F437863

General Info

Members Datasets Scaffolds Average Seq Length
412 273 824 143

Family's Representative Sequence

Representative Sequence 3300041452|Ga0451793_1783910|Ga0451793_1783910_102_632
Length 176
Sequence VPGAQSCAAAFAGSGIDMPGQHESFQPRKTKAAMPPKKKLVKTFTLQLPGGQATPAPPVGPALGQHGVNIMEFVKAYNAQTESQRGDIIPAQISVYEDRTFTFILKTPPAARLLLKAAGVPKGSGVPQKDKVGSITKAQLREVAEKKMSDLNANDIEQAEKIIAGTARSMGIVVKD

Samples

Sample ID Description Type Environment
1 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
108 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
221 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
222 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
225 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
226 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
239 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
255 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
256 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
257 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.38
Metatranscriptomes 12.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.34
Nodule 0
Rhizoplane 4.37
Rhizosphere 83.98
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451793_1783910 3300041452 Bacteria 783
2 JGI24752J21851_1045878 3300001976 Bacteria 589
3 JGI24746J21847_1020088 3300001977 Bacteria 939
4 JGI24739J22299_10160778 3300001989 Unclassified 663
5 JGI24737J22298_10163278 3300001990 Bacteria 658
6 JGI24737J22298_10253976 3300001990 Bacteria 519
7 JGI24743J22301_10007446 3300001991 Bacteria 1898
8 JGI24735J21928_10185425 3300002067 Unclassified 602
9 JGI24738J21930_10025700 3300002075 Bacteria 1210
10 JGI24034J26672_10009779 3300002239 Bacteria 1418
11 Ga0007417J51691_1061249 3300003544 Bacteria 568
12 Ga0058863_11932008 3300004799 Bacteria 845
13 Ga0058860_12149464 3300004801 Bacteria 625
14 Ga0070683_100004374 3300005329 Bacteria 11626
15 Ga0070683_100094315 3300005329 Bacteria 2813
16 Ga0070670_101478067 3300005331 Bacteria 624
17 Ga0068869_100127628 3300005334 Bacteria 1952
18 Ga0068869_100722804 3300005334 Bacteria 851
19 Ga0070666_10669767 3300005335 Bacteria 760
20 Ga0070680_100450871 3300005336 Bacteria 1099
21 Ga0070680_100958102 3300005336 Bacteria 739
22 Ga0070682_100000797 3300005337 Bacteria 18487
23 Ga0070682_100387035 3300005337 Bacteria 1054
24 Ga0068868_100004107 3300005338 Bacteria 10173
25 Ga0070660_100550363 3300005339 Bacteria 963
26 Ga0070689_101114718 3300005340 Bacteria 706
27 Ga0070689_101561924 3300005340 Bacteria 599
28 Ga0070691_10556911 3300005341 Bacteria 671
29 Ga0070668_100049659 3300005347 Bacteria 3227
30 Ga0070668_100050250 3300005347 Bacteria 3210
31 Ga0070668_100266799 3300005347 Bacteria 1425
32 Ga0070675_100634271 3300005354 Bacteria 971
33 Ga0070675_100992885 3300005354 Bacteria 771
34 Ga0070671_100000692 3300005355 Bacteria 24235
35 Ga0070673_100064789 3300005364 Bacteria 2912
36 Ga0070659_100073278 3300005366 Bacteria 2726
37 Ga0070667_100837534 3300005367 Bacteria 855
38 Ga0070709_10255663 3300005434 Bacteria 1264
39 Ga0070714_100218491 3300005435 Bacteria 1750
40 Ga0070714_100300386 3300005435 Bacteria 1496
41 Ga0070714_100477759 3300005435 Bacteria 1186
42 Ga0070713_100028369 3300005436 Bacteria 4420
43 Ga0070710_10528365 3300005437 Bacteria 812
44 Ga0070711_100036438 3300005439 Bacteria 3295
45 Ga0070705_100745367 3300005440 Bacteria 774
46 Ga0070700_100000892 3300005441 Bacteria 14724
47 Ga0070694_100007200 3300005444 Bacteria 6774
48 Ga0070663_100000409 3300005455 Bacteria 22557
49 Ga0070663_100116754 3300005455 Bacteria 2012
50 Ga0070663_101729362 3300005455 Bacteria 560
51 Ga0070678_100283974 3300005456 Bacteria 1401
52 Ga0070678_101005299 3300005456 Bacteria 767
53 Ga0070662_101665881 3300005457 Bacteria 551
54 Ga0070681_10051164 3300005458 Bacteria 4121
55 Ga0070685_10007458 3300005466 Bacteria 5599
56 Ga0070706_100173082 3300005467 Bacteria 2016
57 Ga0070707_101186319 3300005468 Bacteria 729
58 Ga0070679_100446573 3300005530 Bacteria 1238
