F436963

General Info

Members Datasets Scaffolds Average Seq Length
409 226 321 319

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100014104|Ga0075436_1000141042
Length 325
Sequence MTRIWVAGHRGLVGSALTRRLSTVSGVELILRSHSELDLDDAHAVDAFLLRERPEQIYLAAALVGGILANNTRPADFIVSNLGIQLNVVTAAYRTGVSKLLFLGSSCIYPKLAPQPIKEEALLTGPLEPTNEAYAVAKIAGIQLCRSYNRQYGTNFISVMPTNLYGPNDNFDPVRSHVLPALIRRFHEAKESGLPTVTIWGTGTPRREFLHVDDLADACVHVMANHSGNELINIGCGEDISIKELAQMVADAVEYRGEILFDPSKPDGTPRKLLDVSRLTALGWRPRIGLAEGIASTYAWYVSNTVATASPRGREERVPSRTSRR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132181 Kosakonia sacchari SP1 Isolate Stem
3 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
4 2561511199 Enterobacter sp. R4-368 Isolate Nodule
5 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
6 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
7 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
8 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
9 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
10 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
11 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
12 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
13 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
14 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
15 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
16 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
17 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
18 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
19 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
20 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
21 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
22 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
23 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
24 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
25 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
26 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
27 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
28 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
29 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
30 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
31 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
32 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
33 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
34 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
35 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
36 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
37 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
38 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
39 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
40 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
41 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
42 2751185917 Enterobacter sp. HK169 Isolate Unclassified
43 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
44 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
45 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
46 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
47 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
48 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
49 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
50 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
51 2821118458 Enterobacter asburiae 609 Isolate Unclassified
52 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
53 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
54 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
55 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
56 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
57 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
58 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
59 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
60 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
61 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
62 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
63 2937539931 Pantoea sp. LS15 Isolate Unclassified
64 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
65 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
66 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
67 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
68 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
69 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
70 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
71 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
72 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
73 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
74 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
77 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
78 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
102 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
103 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
104 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
129 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
152 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
153 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
154 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
163 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
216 8018221730 Enterobacter sp. CM29 Isolate Unclassified
217 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
218 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
219 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
220 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
221 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
222 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
223 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
224 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
225 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
