F436725

General Info

Members Datasets Scaffolds Average Seq Length
408 249 816 132

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10711857|Ga0157375_107118572
Length 153
Sequence LAEGGRAIERLLRKGDEPMATLGLIEYESASSEVRAIYDDIKTTRQIEDVNNFWKALAHDPITLRRTWESIKQVMAAGDLDVLTKELIYLAVSVTNQCNYCVASHTVAARKAGMTASMFAELMAVVGMANETNRLASGYQVEIDAKFRTPSET

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
241 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
245 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.2
Nodule 0
Rhizoplane 1.23
Rhizosphere 82.84
Stem 0
Stem Tuber 0
Unclassified 8.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10711857 3300013308 Bacteria 1157
2 JGI24735J21928_10113996 3300002067 Bacteria 778
3 Ga0065704_10808806 3300005289 Bacteria 522
4 Ga0065707_10913435 3300005295 Bacteria 563
5 Ga0070658_10528694 3300005327 Bacteria 1020
6 Ga0070683_100025132 3300005329 Bacteria 5345
7 Ga0070690_100146795 3300005330 Bacteria 1606
8 Ga0070680_100000091 3300005336 Bacteria 50978
9 Ga0070680_100281131 3300005336 Bacteria 1410
10 Ga0070682_101890626 3300005337 Bacteria 523
11 Ga0068868_101088471 3300005338 Bacteria 735
12 Ga0070660_100479727 3300005339 Unclassified 1033
13 Ga0070660_100504909 3300005339 Bacteria 1006
14 Ga0070660_100952348 3300005339 Bacteria 725
15 Ga0070689_100167951 3300005340 Bacteria 1777
16 Ga0070689_100187699 3300005340 Bacteria 1682
17 Ga0070691_10004521 3300005341 Bacteria 6315
18 Ga0070661_100158274 3300005344 Bacteria 1714
19 Ga0070692_10115744 3300005345 Bacteria 1489
20 Ga0070692_10230061 3300005345 Bacteria 1100
21 Ga0070669_100509424 3300005353 Bacteria 999
22 Ga0070671_101963360 3300005355 Bacteria 521
23 Ga0070688_100360934 3300005365 Bacteria 1066
24 Ga0070659_100335767 3300005366 Bacteria 1265
25 Ga0070659_101879636 3300005366 Bacteria 537
26 Ga0070714_102034909 3300005435 Bacteria 560
27 Ga0070713_100039868 3300005436 Bacteria 3815
28 Ga0070713_100125347 3300005436 Bacteria 2258
29 Ga0070700_101716960 3300005441 Bacteria 539
30 Ga0070694_101498484 3300005444 Bacteria 571
31 Ga0070678_100025330 3300005456 Bacteria 3989
32 Ga0070678_102237364 3300005456 Bacteria 519
33 Ga0070662_101289292 3300005457 Bacteria 629
34 Ga0070681_10005698 3300005458 Bacteria 12037
35 Ga0070681_10700549 3300005458 Archaea 928
36 Ga0070706_101445382 3300005467 Bacteria 629
37 Ga0070707_100581066 3300005468 Bacteria 1083
38 Ga0070707_100788704 3300005468 Bacteria 914
39 Ga0070699_100901697 3300005518 Bacteria 810
40 Ga0070679_100002144 3300005530 Bacteria 17790
41 Ga0070679_100406658 3300005530 Bacteria 1307
42 Ga0070684_100147198 3300005535 Bacteria 2132
43 Ga0070697_100732514 3300005536 Bacteria 873
44 Ga0068853_100963731 3300005539 Unclassified 820
45 Ga0070672_100832739 3300005543 Bacteria 813
46 Ga0070665_100022313 3300005548 Bacteria 6370
47 Ga0070665_100535135 3300005548 Bacteria 1183
48 Ga0070665_101982206 3300005548 Bacteria 587
49 Ga0070665_102039818 3300005548 Bacteria 578
50 Ga0070704_102054654 3300005549 Bacteria 531
51 Ga0070704_102083427 3300005549 Bacteria 527
52 Ga0068855_100019698 3300005563 Bacteria 8102
53 Ga0068855_101792198 3300005563 Bacteria 624
54 Ga0070664_100184016 3300005564 Bacteria 1858
55 Ga0070664_101747139 3300005564 Bacteria 590
56 Ga0068857_100200976 3300005577 Bacteria 1817
57 Ga0068857_101046746 3300005577 Bacteria 787
58 Ga0068857_101266632 3300005577 Bacteria 715
59 Ga0068854_100560069 3300005578 Bacteria 971
60 Ga0068854_100635731 3300005578 Bacteria 915
61 Ga0068856_100069818 3300005614 Bacteria 3474
62 Ga0068856_100379876 3300005614 Bacteria 1432
63 Ga0068852_102121948 3300005616 Bacteria 584
64 Ga0068859_100037530 3300005617 Bacteria 4863
65 Ga0068859_100693036 3300005617 Bacteria 1109
66 Ga0068859_101102575 3300005617 Unclassified 873
67 Ga0068859_101200533 3300005617 Bacteria 835
68 Ga0068859_102826794 3300005617 Bacteria 532
69 Ga0068864_100447825 3300005618 Bacteria 1234