59 Ga0070684_100019734 3300005535 Bacteria 5579
60 Ga0070684_100286417 3300005535 Bacteria 1510
61 Ga0070696_100557442 3300005546 Bacteria 919
62 Ga0070696_101563420 3300005546 Bacteria 566
63 Ga0070665_100111165 3300005548 Bacteria 2742
64 Ga0070665_100913109 3300005548 Bacteria 891
65 Ga0070704_100470619 3300005549 Bacteria 1086
66 Ga0068855_101793461 3300005563 Bacteria 624
67 Ga0070664_100102297 3300005564 Bacteria 2493
68 Ga0070664_100127634 3300005564 Bacteria 2232
69 Ga0068854_100050934 3300005578 Bacteria 2965
70 Ga0068856_100008031 3300005614 Bacteria 10302
71 Ga0068856_100935123 3300005614 Bacteria 886
72 Ga0070702_100183856 3300005615 Bacteria 1370
73 Ga0068852_100160312 3300005616 Bacteria 2100
74 Ga0068859_100332802 3300005617 Bacteria 1613
75 Ga0068859_100674862 3300005617 Bacteria 1125
76 Ga0068864_100033985 3300005618 Bacteria 4335
77 Ga0068864_100806843 3300005618 Bacteria 923
78 Ga0068866_10619741 3300005718 Bacteria 733
79 Ga0068861_100568731 3300005719 Bacteria 1036
80 Ga0068863_100002624 3300005841 Bacteria 17813
81 Ga0068863_100217994 3300005841 Bacteria 1838
82 Ga0068860_100573983 3300005843 Bacteria 1131
83 Ga0081538_10046986 3300005981 Bacteria 2654
84 Ga0081539_10123497 3300005985 Bacteria 1282
85 Ga0081539_10208624 3300005985 Bacteria 897
86 Ga0070717_10100373 3300006028 Bacteria 2457
87 Ga0070717_10152056 3300006028 Bacteria 2003
88 Ga0070717_10826892 3300006028 Bacteria 843
89 Ga0075363_100098065 3300006048 Bacteria 1620
90 Ga0075364_10004937 3300006051 Bacteria 7727
91 Ga0075364_10571749 3300006051 Bacteria 772
92 Ga0070715_10765658 3300006163 Bacteria 583
93 Ga0070712_100101510 3300006175 Bacteria 2128
94 Ga0070712_100117043 3300006175 Bacteria 1999
95 Ga0075367_10166767 3300006178 Bacteria 1371
96 Ga0075367_10315096 3300006178 Bacteria 985
97 Ga0075367_10325079 3300006178 Bacteria 969
98 Ga0075369_10087272 3300006186 Bacteria 1389
99 Ga0075366_10302464 3300006195 Bacteria 978
100 Ga0075370_10223737 3300006353 Bacteria 1112
101 Ga0075428_100003373 3300006844 Bacteria 17474
102 Ga0075428_100193345 3300006844 Bacteria 2200
103 Ga0075428_100220583 3300006844 Bacteria 2048
104 Ga0075428_100224490 3300006844 Bacteria 2028
105 Ga0075428_100589441 3300006844 Bacteria 1188
106 Ga0075428_100709318 3300006844 Bacteria 1072
107 Ga0075430_100024160 3300006846 Bacteria 5174
108 Ga0075430_100526850 3300006846 Bacteria 975
109 Ga0075431_100011790 3300006847 Bacteria 8821
110 Ga0075431_100025370 3300006847 Bacteria 6076
111 Ga0075431_100067257 3300006847 Bacteria 3699
112 Ga0075431_100102041 3300006847 Bacteria 2961
113 Ga0075431_100430523 3300006847 Bacteria 1317
114 Ga0075433_10068428 3300006852 Bacteria 3117
115 Ga0075434_100115069 3300006871 Bacteria 2702
116 Ga0075429_100369490 3300006880 Bacteria 1256
117 Ga0075429_100471531 3300006880 Bacteria 1100
118 Ga0075436_100060287 3300006914 Bacteria 2621
119 Ga0097620_100332804 3300006931 Bacteria 1613
120 Ga0097620_100674855 3300006931 Bacteria 1125
121 Ga0075435_100046851 3300007076 Bacteria 3469
122 Ga0075435_100607137 3300007076 Bacteria 949
123 Ga0099795_10227406 3300007788 Bacteria 796
124 Ga0105251_10045883 3300009011 Bacteria 2105
125 Ga0111539_10035424 3300009094 Bacteria 6043
126 Ga0111539_10479438 3300009094 Bacteria 1449
127 Ga0111539_10991859 3300009094 Bacteria 976
128 Ga0111539_11009286 3300009094 Bacteria 967
129 Ga0105245_12160333 3300009098 Bacteria 610
130 Ga0105247_10091085 3300009101 Bacteria 1936
131 Ga0105247_11710592 3300009101 Bacteria 520
132 Ga0114129_10003146 3300009147 Bacteria 23167
133 Ga0114129_10170423 3300009147 Bacteria 2968
134 Ga0114129_10401715 3300009147 Bacteria 1806
135 Ga0114129_10434785 3300009147 Bacteria 1724
136 Ga0114129_10953631 3300009147 Bacteria 1083
137 Ga0114129_12302937 3300009147 Bacteria 646
138 Ga0114129_12508908 3300009147 Bacteria 616
139 Ga0114129_12996686 3300009147 Bacteria 555
140 Ga0105243_10048684 3300009148 Bacteria 3342
141 Ga0105248_12181462 3300009177 Bacteria 630