226 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.48
Metatranscriptomes 0
Isolates 21.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.71
Nodule 5.13
Rhizoplane 9.78
Rhizosphere 59.17
Stem 0.24
Stem Tuber 0.24
Unclassified 23.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1050960 2162886007 Bacteria 1225
2 SwRhRL2b_contig_3310149 2162886007 Bacteria 3373
3 SwRhRL2b_contig_438547 2162886007 Bacteria 15152
4 SwRhRL2b_contig_589886 2162886007 Bacteria 8538
5 JGI25152J39213_1000916 3300002773 Bacteria 14450
6 rootH2_10021200 3300003320 Bacteria 27262
7 Ga0058692_1002767 3300003856 Bacteria 5769
8 Ga0058692_1008896 3300003856 Bacteria 2568
9 Ga0058692_1031008 3300003856 Bacteria 1010
10 Ga0065704_10000261 3300005289 Bacteria 53884
11 Ga0065704_10001771 3300005289 Bacteria 11982
12 Ga0065704_10007283 3300005289 Bacteria 4206
13 Ga0065704_10070547 3300005289 Bacteria 20984
14 Ga0065704_10070603 3300005289 Bacteria 19322
15 Ga0065704_10070655 3300005289 Bacteria 18241
16 Ga0065704_10098554 3300005289 Bacteria 2348
17 Ga0070661_100000132 3300005344 Bacteria 62286
18 Ga0070665_100000464 3300005548 Bacteria 58895
19 Ga0070665_100142763 3300005548 Bacteria 2398
20 Ga0068855_100070886 3300005563 Bacteria 4053
21 Ga0070664_100000361 3300005564 Bacteria 33502
22 Ga0081539_10000169 3300005985 Bacteria 153327
23 Ga0075364_10001491 3300006051 Bacteria 12746
24 Ga0075364_10026078 3300006051 Bacteria 3726
25 Ga0075436_100014104 3300006914 Bacteria 5471
26 Ga0079104_1000018 3300006946 Bacteria 271088
27 Ga0079104_1000163 3300006946 Bacteria 94189
28 Ga0079104_1000282 3300006946 Bacteria 65218
29 Ga0079104_1000384 3300006946 Bacteria 51458
30 Ga0079104_1001040 3300006946 Bacteria 21223
31 Ga0079104_1003345 3300006946 Bacteria 7554
32 Ga0079104_1010026 3300006946 Bacteria 3156
33 Ga0079104_1015504 3300006946 Bacteria 2256
34 Ga0079104_1022487 3300006946 Bacteria 1695
35 Ga0105251_10000316 3300009011 Bacteria 48415
36 Ga0105251_10000616 3300009011 Bacteria 32710
37 Ga0105251_10001421 3300009011 Bacteria 20627
38 Ga0105251_10002419 3300009011 Bacteria 14710
39 Ga0105251_10005285 3300009011 Bacteria 8495
40 Ga0105244_10000009 3300009036 Bacteria 286143
41 Ga0105244_10001145 3300009036 Bacteria 21988
42 Ga0105244_10001592 3300009036 Bacteria 18035
43 Ga0105244_10002251 3300009036 Bacteria 14677
44 Ga0105244_10003335 3300009036 Bacteria 11539
45 Ga0105244_10011180 3300009036 Bacteria 5402
46 Ga0105244_10011239 3300009036 Bacteria 5385
47 Ga0105244_10012249 3300009036 Bacteria 5079
48 Ga0105244_10013935 3300009036 Bacteria 4671
49 Ga0105244_10014568 3300009036 Bacteria 4543
50 Ga0105244_10070976 3300009036 Bacteria 1736
51 Ga0105244_10071350 3300009036 Bacteria 1731
52 Ga0105244_10087966 3300009036 Bacteria 1530
53 Ga0105250_10002931 3300009092 Bacteria 8327
54 Ga0105250_10006868 3300009092 Bacteria 4938
55 Ga0105250_10021188 3300009092 Bacteria 2624
56 Ga0105250_10093973 3300009092 Bacteria 1221
57 Ga0105240_10077063 3300009093 Bacteria 4109
58 Ga0105243_10115084 3300009148 Bacteria 2258
59 Ga0105248_10115518 3300009177 Bacteria 3027
60 Ga0157373_10000633 3300013100 Bacteria 27561
61 Ga0157373_10083851 3300013100 Bacteria 2246
62 Ga0157371_10097398 3300013102 Bacteria 2085
63 Ga0157371_10187375 3300013102 Bacteria 1481
64 Ga0157370_10005565 3300013104 Bacteria 14122
65 Ga0157370_10028635 3300013104 Bacteria 5477
66 Ga0157370_10223183 3300013104 Bacteria 1745
67 Ga0157369_10003354 3300013105 Bacteria 19017
68 Ga0157369_10003620 3300013105 Bacteria 18346
69 Ga0157369_10323521 3300013105 Bacteria 1603
70 Ga0163162_10001271 3300013306 Bacteria 23584
71 Ga0157372_10003323 3300013307 Bacteria 17379
72 Ga0157372_10410238 3300013307 Bacteria 1579
73 Ga0163163_10183235 3300014325 Bacteria 2141
74 Ga0182006_1000018 3300015261 Bacteria 299376
75 Ga0183366_1001 3300015679 Bacteria 2743932
76 Ga0183370_1001 3300015680 Bacteria 2743932
77 Ga0183369_1001 3300015685 Bacteria 2743932
78 Ga0183368_1001 3300015687 Bacteria 2743932
79 Ga0163161_10005064 3300017792 Bacteria 9169
80 Ga0213872_10004354 3300021361 Bacteria 7541
81 Ga0213876_10000034 3300021384 Bacteria 202967
82 Ga0209129_1000077 3300025258 Bacteria 193474
83 Ga0207696_1000053 3300025711 Bacteria 268590
84 Ga0207696_1003107 3300025711 Bacteria 7739
85 Ga0207696_1003258 3300025711 Bacteria 7491
86 Ga0207696_1003767 3300025711 Bacteria 6764
87 Ga0207655_1000002 3300025728 Bacteria 1148694
88 Ga0207655_1000004 3300025728 Bacteria 1021221
89 Ga0207655_1000005 3300025728 Bacteria 917277
90 Ga0207655_1000015 3300025728 Bacteria 600662
91 Ga0207655_1000036 3300025728 Bacteria 356747
92 Ga0207655_1000584 3300025728 Bacteria 45065
93 Ga0207655_1000744 3300025728 Bacteria 36545
94 Ga0207655_1000911 3300025728 Bacteria 30763
95 Ga0207655_1002241 3300025728 Bacteria 15993
96 Ga0207655_1005985 3300025728 Bacteria 8141
97 Ga0207655_1013555 3300025728 Bacteria 4671
98 Ga0207655_1017681 3300025728 Bacteria 3833
99 Ga0207655_1059717 3300025728 Bacteria 1482
100 Ga0207655_1079312 3300025728 Bacteria 1190
101 Ga0207713_1000012 3300025735 Bacteria 501860
102 Ga0207713_1001283 3300025735 Bacteria 20705
103 Ga0207713_1008241 3300025735 Bacteria 6029
104 Ga0207713_1019205 3300025735 Bacteria 3354
105 Ga0207713_1024307 3300025735 Bacteria 2829
106 Ga0207705_10193172 3300025909 Bacteria 1540
107 Ga0207695_10031246 3300025913 Bacteria 5845
108 Ga0207649_10000002 3300025920 Bacteria 498633
109 Ga0207679_10000006 3300025945 Bacteria 498868
110 Ga0207667_10134560 3300025949 Bacteria 2545
111 Ga0209281_1000004 3300027111 Bacteria 1253949
112 Ga0209281_1000006 3300027111 Bacteria 1170244
113 Ga0209281_1000014 3300027111 Bacteria 643021
114 Ga0209281_1000064 3300027111 Bacteria 287876
115 Ga0209281_1000071 3300027111 Bacteria 274050
116 Ga0209281_1000257 3300027111 Bacteria 103090