70 Ga0068864_102144969 3300005618 Bacteria 565
71 Ga0068861_100244343 3300005719 Bacteria 1528
72 Ga0068863_100668595 3300005841 Bacteria 1031
73 Ga0068860_100673918 3300005843 Bacteria 1043
74 Ga0068860_101191878 3300005843 Bacteria 782
75 Ga0068862_100406719 3300005844 Bacteria 1274
76 Ga0068862_102675093 3300005844 Bacteria 511
77 Ga0081455_10000366 3300005937 Bacteria 59625
78 Ga0081455_10028594 3300005937 Bacteria 5093
79 Ga0081455_10035222 3300005937 Bacteria 4476
80 Ga0081455_11038875 3300005937 Bacteria 507
81 Ga0081538_10155334 3300005981 Bacteria 1027
82 Ga0081540_1081025 3300005983 Bacteria 1461
83 Ga0081539_10000797 3300005985 Bacteria 61227
84 Ga0081539_10008864 3300005985 Bacteria 8598
85 Ga0081539_10093710 3300005985 Bacteria 1546
86 Ga0070717_10004600 3300006028 Bacteria 9993
87 Ga0070717_11242214 3300006028 Bacteria 678
88 Ga0070717_11276732 3300006028 Bacteria 668
89 Ga0075365_10121866 3300006038 Bacteria 1799
90 Ga0075365_10860488 3300006038 Bacteria 639
91 Ga0075368_10059525 3300006042 Bacteria 1528
92 Ga0075368_10497666 3300006042 Bacteria 544
93 Ga0075363_100084885 3300006048 Unclassified 1736
94 Ga0075363_100624565 3300006048 Bacteria 647
95 Ga0075363_100657753 3300006048 Unclassified 631
96 Ga0075364_10679988 3300006051 Bacteria 702
97 Ga0070712_101997641 3300006175 Bacteria 508
98 Ga0075362_10042663 3300006177 Bacteria 2006
99 Ga0075362_10101042 3300006177 Bacteria 1348
100 Ga0075362_10113115 3300006177 Unclassified 1279
101 Ga0075362_10223062 3300006177 Bacteria 921
102 Ga0075362_10255945 3300006177 Bacteria 862
103 Ga0075367_10036577 3300006178 Bacteria 2848
104 Ga0075367_10040591 3300006178 Bacteria 2717
105 Ga0075367_10784584 3300006178 Bacteria 607
106 Ga0075369_10001838 3300006186 Bacteria 7405
107 Ga0075369_10032774 3300006186 Bacteria 2199
108 Ga0075366_10026885 3300006195 Bacteria 3373
109 Ga0075366_10089502 3300006195 Bacteria 1844
110 Ga0075366_10194251 3300006195 Bacteria 1234
111 Ga0075366_10299311 3300006195 Bacteria 984
112 Ga0097621_100980541 3300006237 Bacteria 790
113 Ga0075370_10059037 3300006353 Bacteria 2182
114 Ga0075370_10072061 3300006353 Bacteria 1977
115 Ga0068871_101332427 3300006358 Bacteria 676
116 Ga0075428_100087259 3300006844 Bacteria 3403
117 Ga0075428_100345056 3300006844 Bacteria 1598
118 Ga0075430_101060054 3300006846 Bacteria 668
119 Ga0075431_100069174 3300006847 Bacteria 3643
120 Ga0075431_100192959 3300006847 Bacteria 2086
121 Ga0075433_10029902 3300006852 Bacteria 4644
122 Ga0075433_10309690 3300006852 Bacteria 1398
123 Ga0075434_100384716 3300006871 Bacteria 1424
124 Ga0075429_100030904 3300006880 Bacteria 4654
125 Ga0075429_100565118 3300006880 Bacteria 997
126 Ga0068865_100238790 3300006881 Bacteria 1429
127 Ga0097620_100037529 3300006931 Bacteria 4863
128 Ga0097620_100693056 3300006931 Bacteria 1109
129 Ga0097620_101102290 3300006931 Unclassified 873
130 Ga0097620_101200501 3300006931 Bacteria 835
131 Ga0097620_102826761 3300006931 Bacteria 532
132 Ga0075435_100006958 3300007076 Bacteria 8029
133 Ga0099794_10202073 3300007265 Bacteria 1018
134 Ga0099794_10216391 3300007265 Bacteria 983
135 Ga0105250_10505082 3300009092 Bacteria 549
136 Ga0105240_10002528 3300009093 Bacteria 29368
137 Ga0105240_10014483 3300009093 Bacteria 10766
138 Ga0105240_11206976 3300009093 Bacteria 801
139 Ga0111539_10043013 3300009094 Bacteria 5419
140 Ga0111539_10699110 3300009094 Bacteria 1180
141 Ga0111539_11317997 3300009094 Bacteria 838
142 Ga0111539_11908674 3300009094 Bacteria 689
143 Ga0105245_11200650 3300009098 Bacteria 806
144 Ga0114129_10017601 3300009147 Bacteria 10173
145 Ga0114129_10101903 3300009147 Bacteria 3971
146 Ga0114129_11532083 3300009147 Bacteria 818
147 Ga0114129_11735164 3300009147 Bacteria 761
148 Ga0105243_12178335 3300009148 Bacteria 591
149 Ga0105241_11348913 3300009174 Bacteria 681
150 Ga0105241_11959368 3300009174 Bacteria 576