142 Ga0105237_10040586 3300009545 Bacteria 4693
143 Ga0105237_10147216 3300009545 Bacteria 2350
144 Ga0105237_10728003 3300009545 Bacteria 998
145 Ga0105249_10325732 3300009553 Bacteria 1549
146 Ga0105249_11113575 3300009553 Bacteria 860
147 Ga0105239_10009439 3300010375 Bacteria 10991
148 Ga0105239_10027156 3300010375 Bacteria 6302
149 Ga0105246_10058712 3300011119 Bacteria 2666
150 Ga0105246_10479198 3300011119 Bacteria 1052
151 Ga0157323_1004742 3300012495 Bacteria 883
152 Ga0157371_10400444 3300013102 Bacteria 1004
153 Ga0157374_10010605 3300013296 Bacteria 7933
154 Ga0157374_10239210 3300013296 Bacteria 1785
155 Ga0157378_10705964 3300013297 Bacteria 1028
156 Ga0163162_11242216 3300013306 Bacteria 846
157 Ga0157375_10137679 3300013308 Bacteria 2567
158 Ga0157375_10459974 3300013308 Bacteria 1438
159 Ga0157375_11051103 3300013308 Bacteria 952
160 Ga0163163_10217286 3300014325 Bacteria 1960
161 Ga0163163_10374432 3300014325 Bacteria 1481
162 Ga0157380_10516643 3300014326 Bacteria 1164
163 Ga0157380_10827176 3300014326 Bacteria 945
164 Ga0157377_10224613 3300014745 Bacteria 1204
165 Ga0157379_10039182 3300014968 Bacteria 4228
166 Ga0157379_10042474 3300014968 Bacteria 4059
167 Ga0157379_10468898 3300014968 Bacteria 1164
168 Ga0157379_11548166 3300014968 Bacteria 646
169 Ga0157376_10569399 3300014969 Bacteria 1123
170 Ga0157376_11347956 3300014969 Bacteria 744
171 Ga0197907_10292858 3300020069 Bacteria 3156
172 Ga0197907_11051494 3300020069 Bacteria 528
173 Ga0197907_11084100 3300020069 Bacteria 975
174 Ga0206356_10167142 3300020070 Bacteria 1003
175 Ga0206356_10212770 3300020070 Bacteria 661
176 Ga0206356_10469993 3300020070 Bacteria 849
177 Ga0206349_1313087 3300020075 Bacteria 1272
178 Ga0206349_1580678 3300020075 Bacteria 1024
179 Ga0206355_1054953 3300020076 Bacteria 991
180 Ga0206355_1537185 3300020076 Bacteria 665
181 Ga0206352_10035001 3300020078 Bacteria 702
182 Ga0206352_10355978 3300020078 Bacteria 727
183 Ga0206352_10413347 3300020078 Bacteria 981
184 Ga0206352_10433851 3300020078 Bacteria 505
185 Ga0206352_10682473 3300020078 Bacteria 1446
186 Ga0206350_10833008 3300020080 Bacteria 1383
187 Ga0206354_10550371 3300020081 Bacteria 1433
188 Ga0206354_11433134 3300020081 Bacteria 1644
189 Ga0206353_10389610 3300020082 Bacteria 1255
190 Ga0206353_10617559 3300020082 Bacteria 759
191 Ga0224712_10090062 3300022467 Bacteria 1283
192 Ga0207710_10062305 3300025900 Bacteria 1694
193 Ga0207680_10399726 3300025903 Bacteria 971
194 Ga0207643_10499882 3300025908 Bacteria 777
195 Ga0207643_10828009 3300025908 Bacteria 600
196 Ga0207705_10665920 3300025909 Bacteria 809
197 Ga0207707_10872133 3300025912 Bacteria 746
198 Ga0207671_10075674 3300025914 Bacteria 2518
199 Ga0207650_10337764 3300025925 Bacteria 1237
200 Ga0207664_10098416 3300025929 Bacteria 2412
201 Ga0207664_10116633 3300025929 Bacteria 2228
202 Ga0207706_10046682 3300025933 Bacteria 3835
203 Ga0207670_10164043 3300025936 Bacteria 1661
204 Ga0207670_10757423 3300025936 Bacteria 807
205 Ga0207704_10919866 3300025938 Bacteria 736
206 Ga0207691_10549009 3300025940 Bacteria 980
207 Ga0207691_11320029 3300025940 Bacteria 595
208 Ga0207711_10103666 3300025941 Bacteria 2519
209 Ga0207689_10806309 3300025942 Bacteria 792
210 Ga0207661_10083766 3300025944 Bacteria 2639
211 Ga0207679_10131907 3300025945 Bacteria 2006
212 Ga0207679_11073960 3300025945 Bacteria 738
213 Ga0207712_10369251 3300025961 Bacteria 1198
214 Ga0207640_10505924 3300025981 Bacteria 1007
215 Ga0207678_10000606 3300026067 Bacteria 32930
216 Ga0207678_10464406 3300026067 Bacteria 1101
217 Ga0207702_11101212 3300026078 Bacteria 788
218 Ga0207641_10006209 3300026088 Bacteria 10105
219 Ga0207676_10659960 3300026095 Bacteria 1010
220 Ga0207674_10295267 3300026116 Bacteria 1569
221 Ga0207674_11393650 3300026116 Bacteria 670
222 Ga0207675_100801523 3300026118 Bacteria 955
223 Ga0265338_10012871 3300028800 Bacteria 9506
224 Ga0307512_10179846 3300030522 Bacteria 1191