117 Ga0209281_1000370 3300027111 Bacteria 72879
118 Ga0209281_1000926 3300027111 Bacteria 24167
119 Ga0209281_1001212 3300027111 Bacteria 17462
120 Ga0209281_1002173 3300027111 Bacteria 8537
121 Ga0209281_1011113 3300027111 Bacteria 2029
122 Ga0209371_1000001 3300027312 Bacteria 2771503
123 Ga0209371_1000002 3300027312 Bacteria 1551985
124 Ga0209371_1000015 3300027312 Bacteria 659640
125 Ga0209371_1000466 3300027312 Bacteria 39817
126 Ga0209371_1003979 3300027312 Bacteria 6744
127 Ga0209371_1004653 3300027312 Bacteria 5846
128 Ga0209969_1008537 3300027360 Bacteria 1454
129 Ga0209995_1001301 3300027471 Bacteria 3840
130 Ga0209968_1000324 3300027526 Bacteria 7996
131 Ga0209970_1004030 3300027614 Bacteria 2449
132 Ga0209983_1000411 3300027665 Bacteria 9214
133 Ga0209971_1000678 3300027682 Bacteria 8818
134 Ga0209966_1000009 3300027695 Bacteria 86456
135 Ga0209974_10010631 3300027876 Bacteria 3105
136 Ga0268266_10000286 3300028379 Bacteria 83269
137 Ga0265324_10000950 3300029957 Bacteria 18084
138 Ga0268256_1000001 3300030500 Bacteria 2771065
139 Ga0268256_1000002 3300030500 Bacteria 1535763
140 Ga0268256_1000018 3300030500 Bacteria 594572
141 Ga0268256_1000423 3300030500 Bacteria 38191
142 Ga0268256_1003099 3300030500 Bacteria 7771
143 Ga0268256_1004411 3300030500 Bacteria 5846
144 Ga0265328_10004660 3300031239 Bacteria 5930
145 Ga0265331_10000033 3300031250 Bacteria 203767
146 Ga0265327_10002831 3300031251 Bacteria 17498
147 Ga0307408_100000043 3300031548 Bacteria 170358
148 Ga0307408_100010716 3300031548 Bacteria 6047
149 Ga0307408_100040223 3300031548 Bacteria 3310
150 Ga0307405_10092501 3300031731 Bacteria 2006
151 Ga0307405_10125268 3300031731 Bacteria 1765
152 Ga0307413_10002037 3300031824 Bacteria 8050
153 Ga0307413_10030828 3300031824 Bacteria 3017
154 Ga0307410_10006858 3300031852 Bacteria 6185
155 Ga0307410_10021223 3300031852 Bacteria 3990
156 Ga0307406_10013026 3300031901 Bacteria 4754
157 Ga0307407_10000979 3300031903 Bacteria 9774
158 Ga0307412_10135386 3300031911 Bacteria 1796
159 Ga0307409_100004913 3300031995 Bacteria 7607
160 Ga0307416_100021574 3300032002 Bacteria 4627
161 Ga0307416_100133782 3300032002 Bacteria 2238
162 Ga0307414_10000365 3300032004 Bacteria 24767
163 Ga0307414_10004163 3300032004 Bacteria 7812
164 Ga0307414_10173664 3300032004 Bacteria 1726
165 Ga0307411_10000814 3300032005 Bacteria 11675
166 Ga0307411_10016244 3300032005 Bacteria 4211
167 Ga0307415_100002093 3300032126 Bacteria 9866
168 Ga0307415_100017236 3300032126 Bacteria 4325
169 Ga0395899_0007660 3300037312 Bacteria 8324
170 Ga0395900_0001145 3300037418 Bacteria 33427
171 Ga0395900_0160330 3300037418 Bacteria 2295
172 Ga0395900_0367376 3300037418 Bacteria 1409
173 Ga0395898_0030717 3300037466 Bacteria 5374
174 Ga0395898_0125427 3300037466 Bacteria 2460
175 Ga0395898_0268555 3300037466 Bacteria 1627
176 Ga0395905_0002266 3300037471 Bacteria 21602
177 Ga0395905_0017417 3300037471 Bacteria 6820
178 Ga0395905_0017953 3300037471 Bacteria 6718
179 Ga0395905_0023672 3300037471 Bacteria 5799
180 Ga0395901_0104015 3300038443 Bacteria 2979
181 Ga0395901_0243385 3300038443 Bacteria 1875
182 Ga0400485_22349 3300038735 Bacteria 174815
183 Ga0400488_31614 3300038741 Bacteria 4293
184 Ga0400486_19188 3300038742 Bacteria 196185
185 Ga0400483_073815 3300039062 Bacteria 2114
186 Ga0400483_118812 3300039062 Bacteria 2460
187 Ga0400483_146356 3300039062 Bacteria 1103
188 Ga0400483_226464 3300039062 Bacteria 2836
189 Ga0400483_246917 3300039062 Bacteria 4763
190 Ga0400483_259586 3300039062 Bacteria 2053
191 Ga0400483_278889 3300039062 Bacteria 2334
192 Ga0400483_289216 3300039062 Bacteria 40574
193 Ga0400487_19710 3300039110 Bacteria 103852
194 Ga0436365_0965775 3300039437 Bacteria 470291
195 Ga0436365_1517111 3300039437 Bacteria 1041
196 Ga0436361_0434733 3300039447 Bacteria 12240
197 Ga0439438_006549 3300041405 Bacteria 4090
198 Ga0451853_2364667 3300041512 Bacteria 7064
199 Ga0439432_005183 3300042006 Bacteria 4709
200 Ga0439432_006625 3300042006 Bacteria 4125
201 Ga0439452_000001 3300042010 Bacteria 1725439
202 Ga0439452_000002 3300042010 Bacteria 1377577
203 Ga0439452_000020 3300042010 Bacteria 309345
204 Ga0439452_000032 3300042010 Bacteria 184797
205 Ga0451577_0007321 3300042876 Bacteria 10863
206 Ga0451577_0032061 3300042876 Bacteria 4734
207 Ga0466981_0000003 3300044669 Bacteria 248458
208 Ga0453683_0012181 3300044673 Bacteria 5642
209 Ga0466966_0026279 3300044684 Bacteria 3802
210 Ga0466961_0004945 3300044693 Bacteria 8381
211 Ga0453684_0028685 3300044712 Bacteria 7929
212 Ga0453684_0761457 3300044712 Bacteria 1047
213 Ga0451576_0012463 3300045051 Bacteria 9546
214 Ga0495627_000231 3300046453 Bacteria 59148
215 Ga0495591_000050 3300046458 Bacteria 137772
216 Ga0495638_0003782 3300046460 Bacteria 11764
217 Ga0495650_0000047 3300046471 Bacteria 335136
218 Ga0495650_0012597 3300046471 Bacteria 4537
219 Ga0495607_0001967 3300046501 Bacteria 17332
220 Ga0495606_0011537 3300046507 Bacteria 7197
221 Ga0495610_0001566 3300046512 Bacteria 20155
222 Ga0495620_0016112 3300046515 Bacteria 3761
223 Ga0495620_0020506 3300046515 Bacteria 3227
224 Ga0495631_0000932 3300046518 Bacteria 18216
225 Ga0495632_0045141 3300046519 Bacteria 2196
226 Ga0495637_0091114 3300046520 Bacteria 1202
227 Ga0495643_0129783 3300046522 Bacteria 1266
228 Ga0495648_0007559 3300046524 Bacteria 8686
229 Ga0495654_0004322 3300046530 Bacteria 8467
230 Ga0495654_0021061 3300046530 Bacteria 3395
231 Ga0495654_0023448 3300046530 Bacteria 3196
232 Ga0495654_0027287 3300046530 Bacteria 2929
233 Ga0495597_0007223 3300046542 Bacteria 5660
234 Ga0495611_0008921 3300046648 Bacteria 4242
235 Ga0495625_0002704 3300046660 Bacteria 18817
236 Ga0495625_0004152 3300046660 Bacteria 13811
237 Ga0495661_0053793 3300046665 Bacteria 2420
238 Ga0495588_0005804 3300046674 Bacteria 5522
239 Ga0495649_0000543 3300046694 Bacteria 31982