151 Ga0105242_10666410 3300009176 Bacteria 1014
152 Ga0105237_10192938 3300009545 Bacteria 2037
153 Ga0105237_11164849 3300009545 Bacteria 777
154 Ga0105238_10060686 3300009551 Bacteria 3785
155 Ga0105238_10274836 3300009551 Bacteria 1665
156 Ga0105238_10340221 3300009551 Bacteria 1488
157 Ga0105035_100379 3300009988 Bacteria 2755
158 Ga0099796_10114574 3300010159 Bacteria 1030
159 Ga0105239_10190087 3300010375 Bacteria 2298
160 Ga0105239_10193572 3300010375 Bacteria 2276
161 Ga0105239_12165032 3300010375 Unclassified 646
162 Ga0157373_10357813 3300013100 Bacteria 1042
163 Ga0157371_10048428 3300013102 Bacteria 3021
164 Ga0157370_10176788 3300013104 Bacteria 1984
165 Ga0157369_10117095 3300013105 Bacteria 2828
166 Ga0157369_10369773 3300013105 Bacteria 1488
167 Ga0157374_10610196 3300013296 Bacteria 1101
168 Ga0157374_10630359 3300013296 Bacteria 1083
169 Ga0157378_10189845 3300013297 Bacteria 1937
170 Ga0157378_10282770 3300013297 Bacteria 1600
171 Ga0157378_12935997 3300013297 Bacteria 529
172 Ga0163162_11021580 3300013306 Bacteria 935
173 Ga0163162_11218084 3300013306 Bacteria 854
174 Ga0157372_10490566 3300013307 Bacteria 1432
175 Ga0157375_11221678 3300013308 Bacteria 882
176 Ga0157515_153337 3300013875 Bacteria 1256
177 Ga0163163_13086096 3300014325 Bacteria 519
178 Ga0157380_10675201 3300014326 Bacteria 1034
179 Ga0157377_11309462 3300014745 Unclassified 567
180 Ga0157379_10624603 3300014968 Bacteria 1007
181 Ga0157376_11504586 3300014969 Bacteria 706
182 Ga0157376_11995183 3300014969 Bacteria 618
183 Ga0163161_11021519 3300017792 Bacteria 707
184 Ga0224572_1000026 3300024225 Bacteria 8543
185 Ga0224572_1032571 3300024225 Bacteria 992
186 Ga0224572_1091070 3300024225 Unclassified 563
187 Ga0228598_1001088 3300024227 Bacteria 5977
188 Ga0207426_1064699 3300025302 Bacteria 1039
189 Ga0207688_10083926 3300025901 Bacteria 1823
190 Ga0207699_10199127 3300025906 Bacteria 1356
191 Ga0207645_10038938 3300025907 Bacteria 3047
192 Ga0207643_10210798 3300025908 Bacteria 1186
193 Ga0207705_10094143 3300025909 Bacteria 2196
194 Ga0207684_11096006 3300025910 Bacteria 663
195 Ga0207707_10009616 3300025912 Bacteria 8387
196 Ga0207707_10687185 3300025912 Unclassified 860
197 Ga0207695_10034694 3300025913 Bacteria 5482
198 Ga0207695_10079118 3300025913 Bacteria 3333
199 Ga0207695_10217072 3300025913 Bacteria 1821
200 Ga0207671_10491752 3300025914 Bacteria 978
201 Ga0207660_10018663 3300025917 Bacteria 4628
202 Ga0207660_10105424 3300025917 Bacteria 2112
203 Ga0207649_10264521 3300025920 Bacteria 1244
204 Ga0207652_10000929 3300025921 Bacteria 27521
205 Ga0207681_10234833 3300025923 Unclassified 1425
206 Ga0207681_10894132 3300025923 Bacteria 744
207 Ga0207694_10037587 3300025924 Bacteria 3719
208 Ga0207694_10304904 3300025924 Bacteria 1312
209 Ga0207650_10265393 3300025925 Bacteria 1394
210 Ga0207700_10157774 3300025928 Bacteria 1882
211 Ga0207664_11915094 3300025929 Bacteria 516
212 Ga0207644_10839025 3300025931 Bacteria 769
213 Ga0207690_10116903 3300025932 Bacteria 1930
214 Ga0207706_11023563 3300025933 Bacteria 693
215 Ga0207709_11000375 3300025935 Bacteria 683
216 Ga0207670_10050799 3300025936 Bacteria 2781
217 Ga0207670_10168913 3300025936 Bacteria 1638
218 Ga0207665_10455551 3300025939 Bacteria 982
219 Ga0207691_10933932 3300025940 Bacteria 725
220 Ga0207689_10438958 3300025942 Bacteria 1090
221 Ga0207679_10368777 3300025945 Bacteria 1256
222 Ga0207667_10027640 3300025949 Bacteria 6171
223 Ga0207667_10067325 3300025949 Bacteria 3731
224 Ga0207667_11521811 3300025949 Bacteria 640
225 Ga0207651_10325238 3300025960 Bacteria 1287
226 Ga0207712_10601428 3300025961 Bacteria 951
227 Ga0207640_10103274 3300025981 Bacteria 2004
228 Ga0207640_10736693 3300025981 Bacteria 848
229 Ga0207677_10525103 3300026023 Bacteria 1027
230 Ga0207703_10580698 3300026035 Bacteria 1059
231 Ga0207639_10544432 3300026041 Bacteria 1065
