598 Ga0207668_10000405
599 Ga0207668_10005050
600 Ga0207668_10048896
601 Ga0207658_10000022
602 Ga0207658_10000082
603 Ga0207658_10000711
604 Ga0207703_10000146
605 Ga0207703_10000732
606 Ga0207639_10004404
607 Ga0207639_10004629
608 Ga0207639_10212014
609 Ga0207678_10010547
610 Ga0207702_10010522
611 Ga0207641_10000010
612 Ga0207641_10000019
613 Ga0207641_10000139
614 Ga0207641_10000274
615 Ga0207641_10003604
616 Ga0207676_10000051
617 Ga0207676_10000310
618 Ga0207676_10001959
619 Ga0207674_10016393
620 Ga0207674_10030417
621 Ga0207675_100002781
622 Ga0207675_100076219
623 Ga0207683_10034503
624 Ga0207698_10001824
625 Ga0207698_10019730
626 Ga0268266_10000009
627 Ga0268266_10000062
628 Ga0268266_10000816
629 Ga0268265_10000026
630 Ga0268265_10000086
631 Ga0268265_10014515
632 Ga0268264_10000003
633 Ga0268264_10000021
634 Ga0268264_10001117
635 Ga0268264_10005009
636 Ga0265337_1005633
637 Ga0307515_10001559
638 Ga0265338_10026890
639 Ga0265327_10000708
640 Ga0265327_10001672
641 Ga0307513_10097729
642 Ga0307408_100123244
643 Ga0265314_10059317
644 Ga0307516_10000010
645 Ga0307405_10007479
646 Ga0307413_10058921
647 Ga0307406_10078009
648 Ga0307412_10000643
649 Ga0307414_10000068
650 Ga0307414_10000296
651 Ga0307414_10013943
652 Ga0373943_0092074
653 Ga0373927_0000350
654 Ga0395899_0000125
655 Ga0395899_0000311
656 Ga0395899_0022037
657 Ga0395900_0002234
658 Ga0395900_0010176
659 Ga0395900_0068719
660 Ga0395900_0157690
661 Ga0395898_0007885
662 Ga0395898_0017388
663 Ga0395905_0000644
664 Ga0395905_0000867
665 Ga0395905_0005044
666 Ga0395905_0054218
667 Ga0395905_0056573
668 Ga0395905_0146379
669 Ga0395901_0015981
670 Ga0395901_0094443
671 Ga0237819_00349
672 Ga0237816_00215
673 Ga0436365_0328398
674 Ga0436365_0372655
675 Ga0436365_0559582
676 Ga0436361_0220258
677 Ga0436363_0699823
678 Ga0436363_1495817
679 Ga0436362_1186234
680 Ga0451793_1883390
681 Ga0439448_0012816
682 Ga0439455_0000352
683 Ga0439455_0002998
684 Ga0439458_0000132
685 Ga0439458_0000162
686 Ga0466961_0006388
687 Ga0466963_0000618
688 Ga0466964_0002809
689 Ga0466971_0004991
690 Ga0466968_0056291
691 Ga0466957_0003600
692 Ga0466957_0103419
693 Ga0466959_0000130
694 Ga0495627_000769
695 Ga0495592_0207226
696 Ga0495629_0103921
697 Ga0495638_0021594
698 Ga0495650_0000237
699 Ga0495650_0001141
700 Ga0495583_0000023
701 Ga0495606_0002673
702 Ga0495610_0032300
703 Ga0495620_0045392
704 Ga0495643_0016403
705 Ga0495654_0001314
706 Ga0495597_0001524
707 Ga0495622_0003827
708 Ga0495633_0002890
709 Ga0495668_0003961
710 Ga0495668_0006244
711 Ga0495668_0030138
712 Ga0495625_0009397
713 Ga0495669_0000004
714 Ga0495669_0000273
715 Ga0495669_0045481
716 Ga0495649_0000649
717 Ga0495604_0092142
718 Ga0495672_0030479
719 Ga0495687_016226
720 Ga0495687_022873
721 Ga0495686_0000383
722 Ga0495686_0007830
723 Ga0495686_0022614
724 Ga0495686_0023394
725 Ga0496101_0026315
726 Ga0496101_0149075
727 Ga0496102_0001152
728 Ga0496103_0120237
729 Ga0496105_0021819
730 Ga0496106_0006952
731 Ga0496106_0034170
732 Ga0496107_0000914
733 Ga0496115_0001819
734 Ga0496115_0070870
735 Ga0496116_0033888
736 Ga0496117_0008907
737 Ga0496118_0000946
738 Ga0496121_0004530
739 Ga0496121_0038270
740 Ga0496121_0054977
741 Ga0496122_0000990
742 Ga0496122_0002487
743 Ga0496122_0010157
744 Ga0496122_0031895
745 Ga0496123_0000097
746 Ga0496123_0001967
747 Ga0496123_0012208
748 Ga0496123_0013645
749 Ga0496124_0008552
750 Ga0496124_0159338
751 Ga0496125_0007215
752 Ga0496126_0084015
753 Ga0496126_0087365
754 Ga0501031_0004036
755 Ga0501033_0001862
756 Ga0501033_0004550
757 Ga0501033_0071740
758 Ga0501034_0004687
759 Ga0501034_0012456
760 Ga0501034_0025334
761 Ga0501034_0044866
762 Ga0501036_0011877
763 Ga0501037_0038715
764 Ga0501038_0116644
765 Ga0501039_0018355
766 Ga0501039_0061445
767 Ga0501043_0007123
768 Ga0501043_0121829
769 Ga0501046_0136693
770 Ga0501047_0013009
771 Ga0501047_0076686
772 Ga0501223_000093
773 Ga0501224_000009
774 Ga0501233_000579
775 Ga0501225_0001826
776 Ga0501079_0069235
777 Ga0501035_0000584
778 Ga0501035_0003152
779 Ga0501035_0005742
780 Ga0501035_0043341
781 Ga0501044_0016725
782 Ga0501045_0004265
783 Ga0501226_000067
784 Ga0500635_0000020
785 Ga0500635_0000453
786 Ga0500643_000137
787 Ga0500643_000992
788 Ga0500643_001088
789 Ga0500651_0023416
790 Ga0500641_0001998
791 Ga0500555_001023
792 Ga0500555_001171
793 Ga0500556_0023542
794 Ga0500562_000475
795 Ga0500592_000561
796 Ga0500595_000693
797 Ga0500595_038046
798 Ga0500608_000238
799 Ga0500608_001156
800 Ga0500614_001841
801 Ga0500559_0000002
802 Ga0500559_0001044
803 Ga0500559_0002861
804 Ga0500573_0031565
805 Ga0500577_0039110
806 Ga0500619_056363
807 Ga0500622_0000627
808 Ga0500627_0000417
809 Ga0500636_0140116
810 Ga0500637_0010595
811 Ga0500637_0034437
812 Ga0500596_002430
813 Ga0500661_000216
814 Ga0501082_0161037
815 Ga0466962_0000478
816 Ga0466962_0004178
817 2643884315
818 2644352790
819 2644548735
820 2739790602
821 2928972903
822 2941486785
823 2977242683
824 8054568609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01225