240 Ga0495672_0000009 3300047320 Bacteria 557755
241 Ga0495672_0013254 3300047320 Bacteria 5694
242 Ga0495679_000182 3300047446 Bacteria 56097
243 Ga0495679_004012 3300047446 Bacteria 6920
244 Ga0495673_0000007 3300047469 Bacteria 796722
245 Ga0495673_0000366 3300047469 Bacteria 54627
246 Ga0496101_0220027 3300048904 Bacteria 1473
247 Ga0496102_0062601 3300048905 Bacteria 3407
248 Ga0496104_0000100 3300048907 Bacteria 83437
249 Ga0496116_0000625 3300048919 Bacteria 46424
250 Ga0496116_0048913 3300048919 Bacteria 2833
251 Ga0496116_0051926 3300048919 Bacteria 2719
252 Ga0496117_0000380 3300048920 Bacteria 76671
253 Ga0496117_0001815 3300048920 Bacteria 29016
254 Ga0496117_0002117 3300048920 Bacteria 26059
255 Ga0496117_0004656 3300048920 Bacteria 14924
256 Ga0496117_0005087 3300048920 Bacteria 14068
257 Ga0496117_0019537 3300048920 Bacteria 5560
258 Ga0496117_0027876 3300048920 Bacteria 4386
259 Ga0496117_0042482 3300048920 Bacteria 3316
260 Ga0496118_0001286 3300048921 Bacteria 38322
261 Ga0496118_0001914 3300048921 Bacteria 29615
262 Ga0496118_0002174 3300048921 Bacteria 27294
263 Ga0496118_0003204 3300048921 Bacteria 20884
264 Ga0496118_0016166 3300048921 Bacteria 6860
265 Ga0496118_0062090 3300048921 Bacteria 2761
266 Ga0496119_0000049 3300048922 Bacteria 185482
267 Ga0496119_0004419 3300048922 Bacteria 14009
268 Ga0496119_0032423 3300048922 Bacteria 3481
269 Ga0496119_0180956 3300048922 Bacteria 1105
270 Ga0496120_0002467 3300048923 Bacteria 18636
271 Ga0496120_0014802 3300048923 Bacteria 5175
272 Ga0496120_0075562 3300048923 Bacteria 1838
273 Ga0496121_0001226 3300048924 Bacteria 44634
274 Ga0496121_0001655 3300048924 Bacteria 36766
275 Ga0496121_0002497 3300048924 Bacteria 27960
276 Ga0496121_0003206 3300048924 Bacteria 23543
277 Ga0496121_0008677 3300048924 Bacteria 11872
278 Ga0496121_0019204 3300048924 Bacteria 6846
279 Ga0496121_0032811 3300048924 Bacteria 4711
280 Ga0496122_0000003 3300048925 Bacteria 645810
281 Ga0496122_0000088 3300048925 Bacteria 207600
282 Ga0496122_0000962 3300048925 Bacteria 51794
283 Ga0496122_0033213 3300048925 Bacteria 4249
284 Ga0496122_0118754 3300048925 Bacteria 1712
285 Ga0496123_0000012 3300048926 Bacteria 458760
286 Ga0496123_0000139 3300048926 Bacteria 151469
287 Ga0496123_0000750 3300048926 Bacteria 52534
288 Ga0496123_0000945 3300048926 Bacteria 45308
289 Ga0496123_0010931 3300048926 Bacteria 7941
290 Ga0496123_0053430 3300048926 Bacteria 2669
291 Ga0496123_0067029 3300048926 Bacteria 2270
292 Ga0496124_0000045 3300048927 Bacteria 287396
293 Ga0496124_0004149 3300048927 Bacteria 17104
294 Ga0496124_0005207 3300048927 Bacteria 14767
295 Ga0496124_0009549 3300048927 Bacteria 9971
296 Ga0496124_0043431 3300048927 Bacteria 3865
297 Ga0496124_0044386 3300048927 Bacteria 3814
298 Ga0496124_0119888 3300048927 Bacteria 2104
299 Ga0496125_0000065 3300048928 Bacteria 249830
300 Ga0496125_0002952 3300048928 Bacteria 21374
301 Ga0496125_0007915 3300048928 Bacteria 11221
302 Ga0496125_0008498 3300048928 Bacteria 10740
303 Ga0496125_0009175 3300048928 Bacteria 10223
304 Ga0496125_0022439 3300048928 Bacteria 5862
305 Ga0496125_0113177 3300048928 Bacteria 1958
306 Ga0496126_0002379 3300048929 Bacteria 25600
307 Ga0496126_0015139 3300048929 Bacteria 7768
308 Ga0496126_0018170 3300048929 Bacteria 6976
309 Ga0496126_0061256 3300048929 Bacteria 3380
310 Ga0501032_0061338 3300049569 Bacteria 2521
311 Ga0501070_0229198 3300049586 Bacteria 1522
312 Ga0501074_0014511 3300049590 Bacteria 5732
313 Ga0501075_0045598 3300049591 Bacteria 3291
314 Ga0501080_0004300 3300049742 Bacteria 12649
315 Ga0501035_0005690 3300049822 Bacteria 11764
316 Ga0501044_0281606 3300049823 Bacteria 1596
317 Ga0501044_0300324 3300049823 Bacteria 1535
318 nmdc:mga00v17_2168_c1 3300050491 Bacteria 10095
319 nmdc:mga07m45_3120_c1 3300050496 Bacteria 7935
320 nmdc:mga08x19_15526_c1 3300050514 Bacteria 4634
321 Ga0500618_000789 3300053125 Bacteria 17680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10323521 Ga0157369_103235212 265
2 2162886007 SwRhRL2b_contig_438547 SwRhRL2b_0643.00006480 272
3 3300005289 Ga0065704_10070655 Ga0065704_1007065513 272
4 3300048920 Ga0496117_0005087 Ga0496117_0005087_4308_5273 272
5 3300048921 Ga0496118_0003204 Ga0496118_0003204_14411_15376 272
6 3300048927 Ga0496124_0043431 Ga0496124_0043431_1338_2303 272
7 3300005344 Ga0070661_100000132 Ga0070661_10000013231 274
8 3300005564 Ga0070664_100000361 Ga0070664_1000003615 274
9 3300009036 Ga0105244_10001592 Ga0105244_1000159211 274
10 3300013105 Ga0157369_10003354 Ga0157369_1000335412 274
11 3300025728 Ga0207655_1000744 Ga0207655_100074411 274
12 3300025920 Ga0207649_10000002 Ga0207649_1000000232 274
13 3300025945 Ga0207679_10000006 Ga0207679_10000006459 274
14 3300048928 Ga0496125_0002952 Ga0496125_0002952_6903_7880 274
15 3300046520 Ga0495637_0091114 Ga0495637_0091114_321_1163 280
16 3300039062 Ga0400483_118812 Ga0400483_118812_65_916 283
17 3300042876 Ga0451577_0007321 Ga0451577_0007321_3660_4517 285
18 3300044712 Ga0453684_0028685 Ga0453684_0028685_6309_7166 285
19 3300050514 nmdc:mga08x19_15526_c1 nmdc:mga08x19_15526_c1_536_1444 287
20 3300039062 Ga0400483_146356 Ga0400483_146356_215_1090 290
21 3300009093 Ga0105240_10077063 Ga0105240_100770633 294
22 3300025913 Ga0207695_10031246 Ga0207695_100312464 294
23 3300029957 Ga0265324_10000950 Ga0265324_1000095023 294
24 3300031239 Ga0265328_10004660 Ga0265328_100046609 294
25 3300031250 Ga0265331_10000033 Ga0265331_1000003379 294
26 3300005985 Ga0081539_10000169 Ga0081539_10000169139 296
27 3300009177 Ga0105248_10115518 Ga0105248_101155182 297
28 3300014325 Ga0163163_10183235 Ga0163163_101832352 297
29 3300049591 Ga0501075_0045598 Ga0501075_0045598_1311_2321 297
30 3300006914 Ga0075436_100014104 Ga0075436_1000141042 299
31 3300031548 Ga0307408_100040223 Ga0307408_1000402232 299