232 Ga0207639_11117683 3300026041 Bacteria 739
233 Ga0207702_10215457 3300026078 Bacteria 1787
234 Ga0207702_11506651 3300026078 Bacteria 666
235 Ga0207676_10278817 3300026095 Bacteria 1517
236 Ga0207674_10061299 3300026116 Bacteria 3801
237 Ga0207674_10215331 3300026116 Bacteria 1869
238 Ga0207674_10304578 3300026116 Bacteria 1543
239 Ga0207674_10685104 3300026116 Bacteria 990
240 Ga0207675_100365397 3300026118 Bacteria 1417
241 Ga0207675_100532158 3300026118 Bacteria 1173
242 Ga0207683_10011244 3300026121 Bacteria 7631
243 Ga0207683_10599741 3300026121 Bacteria 1019
244 Ga0207698_10099643 3300026142 Bacteria 2404
245 Ga0209588_1185236 3300027671 Bacteria 652
246 Ga0209813_10084454 3300027866 Bacteria 1055
247 Ga0209813_10482997 3300027866 Unclassified 511
248 Ga0207428_10222782 3300027907 Bacteria 1413
249 Ga0207428_10776681 3300027907 Bacteria 682
250 Ga0265354_1011302 3300028016 Bacteria 849
251 Ga0268266_10054886 3300028379 Bacteria 3424
252 Ga0268266_10057101 3300028379 Bacteria 3358
253 Ga0268266_11622867 3300028379 Bacteria 622
254 Ga0268265_11408711 3300028380 Bacteria 699
255 Ga0265760_10013147 3300031090 Bacteria 2369
256 Ga0265760_10111173 3300031090 Bacteria 873
257 Ga0265332_10488627 3300031238 Bacteria 510
258 Ga0265331_10317646 3300031250 Bacteria 698
259 Ga0307406_10518331 3300031901 Bacteria 970
260 Ga0307407_11297521 3300031903 Bacteria 571
261 Ga0307416_100127464 3300032002 Bacteria 2283
262 Ga0307416_100173302 3300032002 Bacteria 2012
263 Ga0307416_101798419 3300032002 Bacteria 717
264 Ga0307411_10079894 3300032005 Bacteria 2247
265 Ga0307415_101568310 3300032126 Bacteria 632
266 Ga0373949_0058385 3300035090 Bacteria 988
267 Ga0373952_0237181 3300035092 Bacteria 547
268 Ga0373936_0564743 3300035113 Bacteria 533
269 Ga0373946_0191365 3300035171 Bacteria 976
270 Ga0373942_0052576 3300035207 Bacteria 1146
271 Ga0373924_0177621 3300035410 Bacteria 937
272 Ga0373931_0121390 3300035691 Bacteria 1494
273 Ga0373931_0338387 3300035691 Bacteria 939
274 Ga0373931_0518526 3300035691 Bacteria 771
275 Ga0373931_0567379 3300035691 Bacteria 739
276 Ga0373935_0079810 3300035692 Bacteria 2125
277 Ga0373927_0044640 3300035695 Bacteria 2867
278 Ga0373933_1053891 3300035724 Bacteria 536
279 Ga0373937_0520473 3300036401 Bacteria 1130
280 Ga0373925_0073456 3300037068 Bacteria 2589
281 Ga0373925_0594706 3300037068 Bacteria 911
282 Ga0373925_1174840 3300037068 Bacteria 631
283 Ga0373925_1355022 3300037068 Bacteria 583
284 Ga0395899_0004738 3300037312 Bacteria 10609
285 Ga0395899_0043007 3300037312 Bacteria 3371
286 Ga0395899_0140395 3300037312 Bacteria 1719
287 Ga0395899_0160922 3300037312 Bacteria 1586
288 Ga0395900_0006254 3300037418 Bacteria 12426
289 Ga0395900_0037777 3300037418 Bacteria 4977
290 Ga0395900_0174406 3300037418 Bacteria 2187
291 Ga0395898_0052246 3300037466 Bacteria 3992
292 Ga0395898_0427819 3300037466 Bacteria 1261
293 Ga0395901_0014208 3300038443 Bacteria 8105
294 Ga0395901_0064693 3300038443 Bacteria 3806
295 Ga0395901_0088201 3300038443 Bacteria 3244
296 Ga0436365_1537893 3300039437 Bacteria 1913
297 Ga0436360_0716756 3300039438 Bacteria 1693
298 Ga0436361_0725952 3300039447 Bacteria 704
299 Ga0451787_698460 3300041441 Unclassified 510
300 Ga0451807_0608055 3300041486 Bacteria 600
301 Ga0439445_0234799 3300042004 Bacteria 546
302 Ga0439448_0019143 3300042005 Bacteria 2105
303 Ga0439459_0186256 3300042438 Bacteria 560
304 Ga0466963_0156746 3300044694 Bacteria 1583
305 Ga0466957_0007239 3300044842 Bacteria 6272
306 Ga0466957_0139981 3300044842 Bacteria 1558
307 Ga0466959_0302171 3300045049 Bacteria 1096
308 Ga0466958_0272835 3300045836 Bacteria 1083
309 Ga0466967_0096468 3300045976 Bacteria 2697
310 Ga0466967_0116997 3300045976 Bacteria 2456
311 Ga0495629_1025037 3300046459 Bacteria 536
312 Ga0495636_0051421 3300047318 Bacteria 1727
313 Ga0496104_0669087 3300048907 Bacteria 947
314 Ga0496109_1846063 3300048912 Bacteria 537