225 Ga0265327_10000964 3300031251 Bacteria 41214
226 Ga0265327_10001314 3300031251 Bacteria 32362
227 Ga0265327_10114638 3300031251 Bacteria 1283
228 Ga0307513_10115988 3300031456 Bacteria 2659
229 Ga0307509_10143331 3300031507 Bacteria 2320
230 Ga0307508_10320342 3300031616 Bacteria 1142
231 Ga0307514_10291094 3300031649 Bacteria 924
232 Ga0307405_10006018 3300031731 Bacteria 5926
233 Ga0307405_10426839 3300031731 Bacteria 1045
234 Ga0307405_10897532 3300031731 Bacteria 749
235 Ga0307413_10313545 3300031824 Bacteria 1195
236 Ga0307413_10962971 3300031824 Bacteria 729
237 Ga0307518_10005504 3300031838 Bacteria 9066
238 Ga0307410_10046034 3300031852 Bacteria 2909
239 Ga0307410_10573276 3300031852 Bacteria 938
240 Ga0307406_10012448 3300031901 Bacteria 4853
241 Ga0307406_10156594 3300031901 Bacteria 1632
242 Ga0307406_10171308 3300031901 Bacteria 1571
243 Ga0307406_11673017 3300031901 Bacteria 563
244 Ga0307407_10203561 3300031903 Bacteria 1328
245 Ga0307412_10099074 3300031911 Bacteria 2057
246 Ga0307412_10902062 3300031911 Bacteria 775
247 Ga0307412_11166485 3300031911 Bacteria 688
248 Ga0307409_100007119 3300031995 Bacteria 6659
249 Ga0307409_100278005 3300031995 Bacteria 1546
250 Ga0307409_100593740 3300031995 Bacteria 1093
251 Ga0307416_100000794 3300032002 Bacteria 16600
252 Ga0307416_101227954 3300032002 Bacteria 855
253 Ga0307411_10279627 3300032005 Bacteria 1328
254 Ga0307415_100000118 3300032126 Bacteria 33940
255 Ga0307415_100186351 3300032126 Bacteria 1633
256 Ga0307415_100610659 3300032126 Bacteria 972
257 Ga0307415_100935471 3300032126 Bacteria 801
258 Ga0316583_10005029 3300032133 Bacteria 4731
259 Ga0316593_10007097 3300032168 Unclassified 3062
260 Ga0316593_10037187 3300032168 Bacteria 1607
261 Ga0316593_10128759 3300032168 Unclassified 912
262 Ga0316593_10324076 3300032168 Bacteria 586
263 Ga0307507_10013032 3300033179 Bacteria 10167
264 Ga0307507_10200636 3300033179 Bacteria 1381
265 Ga0316586_1022130 3300033527 Unclassified 1055
266 Ga0373946_0651691 3300035171 Bacteria 548
267 Ga0373935_0082802 3300035692 Bacteria 2088
268 Ga0373937_0179619 3300036401 Bacteria 1987
269 Ga0436364_0182297 3300037853 Bacteria 530
270 Ga0436364_0457328 3300037853 Bacteria 518
271 Ga0436364_0677668 3300037853 Bacteria 3973
272 Ga0436365_1613820 3300039437 Bacteria 2177
273 Ga0436362_1093623 3300039453 Bacteria 556
274 Ga0439461_0010018 3300041410 Bacteria 1731
275 Ga0439466_0003951 3300041411 Bacteria 5716
276 Ga0439465_0005855 3300041413 Bacteria 3911
277 Ga0451797_1377249 3300041453 Bacteria 1945
278 Ga0451837_1078581 3300041494 Bacteria 1451
279 Ga0451853_2194853 3300041512 Bacteria 3576
280 Ga0439442_000485 3300042002 Bacteria 9050
281 Ga0439434_0022873 3300042435 Bacteria 1880
282 Ga0466969_0208745 3300044656 Bacteria 890
283 Ga0466972_0011638 3300044658 Bacteria 4417
284 Ga0466972_0015934 3300044658 Bacteria 3759
285 Ga0466972_0070232 3300044658 Bacteria 1671
286 Ga0466965_0234790 3300044683 Bacteria 980
287 Ga0466966_0151120 3300044684 Bacteria 1416
288 Ga0466961_0585287 3300044693 Bacteria 671
289 Ga0466971_0051644 3300044719 Bacteria 1851
290 Ga0466970_0207674 3300044765 Bacteria 1090
291 Ga0466970_0226606 3300044765 Bacteria 1044
292 Ga0466957_0297058 3300044842 Bacteria 1084
293 Ga0466960_0090918 3300044901 Bacteria 1556
294 Ga0466960_0405954 3300044901 Bacteria 785
295 Ga0466959_0004691 3300045049 Bacteria 9203
296 Ga0466959_0574853 3300045049 Bacteria 759
297 Ga0466958_0005121 3300045836 Bacteria 7007
298 Ga0466967_0004996 3300045976 Bacteria 9081
299 Ga0466967_0057429 3300045976 Bacteria 3436
300 Ga0466967_0309116 3300045976 Bacteria 1522
301 Ga0466967_0335370 3300045976 Bacteria 1461
302 Ga0466967_1818032 3300045976 Bacteria 606
303 Ga0495603_0056347 3300046455 Bacteria 2327
304 Ga0495629_0004180 3300046459 Bacteria 10839
305 Ga0495638_0554238 3300046460 Bacteria 571
306 Ga0495650_0075068 3300046471 Bacteria 1316
307 Ga0495582_0042593 3300046473 Bacteria 2500