32 3300031731 Ga0307405_10125268 Ga0307405_101252682 299
33 3300031824 Ga0307413_10002037 Ga0307413_100020376 299
34 3300031852 Ga0307410_10006858 Ga0307410_100068584 299
35 3300031901 Ga0307406_10013026 Ga0307406_100130262 299
36 3300031903 Ga0307407_10000979 Ga0307407_100009794 299
37 3300031995 Ga0307409_100004913 Ga0307409_1000049134 299
38 3300032002 Ga0307416_100021574 Ga0307416_1000215744 299
39 3300032005 Ga0307411_10000814 Ga0307411_100008144 299
40 3300032126 Ga0307415_100017236 Ga0307415_1000172362 299
41 3300039062 Ga0400483_073815 Ga0400483_073815_566_1519 303
42 3300039062 Ga0400483_226464 Ga0400483_226464_1405_2358 303
43 3300049823 Ga0501044_0300324 Ga0501044_0300324_487_1446 304
44 3300039437 Ga0436365_1517111 Ga0436365_1517111_50_1012 305
45 3300045051 Ga0451576_0012463 Ga0451576_0012463_7215_8183 306
46 3300048928 Ga0496125_0113177 Ga0496125_0113177_761_1702 306
47 3300005563 Ga0068855_100070886 Ga0068855_1000708862 307
48 3300013102 Ga0157371_10187375 Ga0157371_101873752 307
49 3300013104 Ga0157370_10005565 Ga0157370_1000556513 307
50 3300025949 Ga0207667_10134560 Ga0207667_101345602 307
51 3300031548 Ga0307408_100010716 Ga0307408_1000107162 307
52 3300031731 Ga0307405_10092501 Ga0307405_100925012 307
53 3300031824 Ga0307413_10030828 Ga0307413_100308283 307
54 3300031852 Ga0307410_10021223 Ga0307410_100212233 307
55 3300031911 Ga0307412_10135386 Ga0307412_101353862 307
56 3300032002 Ga0307416_100133782 Ga0307416_1001337822 307
57 3300032005 Ga0307411_10016244 Ga0307411_100162444 307
58 3300032126 Ga0307415_100002093 Ga0307415_1000020932 307
59 3300037312 Ga0395899_0007660 Ga0395899_0007660_2719_3672 307
60 3300037418 Ga0395900_0001145 Ga0395900_0001145_12763_13686 307
61 3300037466 Ga0395898_0030717 Ga0395898_0030717_982_1935 307
62 3300037471 Ga0395905_0002266 Ga0395905_0002266_19870_20793 307
63 3300037471 Ga0395905_0017953 Ga0395905_0017953_1725_2678 307
64 3300037471 Ga0395905_0023672 Ga0395905_0023672_3412_4365 307
65 3300038443 Ga0395901_0104015 Ga0395901_0104015_357_1280 307
66 3300038443 Ga0395901_0243385 Ga0395901_0243385_724_1677 307
67 3300044712 Ga0453684_0761457 Ga0453684_0761457_32_1003 307
68 3300046501 Ga0495607_0001967 Ga0495607_0001967_15173_16138 307
69 3300046665 Ga0495661_0053793 Ga0495661_0053793_884_1849 307
70 3300053125 Ga0500618_000789 Ga0500618_000789_4604_5569 307
71 2162886007 SwRhRL2b_contig_1050960 SwRhRL2b_0306.00003430 308
72 2162886007 SwRhRL2b_contig_3310149 SwRhRL2b_0001.00001810 308
73 2162886007 SwRhRL2b_contig_589886 SwRhRL2b_0272.00000920 308
74 3300002773 JGI25152J39213_1000916 JGI25152J39213_100091614 308
75 3300003320 rootH2_10021200 rootH2_1002120021 308
76 3300003856 Ga0058692_1002767 Ga0058692_10027673 308
77 3300003856 Ga0058692_1008896 Ga0058692_10088963 308
78 3300003856 Ga0058692_1031008 Ga0058692_10310081 308
79 3300005289 Ga0065704_10000261 Ga0065704_1000026110 308
80 3300005289 Ga0065704_10001771 Ga0065704_100017713 308
81 3300005289 Ga0065704_10007283 Ga0065704_100072834 308
82 3300005289 Ga0065704_10070547 Ga0065704_1007054718 308
83 3300005289 Ga0065704_10070603 Ga0065704_1007060310 308
84 3300005289 Ga0065704_10098554 Ga0065704_100985542 308
85 3300005548 Ga0070665_100000464 Ga0070665_1000004646 308
86 3300005548 Ga0070665_100142763 Ga0070665_1001427632 308
87 3300006051 Ga0075364_10001491 Ga0075364_100014915 308
88 3300006051 Ga0075364_10026078 Ga0075364_100260782 308
89 3300006946 Ga0079104_1000018 Ga0079104_100001840 308
90 3300006946 Ga0079104_1000163 Ga0079104_100016315 308
91 3300006946 Ga0079104_1000282 Ga0079104_100028221 308
92 3300006946 Ga0079104_1000384 Ga0079104_100038411 308
93 3300006946 Ga0079104_1001040 Ga0079104_10010409 308
94 3300006946 Ga0079104_1003345 Ga0079104_10033456 308
95 3300006946 Ga0079104_1010026 Ga0079104_10100264 308
96 3300006946 Ga0079104_1015504 Ga0079104_10155042 308
97 3300006946 Ga0079104_1022487 Ga0079104_10224872 308
98 3300009011 Ga0105251_10000316 Ga0105251_100003167 308
99 3300009011 Ga0105251_10000616 Ga0105251_1000061628 308
100 3300009011 Ga0105251_10001421 Ga0105251_100014218 308
101 3300009011 Ga0105251_10002419 Ga0105251_1000241910 308
102 3300009011 Ga0105251_10005285 Ga0105251_100052854 308
103 3300009036 Ga0105244_10000009 Ga0105244_1000000952 308
104 3300009036 Ga0105244_10001145 Ga0105244_1000114512 308
105 3300009036 Ga0105244_10002251 Ga0105244_100022516 308
106 3300009036 Ga0105244_10003335 Ga0105244_100033353 308
107 3300009036 Ga0105244_10011180 Ga0105244_100111805 308
108 3300009036 Ga0105244_10011239 Ga0105244_100112395 308
109 3300009036 Ga0105244_10012249 Ga0105244_100122494 308
110 3300009036 Ga0105244_10013935 Ga0105244_100139352 308
111 3300009036 Ga0105244_10014568 Ga0105244_100145685 308
112 3300009036 Ga0105244_10070976 Ga0105244_100709762 308
113 3300009036 Ga0105244_10071350 Ga0105244_100713502 308
114 3300009036 Ga0105244_10087966 Ga0105244_100879662 308
115 3300009092 Ga0105250_10002931 Ga0105250_100029315 308
116 3300009092 Ga0105250_10006868 Ga0105250_100068682 308
117 3300009092 Ga0105250_10021188 Ga0105250_100211882 308
118 3300009092 Ga0105250_10093973 Ga0105250_100939732 308
119 3300009148 Ga0105243_10115084 Ga0105243_101150843 308
120 3300013100 Ga0157373_10000633 Ga0157373_1000063323 308
121 3300013100 Ga0157373_10083851 Ga0157373_100838511 308
122 3300013102 Ga0157371_10097398 Ga0157371_100973982 308
123 3300013104 Ga0157370_10028635 Ga0157370_100286353 308
124 3300013104 Ga0157370_10223183 Ga0157370_102231832 308
125 3300013105 Ga0157369_10003620 Ga0157369_1000362015 308
126 3300013306 Ga0163162_10001271 Ga0163162_100012719 308
127 3300013307 Ga0157372_10003323 Ga0157372_100033239 308
128 3300013307 Ga0157372_10410238 Ga0157372_104102382 308
129 3300015261 Ga0182006_1000018 Ga0182006_1000018114 308
130 3300015679 Ga0183366_1001 Ga0183366_10012219 308
131 3300015680 Ga0183370_1001 Ga0183370_10012219 308