315 Ga0496112_1399165 3300048915 Bacteria 614
316 Ga0496119_0485811 3300048922 Bacteria 577
317 Ga0496126_0049701 3300048929 Bacteria 3827
318 Ga0501031_0051799 3300049568 Unclassified 2674
319 Ga0501032_0003708 3300049569 Bacteria 11595
320 Ga0501034_0018099 3300049571 Bacteria 7230
321 Ga0501034_0023207 3300049571 Bacteria 6321
322 Ga0501036_0000411 3300049572 Bacteria 30265
323 Ga0501037_0037030 3300049573 Bacteria 3595
324 Ga0501037_0522800 3300049573 Bacteria 803
325 Ga0501038_0008535 3300049574 Bacteria 9412
326 Ga0501040_0424245 3300049576 Unclassified 956
327 Ga0501042_0203992 3300049578 Unclassified 1426
328 Ga0501043_0022521 3300049579 Bacteria 4939
329 Ga0501046_0009204 3300049580 Bacteria 8552
330 Ga0501046_0062017 3300049580 Bacteria 2922
331 Ga0501047_0038840 3300049581 Bacteria 4604
332 Ga0501047_0144718 3300049581 Bacteria 2254
333 Ga0501047_0543936 3300049581 Bacteria 986
334 Ga0501048_1401618 3300049582 Unclassified 502
335 Ga0501067_0013690 3300049583 Bacteria 4492
336 Ga0501068_0003285 3300049584 Bacteria 8667
337 Ga0501069_0007065 3300049585 Bacteria 5880
338 Ga0501070_0414757 3300049586 Bacteria 1088
339 Ga0501070_0508195 3300049586 Bacteria 968
340 Ga0501070_0762992 3300049586 Unclassified 761
341 Ga0501072_0010228 3300049588 Bacteria 7146
342 Ga0501072_1485692 3300049588 Bacteria 523
343 Ga0501073_0190134 3300049589 Unclassified 1420
344 Ga0501074_0019413 3300049590 Bacteria 4937
345 Ga0501076_0025458 3300049592 Bacteria 4579
346 Ga0501077_0004262 3300049593 Bacteria 8646
347 Ga0501209_234795 3300049656 Bacteria 571
348 Ga0501079_0004737 3300049741 Bacteria 10075
349 Ga0501080_0028580 3300049742 Bacteria 5189
350 Ga0501080_0562655 3300049742 Bacteria 1015
351 Ga0501080_0790491 3300049742 Bacteria 833
352 Ga0501080_1341725 3300049742 Bacteria 612
353 Ga0501083_0329706 3300049744 Unclassified 992
354 Ga0501035_1015529 3300049822 Unclassified 651
355 Ga0501044_0811253 3300049823 Bacteria 814
356 nmdc:mga03683_328603_c1 3300050489 Unclassified 721
357 nmdc:mga03683_33737_c1 3300050489 Bacteria 1449
358 nmdc:mga03683_38838_c1 3300050489 Bacteria 1946
359 nmdc:mga03683_406660_c1 3300050489 Unclassified 650
360 nmdc:mga03683_43414_c1 3300050489 Bacteria 1854
361 nmdc:mga03683_84118_c1 3300050489 Bacteria 1378
362 nmdc:mga03n38_102638_c1 3300050490 Unclassified 1381
363 nmdc:mga03n38_926013_c1 3300050490 Unclassified 513
364 nmdc:mga00v17_227202_c1 3300050491 Unclassified 504
365 nmdc:mga00v17_612471_c1 3300050491 Bacteria 702
366 nmdc:mga0yw44_34171_c1 3300050492 Bacteria 2977
367 nmdc:mga0yw44_679802_c1 3300050492 Bacteria 699
368 nmdc:mga0k408_1694_c3 3300050493 Bacteria 2107
369 nmdc:mga0k408_254572_c1 3300050493 Bacteria 1048
370 nmdc:mga0k408_317838_c1 3300050493 Bacteria 929
371 nmdc:mga0k408_86080_c1 3300050493 Bacteria 1844
372 nmdc:mga06z11_149122_c1 3300050494 Bacteria 1328
373 nmdc:mga06z11_44403_c1 3300050494 Bacteria 2241
374 nmdc:mga06z11_448882_c1 3300050494 Bacteria 779
375 nmdc:mga06z11_84550_c1 3300050494 Unclassified 1710
376 nmdc:mga04h51_364761_c1 3300050495 Unclassified 599
377 nmdc:mga07m45_204714_c1 3300050496 Unclassified 1148
378 nmdc:mga05p37_231190_c1 3300050507 Bacteria 2228
379 nmdc:mga05p37_467298_c1 3300050507 Bacteria 1456
380 nmdc:mga09592_40797_c1 3300050508 Bacteria 3900
381 nmdc:mga09592_507184_c1 3300050508 Bacteria 1038
382 nmdc:mga09592_518329_c1 3300050508 Bacteria 1025
383 nmdc:mga08y16_111663_c1 3300050511 Bacteria 2845
384 nmdc:mga08y16_121353_c1 3300050511 Bacteria 2720
385 nmdc:mga08y16_684003_c1 3300050511 Bacteria 1027
386 nmdc:mga08y16_85158_c1 3300050511 Bacteria 3294
387 nmdc:mga0n895_355142_c1 3300050512 Bacteria 1484
388 nmdc:mga0n895_356850_c1 3300050512 Bacteria 1481
389 nmdc:mga0rr50_1753435_c1 3300050513 Unclassified 523
390 nmdc:mga0rr50_22813_c1 3300050513 Bacteria 4303
391 nmdc:mga0a205_180998_c1 3300050515 Bacteria 2002