308 Ga0495639_0041960 3300046475 Bacteria 2062
309 Ga0495618_0081288 3300046514 Bacteria 2069
310 Ga0495630_0249472 3300046517 Bacteria 1356
311 Ga0495666_0138104 3300046526 Bacteria 1137
312 Ga0495665_0078559 3300046531 Bacteria 1736
313 Ga0495640_0017811 3300046533 Bacteria 5284
314 Ga0495645_0177392 3300046543 Bacteria 1462
315 Ga0495647_0245172 3300046681 Bacteria 796
316 Ga0495624_0008208 3300046690 Bacteria 7302
317 Ga0495674_0178498 3300047319 Bacteria 1769
318 Ga0495676_0057664 3300047321 Bacteria 3061
319 Ga0495593_0012968 3300047673 Bacteria 4760
320 Ga0495602_0427802 3300048088 Bacteria 939
321 Ga0495626_0260843 3300048091 Bacteria 693
322 Ga0496100_0018003 3300048903 Bacteria 4183
323 Ga0496102_0000772 3300048905 Bacteria 31172
324 Ga0496102_1388177 3300048905 Bacteria 621
325 Ga0496103_0000018 3300048906 Bacteria 239585
326 Ga0496104_0032982 3300048907 Bacteria 4821
327 Ga0496104_0122891 3300048907 Bacteria 2492
328 Ga0496105_0021024 3300048908 Bacteria 5278
329 Ga0496106_0273285 3300048909 Bacteria 1353
330 Ga0496108_1180557 3300048911 Bacteria 648
331 Ga0496108_1257238 3300048911 Bacteria 624
332 Ga0496110_0334203 3300048913 Bacteria 1380
333 Ga0496112_0037304 3300048915 Bacteria 4744
334 Ga0496113_0267422 3300048916 Bacteria 1366
335 Ga0496114_0009478 3300048917 Bacteria 7730
336 Ga0496114_0523317 3300048917 Bacteria 1049
337 Ga0496115_0902114 3300048918 Unclassified 681
338 Ga0496116_0000173 3300048919 Bacteria 129928
339 Ga0496117_0000144 3300048920 Bacteria 153831
340 Ga0496118_0000096 3300048921 Bacteria 163988
341 Ga0496119_0001793 3300048922 Bacteria 25009
342 Ga0496120_0008987 3300048923 Bacteria 7147
343 Ga0496121_0008709 3300048924 Bacteria 11847
344 Ga0496122_0586434 3300048925 Bacteria 524
345 Ga0496124_0069821 3300048927 Bacteria 2915
346 Ga0496125_0070976 3300048928 Bacteria 2723
347 Ga0496125_0499148 3300048928 Bacteria 685
348 Ga0496126_0000330 3300048929 Bacteria 101064
349 Ga0501306_070132 3300049127 Bacteria 590
350 Ga0501310_025215 3300049130 Bacteria 764
351 Ga0501305_008825 3300049161 Bacteria 1312
352 Ga0501034_1195235 3300049571 Bacteria 639
353 Ga0501038_0621654 3300049574 Bacteria 816
354 Ga0501040_0366186 3300049576 Bacteria 1033
355 Ga0501040_0556795 3300049576 Bacteria 828
356 Ga0501040_0778458 3300049576 Bacteria 692
357 Ga0501047_0039136 3300049581 Bacteria 4587
358 Ga0501048_1310822 3300049582 Bacteria 521
359 Ga0501069_0081785 3300049585 Bacteria 1820
360 Ga0501069_0457530 3300049585 Bacteria 759
361 Ga0501071_0568603 3300049587 Bacteria 871
362 Ga0501073_0127081 3300049589 Bacteria 1767
363 Ga0501080_0215720 3300049742 Bacteria 1758
364 nmdc:mga03683_93418_c1 3300050489 Bacteria 1314
365 nmdc:mga03n38_13824_c1 3300050490 Bacteria 3078
366 nmdc:mga03n38_83635_c1 3300050490 Bacteria 1505
367 nmdc:mga00v17_312083_c1 3300050491 Bacteria 1022
368 nmdc:mga00v17_471484_c1 3300050491 Bacteria 815
369 nmdc:mga07m45_11392_c1 3300050496 Bacteria 4670
370 nmdc:mga05p37_1108964_c1 3300050507 Bacteria 828
371 nmdc:mga05p37_450815_c1 3300050507 Bacteria 1489
372 nmdc:mga09592_307957_c1 3300050508 Bacteria 1373
373 nmdc:mga0qj67_14322_c1 3300050509 Bacteria 5993
374 nmdc:mga06r32_106286_c1 3300050510 Bacteria 2758
375 nmdc:mga06r32_1796663_c1 3300050510 Bacteria 549
376 nmdc:mga06r32_18990_c1 3300050510 Bacteria 6302
377 nmdc:mga06r32_362385_c1 3300050510 Bacteria 1433
378 nmdc:mga06r32_36773_c1 3300050510 Bacteria 4629
379 nmdc:mga08y16_386272_c1 3300050511 Bacteria 1434
380 nmdc:mga08y16_49339_c1 3300050511 Bacteria 4405
381 nmdc:mga0n895_241955_c1 3300050512 Bacteria 1831
382 nmdc:mga0rr50_323320_c1 3300050513 Bacteria 1293
383 Ga0495595_0153704 3300053084 Bacteria 1133
384 Ga0500578_0535061 3300053086 Bacteria 654
385 Ga0500644_0522375 3300053088 Bacteria 523
386 Ga0500646_0006492 3300053090 Bacteria 2974
387 Ga0500583_0000768 3300053092 Bacteria 9330
388 Ga0500654_085765 3300053099 Bacteria 1436
389 Ga0500588_0005392 3300053146 Bacteria 2841
390 Ga0500634_0335670 3300053161 Bacteria 583