132 3300015685 Ga0183369_1001 Ga0183369_10012220 308
133 3300015687 Ga0183368_1001 Ga0183368_10012219 308
134 3300017792 Ga0163161_10005064 Ga0163161_100050642 308
135 3300021361 Ga0213872_10004354 Ga0213872_100043542 308
136 3300021384 Ga0213876_10000034 Ga0213876_1000003420 308
137 3300025258 Ga0209129_1000077 Ga0209129_100007750 308
138 3300025711 Ga0207696_1000053 Ga0207696_100005395 308
139 3300025711 Ga0207696_1003107 Ga0207696_10031073 308
140 3300025711 Ga0207696_1003258 Ga0207696_10032586 308
141 3300025711 Ga0207696_1003767 Ga0207696_10037677 308
142 3300025728 Ga0207655_1000002 Ga0207655_1000002447 308
143 3300025728 Ga0207655_1000004 Ga0207655_1000004449 308
144 3300025728 Ga0207655_1000005 Ga0207655_100000524 308
145 3300025728 Ga0207655_1000015 Ga0207655_1000015113 308
146 3300025728 Ga0207655_1000036 Ga0207655_1000036178 308
147 3300025728 Ga0207655_1000584 Ga0207655_100058428 308
148 3300025728 Ga0207655_1000911 Ga0207655_100091115 308
149 3300025728 Ga0207655_1002241 Ga0207655_10022413 308
150 3300025728 Ga0207655_1005985 Ga0207655_10059856 308
151 3300025728 Ga0207655_1013555 Ga0207655_10135552 308
152 3300025728 Ga0207655_1017681 Ga0207655_10176815 308
153 3300025728 Ga0207655_1059717 Ga0207655_10597171 308
154 3300025728 Ga0207655_1079312 Ga0207655_10793121 308
155 3300025735 Ga0207713_1000012 Ga0207713_1000012235 308
156 3300025735 Ga0207713_1001283 Ga0207713_100128318 308
157 3300025735 Ga0207713_1008241 Ga0207713_10082415 308
158 3300025735 Ga0207713_1019205 Ga0207713_10192051 308
159 3300025735 Ga0207713_1024307 Ga0207713_10243072 308
160 3300025909 Ga0207705_10193172 Ga0207705_101931721 308
161 3300027111 Ga0209281_1000004 Ga0209281_1000004422 308
162 3300027111 Ga0209281_1000006 Ga0209281_1000006164 308
163 3300027111 Ga0209281_1000014 Ga0209281_1000014582 308
164 3300027111 Ga0209281_1000064 Ga0209281_1000064255 308
165 3300027111 Ga0209281_1000071 Ga0209281_100007137 308
166 3300027111 Ga0209281_1000257 Ga0209281_100025753 308
167 3300027111 Ga0209281_1000370 Ga0209281_100037017 308
168 3300027111 Ga0209281_1000926 Ga0209281_100092615 308
169 3300027111 Ga0209281_1001212 Ga0209281_10012125 308
170 3300027111 Ga0209281_1002173 Ga0209281_10021735 308
171 3300027111 Ga0209281_1011113 Ga0209281_10111131 308
172 3300027312 Ga0209371_1000001 Ga0209371_10000012169 308
173 3300027312 Ga0209371_1000002 Ga0209371_10000021335 308
174 3300027312 Ga0209371_1000015 Ga0209371_1000015120 308
175 3300027312 Ga0209371_1000466 Ga0209371_100046635 308
176 3300027312 Ga0209371_1003979 Ga0209371_10039796 308
177 3300027312 Ga0209371_1004653 Ga0209371_10046533 308
178 3300027360 Ga0209969_1008537 Ga0209969_10085372 308
179 3300027471 Ga0209995_1001301 Ga0209995_10013013 308
180 3300027526 Ga0209968_1000324 Ga0209968_10003246 308
181 3300027614 Ga0209970_1004030 Ga0209970_10040302 308
182 3300027665 Ga0209983_1000411 Ga0209983_10004116 308
183 3300027682 Ga0209971_1000678 Ga0209971_10006785 308
184 3300027695 Ga0209966_1000009 Ga0209966_100000931 308
185 3300027876 Ga0209974_10010631 Ga0209974_100106313 308
186 3300028379 Ga0268266_10000286 Ga0268266_1000028629 308
187 3300030500 Ga0268256_1000001 Ga0268256_1000001471 308
188 3300030500 Ga0268256_1000002 Ga0268256_1000002127 308
189 3300030500 Ga0268256_1000018 Ga0268256_1000018505 308
190 3300030500 Ga0268256_1000423 Ga0268256_10004232 308
191 3300030500 Ga0268256_1003099 Ga0268256_10030996 308
192 3300030500 Ga0268256_1004411 Ga0268256_10044113 308
193 3300031251 Ga0265327_10002831 Ga0265327_1000283110 308
194 3300031548 Ga0307408_100000043 Ga0307408_10000004346 308
195 3300032004 Ga0307414_10000365 Ga0307414_1000036511 308
196 3300032004 Ga0307414_10004163 Ga0307414_100041632 308
197 3300032004 Ga0307414_10173664 Ga0307414_101736642 308
198 3300037418 Ga0395900_0160330 Ga0395900_0160330_569_1507 308
199 3300037418 Ga0395900_0367376 Ga0395900_0367376_202_1161 308
200 3300037466 Ga0395898_0125427 Ga0395898_0125427_1192_2130 308
201 3300037466 Ga0395898_0268555 Ga0395898_0268555_26_952 308
202 3300037471 Ga0395905_0017417 Ga0395905_0017417_5668_6627 308
203 3300038735 Ga0400485_22349 Ga0400485_22349_109874_110854 308
204 3300038741 Ga0400488_31614 Ga0400488_31614_1803_2783 308
205 3300038742 Ga0400486_19188 Ga0400486_19188_28156_29136 308
206 3300039062 Ga0400483_246917 Ga0400483_246917_1939_2907 308
207 3300039062 Ga0400483_259586 Ga0400483_259586_697_1665 308
208 3300039062 Ga0400483_278889 Ga0400483_278889_1148_2116 308
209 3300039062 Ga0400483_289216 Ga0400483_289216_30849_31814 308
210 3300039110 Ga0400487_19710 Ga0400487_19710_28100_29080 308
211 3300039437 Ga0436365_0965775 Ga0436365_0965775_292272_293237 308
212 3300039447 Ga0436361_0434733 Ga0436361_0434733_6727_7710 308
213 3300041405 Ga0439438_006549 Ga0439438_006549_444_1409 308
214 3300041512 Ga0451853_2364667 Ga0451853_2364667_154_1119 308
215 3300042006 Ga0439432_005183 Ga0439432_005183_3271_4236 308
216 3300042006 Ga0439432_006625 Ga0439432_006625_2778_3743 308
217 3300042010 Ga0439452_000001 Ga0439452_000001_1557592_1558554 308
218 3300042010 Ga0439452_000002 Ga0439452_000002_445910_446875 308
219 3300042010 Ga0439452_000020 Ga0439452_000020_238417_239382 308
220 3300042010 Ga0439452_000032 Ga0439452_000032_142637_143602 308
221 3300042876 Ga0451577_0032061 Ga0451577_0032061_1196_2173 308
222 3300044669 Ga0466981_0000003 Ga0466981_0000003_98901_99866 308
223 3300044673 Ga0453683_0012181 Ga0453683_0012181_2246_3223 308
224 3300044684 Ga0466966_0026279 Ga0466966_0026279_1228_2202 308
225 3300044693 Ga0466961_0004945 Ga0466961_0004945_3056_4030 308
226 3300046453 Ga0495627_000231 Ga0495627_000231_32702_33697 308
227 3300046458 Ga0495591_000050 Ga0495591_000050_93782_94747 308
228 3300046460 Ga0495638_0003782 Ga0495638_0003782_3618_4583 308
229 3300046471 Ga0495650_0000047 Ga0495650_0000047_276094_277059 308