392 nmdc:mga0a205_33236_c1 3300050515 Bacteria 4946
393 nmdc:mga0a205_440781_c1 3300050515 Bacteria 1163
394 nmdc:mga0sz30_2057_c1 3300050516 Bacteria 7188
395 nmdc:mga0sz30_7547_c2 3300050516 Bacteria 3837
396 Ga0500644_0137075 3300053088 Bacteria 969
397 Ga0500644_0179280 3300053088 Bacteria 866
398 Ga0500646_0177120 3300053090 Bacteria 721
399 Ga0500647_0053052 3300053091 Bacteria 1951
400 Ga0500651_0112882 3300053093 Bacteria 1657
401 Ga0500566_0484610 3300053094 Unclassified 535
402 Ga0500641_0001121 3300053096 Bacteria 9527
403 Ga0500658_0280511 3300053134 Bacteria 766
404 Ga0500577_0468138 3300053142 Unclassified 551
405 Ga0500616_0005260 3300053153 Bacteria 8846
406 Ga0500552_000420 3300053733 Bacteria 3918
407 Ga0501084_0020570 3300054114 Bacteria 5503
408 Ga0501082_0011161 3300060353 Bacteria 7722
409 Ga0157375_10711857
410 JGI24735J21928_10113996
411 Ga0065704_10808806
412 Ga0065707_10913435
413 Ga0070658_10528694
414 Ga0070683_100025132
415 Ga0070690_100146795
416 Ga0070680_100000091
417 Ga0070680_100281131
418 Ga0070682_101890626
419 Ga0068868_101088471
420 Ga0070660_100479727
421 Ga0070660_100504909
422 Ga0070660_100952348
423 Ga0070689_100167951
424 Ga0070689_100187699
425 Ga0070691_10004521
426 Ga0070661_100158274
427 Ga0070692_10115744
428 Ga0070692_10230061
429 Ga0070669_100509424
430 Ga0070671_101963360
431 Ga0070688_100360934
432 Ga0070659_100335767
433 Ga0070659_101879636
434 Ga0070714_102034909
435 Ga0070713_100039868
436 Ga0070713_100125347
437 Ga0070700_101716960
438 Ga0070694_101498484
439 Ga0070678_100025330
440 Ga0070678_102237364
441 Ga0070662_101289292
442 Ga0070681_10005698
443 Ga0070681_10700549
444 Ga0070706_101445382
445 Ga0070707_100581066
446 Ga0070707_100788704
447 Ga0070699_100901697
448 Ga0070679_100002144
449 Ga0070679_100406658
450 Ga0070684_100147198
451 Ga0070697_100732514
452 Ga0068853_100963731
453 Ga0070672_100832739
454 Ga0070665_100022313
455 Ga0070665_100535135
456 Ga0070665_101982206
457 Ga0070665_102039818
458 Ga0070704_102054654
459 Ga0070704_102083427
460 Ga0068855_100019698
461 Ga0068855_101792198
462 Ga0070664_100184016
463 Ga0070664_101747139
464 Ga0068857_100200976
465 Ga0068857_101046746
466 Ga0068857_101266632
467 Ga0068854_100560069
468 Ga0068854_100635731
469 Ga0068856_100069818
470 Ga0068856_100379876
471 Ga0068852_102121948
472 Ga0068859_100037530
473 Ga0068859_100693036
474 Ga0068859_101102575
475 Ga0068859_101200533
476 Ga0068859_102826794
477 Ga0068864_100447825
478 Ga0068864_102144969
479 Ga0068861_100244343
480 Ga0068863_100668595
481 Ga0068860_100673918
482 Ga0068860_101191878
483 Ga0068862_100406719
484 Ga0068862_102675093
485 Ga0081455_10000366
486 Ga0081455_10028594
487 Ga0081455_10035222
488 Ga0081455_11038875
489 Ga0081538_10155334
490 Ga0081540_1081025
491 Ga0081539_10000797
492 Ga0081539_10008864
493 Ga0081539_10093710
494 Ga0070717_10004600
495 Ga0070717_11242214
496 Ga0070717_11276732
497 Ga0075365_10121866
498 Ga0075365_10860488
499 Ga0075368_10059525
500 Ga0075368_10497666
501 Ga0075363_100084885
502 Ga0075363_100624565
503 Ga0075363_100657753
504 Ga0075364_10679988
505 Ga0070712_101997641
506 Ga0075362_10042663
507 Ga0075362_10101042
508 Ga0075362_10113115
509 Ga0075362_10223062
510 Ga0075362_10255945
511 Ga0075367_10036577
512 Ga0075367_10040591
513 Ga0075367_10784584
514 Ga0075369_10001838
515 Ga0075369_10032774
516 Ga0075366_10026885
517 Ga0075366_10089502
518 Ga0075366_10194251
519 Ga0075366_10299311
520 Ga0097621_100980541
521 Ga0075370_10059037
522 Ga0075370_10072061
523 Ga0068871_101332427
524 Ga0075428_100087259
525 Ga0075428_100345056
526 Ga0075430_101060054
527 Ga0075431_100069174
528 Ga0075431_100192959
529 Ga0075433_10029902
530 Ga0075433_10309690
531 Ga0075434_100384716
532 Ga0075429_100030904
533 Ga0075429_100565118
534 Ga0068865_100238790
535 Ga0097620_100037529
536 Ga0097620_100693056
537 Ga0097620_101102290
538 Ga0097620_101200501