Mur_ligase

Mur ligase family, catalytic domain

34

112

0.94

PF08245

Mur_ligase_M

Mur ligase middle domain

122

331

0.92

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

353

483

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e8c-assembly1.cif.gz_A structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli 0.9113 1 470
4c12-assembly1.cif.gz_A x-ray crystal structure of staphylococcus aureus mure with udp-murnac- ala-glu-lys and adp 0.908 1 471
1e8c-assembly1.cif.gz_A structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli 0.9058 1 470
4c12-assembly1.cif.gz_A x-ray crystal structure of staphylococcus aureus mure with udp-murnac- ala-glu-lys and adp 0.9043 1 471
2xja-assembly1.cif.gz_A structure of mure from m.tuberculosis with dipeptide and adp 0.8908 17 470
ID Description Score Start End Superfamily
af_I1KPB4_561_737_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9511 337 470 3.90.190.20
1e8cB03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9338 329 463 3.90.190.20
4bubB03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9277 332 471 3.90.190.20
4c13A02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9232 95 325 3.40.1190.10
4c12A03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9219 335 471 3.90.190.20
ID Description Score Start End GO Terms
AF-A0A0A0CWN4-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9729 72 341 GO:0005524
GO:0009058
GO:0016881
AF-A0A349J3T9-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9708 331 470 GO:0009058
GO:0016881
AF-A0A2S6UTV3-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase (EC 6.3.2.13) 0.97 1 407 GO:0005524
GO:0005737
GO:0008360
GO:0008765
GO:0009252
GO:0051301
GO:0071555
AF-A0A3S1Q2K8-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9691 100 260 GO:0005524
GO:0009058
GO:0016881
AF-A0A5A7N9C0-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC 6.3.2.13) (Meso-A2pm-adding enzyme) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-L-Ala-D-Glu:meso-diaminopimelate ligase) (UDP-MurNAc-tripeptide synthetase) (UDP-N-acetylmuramyl-tripeptide synthetase) 0.9659 17 472 GO:0000287
GO:0005524
GO:0005737
GO:0008360
GO:0008765
GO:0009252
GO:0051301
GO:0071555

Map