230 3300046471 Ga0495650_0012597 Ga0495650_0012597_43_990 308
231 3300046507 Ga0495606_0011537 Ga0495606_0011537_1921_2934 308
232 3300046512 Ga0495610_0001566 Ga0495610_0001566_7591_8568 308
233 3300046515 Ga0495620_0016112 Ga0495620_0016112_1999_2973 308
234 3300046515 Ga0495620_0020506 Ga0495620_0020506_1841_2806 308
235 3300046518 Ga0495631_0000932 Ga0495631_0000932_4027_5022 308
236 3300046519 Ga0495632_0045141 Ga0495632_0045141_59_1054 308
237 3300046522 Ga0495643_0129783 Ga0495643_0129783_224_1189 308
238 3300046524 Ga0495648_0007559 Ga0495648_0007559_7714_8643 308
239 3300046530 Ga0495654_0004322 Ga0495654_0004322_4210_5205 308
240 3300046530 Ga0495654_0021061 Ga0495654_0021061_46_1023 308
241 3300046530 Ga0495654_0023448 Ga0495654_0023448_371_1336 308
242 3300046530 Ga0495654_0027287 Ga0495654_0027287_1025_1999 308
243 3300046542 Ga0495597_0007223 Ga0495597_0007223_3543_4508 308
244 3300046648 Ga0495611_0008921 Ga0495611_0008921_1133_2062 308
245 3300046660 Ga0495625_0002704 Ga0495625_0002704_3673_4638 308
246 3300046660 Ga0495625_0004152 Ga0495625_0004152_8095_9057 308
247 3300046674 Ga0495588_0005804 Ga0495588_0005804_2492_3457 308
248 3300046694 Ga0495649_0000543 Ga0495649_0000543_3724_4689 308
249 3300047320 Ga0495672_0000009 Ga0495672_0000009_430856_431821 308
250 3300047320 Ga0495672_0013254 Ga0495672_0013254_3175_4170 308
251 3300047446 Ga0495679_000182 Ga0495679_000182_52163_53128 308
252 3300047446 Ga0495679_004012 Ga0495679_004012_442_1407 308
253 3300047469 Ga0495673_0000007 Ga0495673_0000007_12836_13801 308
254 3300047469 Ga0495673_0000366 Ga0495673_0000366_39071_40045 308
255 3300048904 Ga0496101_0220027 Ga0496101_0220027_498_1463 308
256 3300048905 Ga0496102_0062601 Ga0496102_0062601_1478_2467 308
257 3300048907 Ga0496104_0000100 Ga0496104_0000100_47964_48929 308
258 3300048919 Ga0496116_0000625 Ga0496116_0000625_10012_10977 308
259 3300048919 Ga0496116_0048913 Ga0496116_0048913_1202_2167 308
260 3300048919 Ga0496116_0051926 Ga0496116_0051926_1341_2306 308
261 3300048920 Ga0496117_0000380 Ga0496117_0000380_38398_39363 308
262 3300048920 Ga0496117_0001815 Ga0496117_0001815_18906_19835 308
263 3300048920 Ga0496117_0002117 Ga0496117_0002117_4023_4997 308
264 3300048920 Ga0496117_0004656 Ga0496117_0004656_12743_13708 308
265 3300048920 Ga0496117_0019537 Ga0496117_0019537_1783_2748 308
266 3300048920 Ga0496117_0027876 Ga0496117_0027876_72_1061 308
267 3300048920 Ga0496117_0042482 Ga0496117_0042482_2070_3035 308
268 3300048921 Ga0496118_0001286 Ga0496118_0001286_8972_9946 308
269 3300048921 Ga0496118_0001914 Ga0496118_0001914_26761_27726 308
270 3300048921 Ga0496118_0002174 Ga0496118_0002174_17185_18114 308
271 3300048921 Ga0496118_0016166 Ga0496118_0016166_2687_3652 308
272 3300048921 Ga0496118_0062090 Ga0496118_0062090_713_1702 308
273 3300048922 Ga0496119_0000049 Ga0496119_0000049_41354_42319 308
274 3300048922 Ga0496119_0004419 Ga0496119_0004419_8618_9583 308
275 3300048922 Ga0496119_0032423 Ga0496119_0032423_1942_2907 308
276 3300048922 Ga0496119_0180956 Ga0496119_0180956_68_1033 308
277 3300048923 Ga0496120_0002467 Ga0496120_0002467_16632_17597 308
278 3300048923 Ga0496120_0014802 Ga0496120_0014802_1166_2131 308
279 3300048923 Ga0496120_0075562 Ga0496120_0075562_182_1147 308
280 3300048924 Ga0496121_0001226 Ga0496121_0001226_43627_44592 308
281 3300048924 Ga0496121_0001655 Ga0496121_0001655_1202_2167 308
282 3300048924 Ga0496121_0002497 Ga0496121_0002497_9179_10108 308
283 3300048924 Ga0496121_0003206 Ga0496121_0003206_10025_10990 308
284 3300048924 Ga0496121_0008677 Ga0496121_0008677_3395_4360 308
285 3300048924 Ga0496121_0019204 Ga0496121_0019204_1601_2566 308
286 3300048924 Ga0496121_0032811 Ga0496121_0032811_935_1900 308
287 3300048925 Ga0496122_0000003 Ga0496122_0000003_294550_295515 308
288 3300048925 Ga0496122_0000088 Ga0496122_0000088_49530_50495 308
289 3300048925 Ga0496122_0000962 Ga0496122_0000962_33335_34300 308
290 3300048925 Ga0496122_0033213 Ga0496122_0033213_933_1898 308
291 3300048925 Ga0496122_0118754 Ga0496122_0118754_382_1347 308
292 3300048926 Ga0496123_0000012 Ga0496123_0000012_49733_50698 308
293 3300048926 Ga0496123_0000139 Ga0496123_0000139_100976_101941 308
294 3300048926 Ga0496123_0000750 Ga0496123_0000750_18236_19201 308
295 3300048926 Ga0496123_0000945 Ga0496123_0000945_21839_22804 308
296 3300048926 Ga0496123_0010931 Ga0496123_0010931_834_1799 308
297 3300048926 Ga0496123_0053430 Ga0496123_0053430_1084_2049 308
298 3300048926 Ga0496123_0067029 Ga0496123_0067029_711_1676 308
299 3300048927 Ga0496124_0000045 Ga0496124_0000045_174161_175126 308
300 3300048927 Ga0496124_0004149 Ga0496124_0004149_12036_13010 308
301 3300048927 Ga0496124_0005207 Ga0496124_0005207_6623_7588 308
302 3300048927 Ga0496124_0009549 Ga0496124_0009549_8950_9915 308
303 3300048927 Ga0496124_0044386 Ga0496124_0044386_520_1449 308
304 3300048927 Ga0496124_0119888 Ga0496124_0119888_625_1590 308
305 3300048928 Ga0496125_0000065 Ga0496125_0000065_47817_48782 308
306 3300048928 Ga0496125_0007915 Ga0496125_0007915_453_1382 308
307 3300048928 Ga0496125_0008498 Ga0496125_0008498_7016_7981 308
308 3300048928 Ga0496125_0009175 Ga0496125_0009175_1906_2883 308
309 3300048928 Ga0496125_0022439 Ga0496125_0022439_4648_5613 308
310 3300048929 Ga0496126_0002379 Ga0496126_0002379_15641_16570 308
311 3300048929 Ga0496126_0015139 Ga0496126_0015139_4638_5603 308
312 3300048929 Ga0496126_0018170 Ga0496126_0018170_5833_6798 308
313 3300048929 Ga0496126_0061256 Ga0496126_0061256_252_1217 308
314 3300049569 Ga0501032_0061338 Ga0501032_0061338_804_1760 308
315 3300049586 Ga0501070_0229198 Ga0501070_0229198_533_1489 308
316 3300049590 Ga0501074_0014511 Ga0501074_0014511_3374_4360 308
317 3300049742 Ga0501080_0004300 Ga0501080_0004300_9783_10769 308
318 3300049822 Ga0501035_0005690 Ga0501035_0005690_7177_8133 308