539 Ga0097620_102826761
540 Ga0075435_100006958
541 Ga0099794_10202073
542 Ga0099794_10216391
543 Ga0105250_10505082
544 Ga0105240_10002528
545 Ga0105240_10014483
546 Ga0105240_11206976
547 Ga0111539_10043013
548 Ga0111539_10699110
549 Ga0111539_11317997
550 Ga0111539_11908674
551 Ga0105245_11200650
552 Ga0114129_10017601
553 Ga0114129_10101903
554 Ga0114129_11532083
555 Ga0114129_11735164
556 Ga0105243_12178335
557 Ga0105241_11348913
558 Ga0105241_11959368
559 Ga0105242_10666410
560 Ga0105237_10192938
561 Ga0105237_11164849
562 Ga0105238_10060686
563 Ga0105238_10274836
564 Ga0105238_10340221
565 Ga0105035_100379
566 Ga0099796_10114574
567 Ga0105239_10190087
568 Ga0105239_10193572
569 Ga0105239_12165032
570 Ga0157373_10357813
571 Ga0157371_10048428
572 Ga0157370_10176788
573 Ga0157369_10117095
574 Ga0157369_10369773
575 Ga0157374_10610196
576 Ga0157374_10630359
577 Ga0157378_10189845
578 Ga0157378_10282770
579 Ga0157378_12935997
580 Ga0163162_11021580
581 Ga0163162_11218084
582 Ga0157372_10490566
583 Ga0157375_11221678
584 Ga0157515_153337
585 Ga0163163_13086096
586 Ga0157380_10675201
587 Ga0157377_11309462
588 Ga0157379_10624603
589 Ga0157376_11504586
590 Ga0157376_11995183
591 Ga0163161_11021519
592 Ga0224572_1000026
593 Ga0224572_1032571
594 Ga0224572_1091070
595 Ga0228598_1001088
596 Ga0207426_1064699
597 Ga0207688_10083926
598 Ga0207699_10199127
599 Ga0207645_10038938
600 Ga0207643_10210798
601 Ga0207705_10094143
602 Ga0207684_11096006
603 Ga0207707_10009616
604 Ga0207707_10687185
605 Ga0207695_10034694
606 Ga0207695_10079118
607 Ga0207695_10217072
608 Ga0207671_10491752
609 Ga0207660_10018663
610 Ga0207660_10105424
611 Ga0207649_10264521
612 Ga0207652_10000929
613 Ga0207681_10234833
614 Ga0207681_10894132
615 Ga0207694_10037587
616 Ga0207694_10304904
617 Ga0207650_10265393
618 Ga0207700_10157774
619 Ga0207664_11915094
620 Ga0207644_10839025
621 Ga0207690_10116903
622 Ga0207706_11023563
623 Ga0207709_11000375
624 Ga0207670_10050799
625 Ga0207670_10168913
626 Ga0207665_10455551
627 Ga0207691_10933932
628 Ga0207689_10438958
629 Ga0207679_10368777
630 Ga0207667_10027640
631 Ga0207667_10067325
632 Ga0207667_11521811
633 Ga0207651_10325238
634 Ga0207712_10601428
635 Ga0207640_10103274
636 Ga0207640_10736693
637 Ga0207677_10525103
638 Ga0207703_10580698
639 Ga0207639_10544432
640 Ga0207639_11117683
641 Ga0207702_10215457
642 Ga0207702_11506651
643 Ga0207676_10278817
644 Ga0207674_10061299
645 Ga0207674_10215331
646 Ga0207674_10304578
647 Ga0207674_10685104
648 Ga0207675_100365397
649 Ga0207675_100532158
650 Ga0207683_10011244
651 Ga0207683_10599741
652 Ga0207698_10099643
653 Ga0209588_1185236
654 Ga0209813_10084454
655 Ga0209813_10482997
656 Ga0207428_10222782
657 Ga0207428_10776681
658 Ga0265354_1011302
659 Ga0268266_10054886
660 Ga0268266_10057101
661 Ga0268266_11622867
662 Ga0268265_11408711
663 Ga0265760_10013147
664 Ga0265760_10111173
665 Ga0265332_10488627
666 Ga0265331_10317646
667 Ga0307406_10518331
668 Ga0307407_11297521
669 Ga0307416_100127464
670 Ga0307416_100173302
671 Ga0307416_101798419
672 Ga0307411_10079894
673 Ga0307415_101568310
674 Ga0373949_0058385
675 Ga0373952_0237181
676 Ga0373936_0564743
677 Ga0373946_0191365
678 Ga0373942_0052576
679 Ga0373924_0177621
680 Ga0373931_0121390
681 Ga0373931_0338387
682 Ga0373931_0518526
683 Ga0373931_0567379
684 Ga0373935_0079810
685 Ga0373927_0044640
686 Ga0373933_1053891
687 Ga0373937_0520473
688 Ga0373925_0073456
689 Ga0373925_0594706
690 Ga0373925_1174840
691 Ga0373925_1355022
692 Ga0395899_0004738
693 Ga0395899_0043007
694 Ga0395899_0140395
695 Ga0395899_0160922
696 Ga0395900_0006254
697 Ga0395900_0037777
698 Ga0395900_0174406
699 Ga0395898_0052246
700 Ga0395898_0427819
701 Ga0395901_0014208
702 Ga0395901_0064693
703 Ga0395901_0088201
704 Ga0436365_1537893
705 Ga0436360_0716756
706 Ga0436361_0725952
707 Ga0451787_698460
708 Ga0451807_0608055
709 Ga0439445_0234799