391 Ga0587066_088523 3300059490 Bacteria 683
392 Ga0587070_167628 3300059491 Bacteria 563
393 Ga0587073_0048047 3300059492 Bacteria 957
394 Ga0587073_0156324 3300059492 Bacteria 649
395 Ga0587073_0239363 3300059492 Bacteria 564
396 Ga0587073_0305527 3300059492 Bacteria 519
397 Ga0587083_0042784 3300059505 Bacteria 956
398 Ga0587083_0241855 3300059505 Bacteria 534
399 Ga0587085_067241 3300059506 Bacteria 692
400 Ga0587086_055426 3300059507 Bacteria 649
401 Ga0587091_092108 3300059511 Bacteria 698
402 Ga0587106_030126 3300059605 Bacteria 866
403 Ga0587121_09600 3300059606 Bacteria 600
404 Ga0587125_034624 3300059607 Bacteria 659
405 Ga0587067_077010 3300059640 Bacteria 731
406 Ga0587072_096762 3300059643 Bacteria 658
407 Ga0587078_025141 3300059646 Bacteria 775
408 Ga0587100_028938 3300059648 Bacteria 579
409 Ga0587111_0088266 3300060346 Bacteria 753
410 Ga0587111_0190889 3300060346 Bacteria 575
411 Ga0501082_1043698 3300060353 Bacteria 715
412 Ga0466962_0108119 3300061719 Bacteria 1338
413 Ga0451793_1783910
414 JGI24752J21851_1045878
415 JGI24746J21847_1020088
416 JGI24739J22299_10160778
417 JGI24737J22298_10163278
418 JGI24737J22298_10253976
419 JGI24743J22301_10007446
420 JGI24735J21928_10185425
421 JGI24738J21930_10025700
422 JGI24034J26672_10009779
423 Ga0007417J51691_1061249
424 Ga0058863_11932008
425 Ga0058860_12149464
426 Ga0070683_100004374
427 Ga0070683_100094315
428 Ga0070670_101478067
429 Ga0068869_100127628
430 Ga0068869_100722804
431 Ga0070666_10669767
432 Ga0070680_100450871
433 Ga0070680_100958102
434 Ga0070682_100000797
435 Ga0070682_100387035
436 Ga0068868_100004107
437 Ga0070660_100550363
438 Ga0070689_101114718
439 Ga0070689_101561924
440 Ga0070691_10556911
441 Ga0070668_100049659
442 Ga0070668_100050250
443 Ga0070668_100266799
444 Ga0070675_100634271
445 Ga0070675_100992885
446 Ga0070671_100000692
447 Ga0070673_100064789
448 Ga0070659_100073278
449 Ga0070667_100837534
450 Ga0070709_10255663
451 Ga0070714_100218491
452 Ga0070714_100300386
453 Ga0070714_100477759
454 Ga0070713_100028369
455 Ga0070710_10528365
456 Ga0070711_100036438
457 Ga0070705_100745367
458 Ga0070700_100000892
459 Ga0070694_100007200
460 Ga0070663_100000409
461 Ga0070663_100116754
462 Ga0070663_101729362
463 Ga0070678_100283974
464 Ga0070678_101005299
465 Ga0070662_101665881
466 Ga0070681_10051164
467 Ga0070685_10007458
468 Ga0070706_100173082
469 Ga0070707_101186319
470 Ga0070679_100446573
471 Ga0070684_100019734
472 Ga0070684_100286417
473 Ga0070696_100557442
474 Ga0070696_101563420
475 Ga0070665_100111165
476 Ga0070665_100913109
477 Ga0070704_100470619
478 Ga0068855_101793461
479 Ga0070664_100102297
480 Ga0070664_100127634
481 Ga0068854_100050934
482 Ga0068856_100008031
483 Ga0068856_100935123
484 Ga0070702_100183856
485 Ga0068852_100160312
486 Ga0068859_100332802
487 Ga0068859_100674862
488 Ga0068864_100033985
489 Ga0068864_100806843
490 Ga0068866_10619741
491 Ga0068861_100568731
492 Ga0068863_100002624
493 Ga0068863_100217994
494 Ga0068860_100573983
495 Ga0081538_10046986
496 Ga0081539_10123497
497 Ga0081539_10208624
498 Ga0070717_10100373
499 Ga0070717_10152056
500 Ga0070717_10826892
501 Ga0075363_100098065
502 Ga0075364_10004937
503 Ga0075364_10571749
504 Ga0070715_10765658
505 Ga0070712_100101510
506 Ga0070712_100117043
507 Ga0075367_10166767
508 Ga0075367_10315096
509 Ga0075367_10325079
510 Ga0075369_10087272
511 Ga0075366_10302464
512 Ga0075370_10223737
513 Ga0075428_100003373
514 Ga0075428_100193345
515 Ga0075428_100220583
516 Ga0075428_100224490
517 Ga0075428_100589441
518 Ga0075428_100709318
519 Ga0075430_100024160
520 Ga0075430_100526850
521 Ga0075431_100011790
522 Ga0075431_100025370
523 Ga0075431_100067257
524 Ga0075431_100102041
525 Ga0075431_100430523
526 Ga0075433_10068428
527 Ga0075434_100115069
528 Ga0075429_100369490
529 Ga0075429_100471531
530 Ga0075436_100060287
531 Ga0097620_100332804
532 Ga0097620_100674855
533 Ga0075435_100046851
534 Ga0075435_100607137
535 Ga0099795_10227406