319 3300049823 Ga0501044_0281606 Ga0501044_0281606_433_1389 308
320 3300050491 nmdc:mga00v17_2168_c1 nmdc:mga00v17_2168_c1_4976_5941 308
321 3300050496 nmdc:mga07m45_3120_c1 nmdc:mga07m45_3120_c1_2384_3364 308
322 iso_pu_bacteria 2547132181 2547697199 308
323 iso_pu_bacteria 2547132416 2548649540 308
324 iso_pu_bacteria 2561511199 2562463355 308
325 iso_pu_bacteria 2599185299 2599926360 308
326 iso_pu_bacteria 2599185318 2600034445 308
327 iso_pu_bacteria 2600255254 2601524435 308
328 iso_pu_bacteria 2600255255 2601529589 308
329 iso_pu_bacteria 2600255256 2601534839 308
330 iso_pu_bacteria 2600255257 2601539532 308
331 iso_pu_bacteria 2600255280 2601616423 308
332 iso_pu_bacteria 2600255281 2601621145 308
333 iso_pu_bacteria 2600255288 2601649542 308
334 iso_pu_bacteria 2600255289 2601654469 308
335 iso_pu_bacteria 2600255290 2601659891 308
336 iso_pu_bacteria 2600255300 2601707213 308
337 iso_pu_bacteria 2600255301 2601711835 308
338 iso_pu_bacteria 2600255302 2601717730 308
339 iso_pu_bacteria 2600255304 2601727658 308
340 iso_pu_bacteria 2600255305 2601732277 308
341 iso_pu_bacteria 2600255306 2601739500 308
342 iso_pu_bacteria 2600255310 2601757882 308
343 iso_pu_bacteria 2600255311 2601764240 308
344 iso_pu_bacteria 2602042046 2603637050 308
345 iso_pu_bacteria 2602042047 2603645012 308
346 iso_pu_bacteria 2602042066 2603699180 308
347 iso_pu_bacteria 2602042067 2603705197 308
348 iso_pu_bacteria 2602042103 2603840084 308
349 iso_pu_bacteria 2602042104 2603845161 308
350 iso_pu_bacteria 2602042105 2603849834 308
351 iso_pu_bacteria 2602042106 2603855302 308
352 iso_pu_bacteria 2602042110 2603872883 308
353 iso_pu_bacteria 2603880178 2606049660 308
354 iso_pu_bacteria 2603880202 2606147746 308
355 iso_pu_bacteria 2603880211 2606177549 308
356 iso_pu_bacteria 2609459761 2609909832 308
357 iso_pu_bacteria 2667528172 2671101300 308
358 iso_pu_bacteria 2671180115 2671585568 308
359 iso_pu_bacteria 2681812866 2681996387 308
360 iso_pu_bacteria 2681812869 2682006264 308
361 iso_pu_bacteria 2711768156 2712469401 308
362 iso_pu_bacteria 2751185917 2753856750 308
363 iso_pu_bacteria 2765235842 2765589841 308
364 iso_pu_bacteria 2775506706 2775541474 308
365 iso_pu_bacteria 2791354903 2791922044 308
366 iso_pu_bacteria 2791355010 2792310331 308
367 iso_pu_bacteria 2791355275 2793404910 308
368 iso_pu_bacteria 2808606414 2809125567 308
369 iso_pu_bacteria 2811995292 2813728060 308
370 iso_pu_bacteria 2814123068 2814695615 308
371 iso_pu_bacteria 2821118458 2821120866 308
372 iso_pu_bacteria 2823373977 2823375497 308
373 iso_pu_bacteria 2840878972 2840883411 308
374 iso_pu_bacteria 2844425489 2844428187 308
375 iso_pu_bacteria 2871272651 2871275374 308
376 iso_pu_bacteria 2884086401 2884088126 308
377 iso_pu_bacteria 2891633521 2891637062 308
378 iso_pu_bacteria 2891670763 2891672127 308
379 iso_pu_bacteria 2919688452 2919688632 308
380 iso_pu_bacteria 2923634449 2923635664 308
381 iso_pu_bacteria 2927833300 2927833367 308
382 iso_pu_bacteria 2935625433 2935625941 308
383 iso_pu_bacteria 2937539931 2937542621 308
384 iso_pu_bacteria 2939568625 2939569867 308
385 iso_pu_bacteria 2939573065 2939575128 308
386 iso_pu_bacteria 2939573065 2939577837 308
387 iso_pu_bacteria 2939607340 2939608858 308
388 iso_pu_bacteria 2939617950 2939618309 308
389 iso_pu_bacteria 2939642701 2939643129 308
390 iso_pu_bacteria 2939642701 2939643149 308
391 iso_pu_bacteria 2939651529 2939653167 308
392 iso_pu_bacteria 2945874760 2945877037 308
393 iso_pu_bacteria 2974310843 2974311283 308
394 iso_pu_bacteria 2974435778 2974439084 308
395 iso_pu_bacteria 2974435778 2974439100 308
396 iso_pu_bacteria 3000376612 3000378560 308
397 iso_pu_bacteria 3007872151 3007872363 308
398 iso_pu_bacteria 8018221730 8018225294 308
399 iso_pu_bacteria 8018405270 8018409427 308
400 iso_pu_bacteria 8019504834 8019505354 308
401 iso_pu_bacteria 8054503363 8054505168 308
402 iso_pu_bacteria 8054844752 8054846455 308
403 iso_pu_bacteria 8054849141 8054851775 308
404 iso_pu_bacteria 8055087960 8055087992 308
405 iso_pu_bacteria 8055092621 8055095318 308
406 iso_pu_bacteria 8055097453 8055098385 308
407 iso_pu_bacteria 8055817908 8055819703 308
408 iso_pu_bacteria 8057304971 8057306982 308
409 iso_pu_bacteria 8057304971 8057307000 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

235

0.97

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

18

297

0.81

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

273

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e6u-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase 0.9917 2 303
1e7q-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a 0.9913 2 303
1e7r-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e 0.9908 1 303
1bsv-assembly1.cif.gz_A gdp-fucose synthetase from escherichia coli complex with nadph 0.99 2 306
1e7s-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r 0.99 2 303
ID Description Score Start End Superfamily
1bwsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9929 1 286 3.40.50.720
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9681 155 303 3.90.25.10
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9581 155 303 3.90.25.10
1bwsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9391 1 286 3.40.50.720
4bkpC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8979 2 235 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A731UXI0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9998 43 143 GO:0050577
AF-A0A2X1KEY2-F1-model_v4 GDP-L-fucose synthetase (EC 1.1.1.271) 0.9952 1 164 GO:0050577
AF-A0A5C9AE87-F1-model_v4 GDP-L-fucose synthase (EC 1.1.1.271) 0.9952 1 125 GO:0050577
AF-A0A376SIQ7-F1-model_v4 deleted 0.9945 1 149
AF-A0A354T6V8-F1-model_v4 GDP-fucose synthetase 0.9933 1 132 GO:0050577

Feature Viewer

pLDDT pTM Quality
94.07 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map