536 Ga0105251_10045883
537 Ga0111539_10035424
538 Ga0111539_10479438
539 Ga0111539_10991859
540 Ga0111539_11009286
541 Ga0105245_12160333
542 Ga0105247_10091085
543 Ga0105247_11710592
544 Ga0114129_10003146
545 Ga0114129_10170423
546 Ga0114129_10401715
547 Ga0114129_10434785
548 Ga0114129_10953631
549 Ga0114129_12302937
550 Ga0114129_12508908
551 Ga0114129_12996686
552 Ga0105243_10048684
553 Ga0105248_12181462
554 Ga0105237_10040586
555 Ga0105237_10147216
556 Ga0105237_10728003
557 Ga0105249_10325732
558 Ga0105249_11113575
559 Ga0105239_10009439
560 Ga0105239_10027156
561 Ga0105246_10058712
562 Ga0105246_10479198
563 Ga0157323_1004742
564 Ga0157371_10400444
565 Ga0157374_10010605
566 Ga0157374_10239210
567 Ga0157378_10705964
568 Ga0163162_11242216
569 Ga0157375_10137679
570 Ga0157375_10459974
571 Ga0157375_11051103
572 Ga0163163_10217286
573 Ga0163163_10374432
574 Ga0157380_10516643
575 Ga0157380_10827176
576 Ga0157377_10224613
577 Ga0157379_10039182
578 Ga0157379_10042474
579 Ga0157379_10468898
580 Ga0157379_11548166
581 Ga0157376_10569399
582 Ga0157376_11347956
583 Ga0197907_10292858
584 Ga0197907_11051494
585 Ga0197907_11084100
586 Ga0206356_10167142
587 Ga0206356_10212770
588 Ga0206356_10469993
589 Ga0206349_1313087
590 Ga0206349_1580678
591 Ga0206355_1054953
592 Ga0206355_1537185
593 Ga0206352_10035001
594 Ga0206352_10355978
595 Ga0206352_10413347
596 Ga0206352_10433851
597 Ga0206352_10682473
598 Ga0206350_10833008
599 Ga0206354_10550371
600 Ga0206354_11433134
601 Ga0206353_10389610
602 Ga0206353_10617559
603 Ga0224712_10090062
604 Ga0207710_10062305
605 Ga0207680_10399726
606 Ga0207643_10499882
607 Ga0207643_10828009
608 Ga0207705_10665920
609 Ga0207707_10872133
610 Ga0207671_10075674
611 Ga0207650_10337764
612 Ga0207664_10098416
613 Ga0207664_10116633
614 Ga0207706_10046682
615 Ga0207670_10164043
616 Ga0207670_10757423
617 Ga0207704_10919866
618 Ga0207691_10549009
619 Ga0207691_11320029
620 Ga0207711_10103666
621 Ga0207689_10806309
622 Ga0207661_10083766
623 Ga0207679_10131907
624 Ga0207679_11073960
625 Ga0207712_10369251
626 Ga0207640_10505924
627 Ga0207678_10000606
628 Ga0207678_10464406
629 Ga0207702_11101212
630 Ga0207641_10006209
631 Ga0207676_10659960
632 Ga0207674_10295267
633 Ga0207674_11393650
634 Ga0207675_100801523
635 Ga0265338_10012871
636 Ga0307512_10179846
637 Ga0265327_10000964
638 Ga0265327_10001314
639 Ga0265327_10114638
640 Ga0307513_10115988
641 Ga0307509_10143331
642 Ga0307508_10320342
643 Ga0307514_10291094
644 Ga0307405_10006018
645 Ga0307405_10426839
646 Ga0307405_10897532
647 Ga0307413_10313545
648 Ga0307413_10962971
649 Ga0307518_10005504
650 Ga0307410_10046034
651 Ga0307410_10573276
652 Ga0307406_10012448
653 Ga0307406_10156594
654 Ga0307406_10171308
655 Ga0307406_11673017
656 Ga0307407_10203561
657 Ga0307412_10099074
658 Ga0307412_10902062
659 Ga0307412_11166485
660 Ga0307409_100007119
661 Ga0307409_100278005
662 Ga0307409_100593740
663 Ga0307416_100000794
664 Ga0307416_101227954
665 Ga0307411_10279627
666 Ga0307415_100000118
667 Ga0307415_100186351
668 Ga0307415_100610659
669 Ga0307415_100935471
670 Ga0316583_10005029
671 Ga0316593_10007097
672 Ga0316593_10037187
673 Ga0316593_10128759
674 Ga0316593_10324076
675 Ga0307507_10013032
676 Ga0307507_10200636
677 Ga0316586_1022130
678 Ga0373946_0651691
679 Ga0373935_0082802
680 Ga0373937_0179619
681 Ga0436364_0182297
682 Ga0436364_0457328
683 Ga0436364_0677668
684 Ga0436365_1613820
685 Ga0436362_1093623
686 Ga0439461_0010018
687 Ga0439466_0003951
688 Ga0439465_0005855
689 Ga0451797_1377249
690 Ga0451837_1078581
691 Ga0451853_2194853
692 Ga0439442_000485
693 Ga0439434_0022873
694 Ga0466969_0208745
695 Ga0466972_0011638
696 Ga0466972_0015934
697 Ga0466972_0070232
698 Ga0466965_0234790
699 Ga0466966_0151120
700 Ga0466961_0585287
701 Ga0466971_0051644
702 Ga0466970_0207674
703 Ga0466970_0226606
704 Ga0466957_0297058
705 Ga0466960_0090918
706 Ga0466960_0405954
707 Ga0466959_0004691
708 Ga0466959_0574853
709 Ga0466958_0005121
710 Ga0466967_0004996
711 Ga0466967_0057429
712 Ga0466967_0309116
713 Ga0466967_0335370
714 Ga0466967_1818032
715 Ga0495603_0056347
716 Ga0495629_0004180
717 Ga0495638_0554238
718 Ga0495650_0075068
719 Ga0495582_0042593
720 Ga0495639_0041960
721 Ga0495618_0081288
722 Ga0495630_0249472
723 Ga0495666_0138104
724 Ga0495665_0078559
725 Ga0495640_0017811
726 Ga0495645_0177392
727 Ga0495647_0245172
728 Ga0495624_0008208
729 Ga0495674_0178498
730 Ga0495676_0057664
731 Ga0495593_0012968
732 Ga0495602_0427802
733 Ga0495626_0260843
734 Ga0496100_0018003
735 Ga0496102_0000772
736 Ga0496102_1388177
737 Ga0496103_0000018
738 Ga0496104_0032982
739 Ga0496104_0122891
740 Ga0496105_0021024
741 Ga0496106_0273285
742 Ga0496108_1180557
743 Ga0496108_1257238
744 Ga0496110_0334203
745 Ga0496112_0037304
746 Ga0496113_0267422
747 Ga0496114_0009478
748 Ga0496114_0523317
749 Ga0496115_0902114
750 Ga0496116_0000173
751 Ga0496117_0000144
752 Ga0496118_0000096
753 Ga0496119_0001793
754 Ga0496120_0008987
755 Ga0496121_0008709
756 Ga0496122_0586434
757 Ga0496124_0069821
758 Ga0496125_0070976
759 Ga0496125_0499148
760 Ga0496126_0000330
761 Ga0501306_070132
762 Ga0501310_025215
763 Ga0501305_008825
764 Ga0501034_1195235
765 Ga0501038_0621654
766 Ga0501040_0366186
767 Ga0501040_0556795
768 Ga0501040_0778458
769 Ga0501047_0039136
770 Ga0501048_1310822
771 Ga0501069_0081785
772 Ga0501069_0457530
773 Ga0501071_0568603
774 Ga0501073_0127081
775 Ga0501080_0215720
776 nmdc:mga03683_93418_c1
777 nmdc:mga03n38_13824_c1
778 nmdc:mga03n38_83635_c1
779 nmdc:mga00v17_312083_c1
780 nmdc:mga00v17_471484_c1
781 nmdc:mga07m45_11392_c1
782 nmdc:mga05p37_1108964_c1
783 nmdc:mga05p37_450815_c1
784 nmdc:mga09592_307957_c1
785 nmdc:mga0qj67_14322_c1
786 nmdc:mga06r32_106286_c1
787 nmdc:mga06r32_1796663_c1
788 nmdc:mga06r32_18990_c1
789 nmdc:mga06r32_362385_c1
790 nmdc:mga06r32_36773_c1
791 nmdc:mga08y16_386272_c1
792 nmdc:mga08y16_49339_c1
793 nmdc:mga0n895_241955_c1
794 nmdc:mga0rr50_323320_c1
795 Ga0495595_0153704
796 Ga0500578_0535061
797 Ga0500644_0522375
798 Ga0500646_0006492
799 Ga0500583_0000768
800 Ga0500654_085765
801 Ga0500588_0005392
802 Ga0500634_0335670
803 Ga0587066_088523
804 Ga0587070_167628
805 Ga0587073_0048047
806 Ga0587073_0156324
807 Ga0587073_0239363
808 Ga0587073_0305527
809 Ga0587083_0042784
810 Ga0587083_0241855
811 Ga0587085_067241
812 Ga0587086_055426
813 Ga0587091_092108
814 Ga0587106_030126
815 Ga0587121_09600
816 Ga0587125_034624
817 Ga0587067_077010
818 Ga0587072_096762
819 Ga0587078_025141
820 Ga0587100_028938
821 Ga0587111_0088266
822 Ga0587111_0190889
823 Ga0501082_1043698
824 Ga0466962_0108119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

106

174

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

44

101

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.991 71 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9879 71 140
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9864 71 140
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9741 71 140
1s72-assembly1.cif.gz_I refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution 0.9737 73 140
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9909 72 139 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9699 73 140 1.10.10.250
af_P54030_78_161_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9691 80 139 1.10.10.250
1hc8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9689 67 140 1.10.10.250
2qa4I02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9595 72 133 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A645A187-F1-model_v4 50S ribosomal protein L11 1.002 78 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7C3NAE7-F1-model_v4 50S ribosomal protein L11 1.002 76 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A2S7TEL3-F1-model_v4 deleted 1.001 73 140
AF-D6SXA2-F1-model_v4 deleted 1.001 79 140
AF-A0A356V906-F1-model_v4 50S ribosomal protein L11 1 72 140 GO:0003735
GO:0006412
GO:0022625
GO:0070180

Map