710 Ga0439448_0019143
711 Ga0439459_0186256
712 Ga0466963_0156746
713 Ga0466957_0007239
714 Ga0466957_0139981
715 Ga0466959_0302171
716 Ga0466958_0272835
717 Ga0466967_0096468
718 Ga0466967_0116997
719 Ga0495629_1025037
720 Ga0495636_0051421
721 Ga0496104_0669087
722 Ga0496109_1846063
723 Ga0496112_1399165
724 Ga0496119_0485811
725 Ga0496126_0049701
726 Ga0501031_0051799
727 Ga0501032_0003708
728 Ga0501034_0018099
729 Ga0501034_0023207
730 Ga0501036_0000411
731 Ga0501037_0037030
732 Ga0501037_0522800
733 Ga0501038_0008535
734 Ga0501040_0424245
735 Ga0501042_0203992
736 Ga0501043_0022521
737 Ga0501046_0009204
738 Ga0501046_0062017
739 Ga0501047_0038840
740 Ga0501047_0144718
741 Ga0501047_0543936
742 Ga0501048_1401618
743 Ga0501067_0013690
744 Ga0501068_0003285
745 Ga0501069_0007065
746 Ga0501070_0414757
747 Ga0501070_0508195
748 Ga0501070_0762992
749 Ga0501072_0010228
750 Ga0501072_1485692
751 Ga0501073_0190134
752 Ga0501074_0019413
753 Ga0501076_0025458
754 Ga0501077_0004262
755 Ga0501209_234795
756 Ga0501079_0004737
757 Ga0501080_0028580
758 Ga0501080_0562655
759 Ga0501080_0790491
760 Ga0501080_1341725
761 Ga0501083_0329706
762 Ga0501035_1015529
763 Ga0501044_0811253
764 nmdc:mga03683_328603_c1
765 nmdc:mga03683_33737_c1
766 nmdc:mga03683_38838_c1
767 nmdc:mga03683_406660_c1
768 nmdc:mga03683_43414_c1
769 nmdc:mga03683_84118_c1
770 nmdc:mga03n38_102638_c1
771 nmdc:mga03n38_926013_c1
772 nmdc:mga00v17_227202_c1
773 nmdc:mga00v17_612471_c1
774 nmdc:mga0yw44_34171_c1
775 nmdc:mga0yw44_679802_c1
776 nmdc:mga0k408_1694_c3
777 nmdc:mga0k408_254572_c1
778 nmdc:mga0k408_317838_c1
779 nmdc:mga0k408_86080_c1
780 nmdc:mga06z11_149122_c1
781 nmdc:mga06z11_44403_c1
782 nmdc:mga06z11_448882_c1
783 nmdc:mga06z11_84550_c1
784 nmdc:mga04h51_364761_c1
785 nmdc:mga07m45_204714_c1
786 nmdc:mga05p37_231190_c1
787 nmdc:mga05p37_467298_c1
788 nmdc:mga09592_40797_c1
789 nmdc:mga09592_507184_c1
790 nmdc:mga09592_518329_c1
791 nmdc:mga08y16_111663_c1
792 nmdc:mga08y16_121353_c1
793 nmdc:mga08y16_684003_c1
794 nmdc:mga08y16_85158_c1
795 nmdc:mga0n895_355142_c1
796 nmdc:mga0n895_356850_c1
797 nmdc:mga0rr50_1753435_c1
798 nmdc:mga0rr50_22813_c1
799 nmdc:mga0a205_180998_c1
800 nmdc:mga0a205_33236_c1
801 nmdc:mga0a205_440781_c1
802 nmdc:mga0sz30_2057_c1
803 nmdc:mga0sz30_7547_c2
804 Ga0500644_0137075
805 Ga0500644_0179280
806 Ga0500646_0177120
807 Ga0500647_0053052
808 Ga0500651_0112882
809 Ga0500566_0484610
810 Ga0500641_0001121
811 Ga0500658_0280511
812 Ga0500577_0468138
813 Ga0500616_0005260
814 Ga0500552_000420
815 Ga0501084_0020570
816 Ga0501082_0011161

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

63

141

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.9292 1 128
5cuf-assembly2.cif.gz_B x-ray crystal structure of semet human sestrin2 0.9024 31 95
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.9021 1 128
3bey-assembly1.cif.gz_A crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.8896 39 122
3bey-assembly1.cif.gz_F crystal structure of the protein o27018 from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt217 0.8832 39 122
ID Description Score Start End Superfamily
2ouwA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9545 12 128 1.20.1290.10
af_A0F081_38_194_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8753 39 98 1.20.1290.10
af_U3JAG5_124_286_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8635 13 95 1.20.1290.10
af_O06218_5_119_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8584 3 105 1.20.1290.10
3beyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8563 39 120 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A521LUV9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9939 1 131 GO:0051920
AF-A0A521LUV9-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9864 1 131 GO:0051920
AF-A0A2V9VNU2-F1-model_v4 Alkylhydroperoxidase 0.9848 32 131 GO:0051920
AF-A0A2S5LRH5-F1-model_v4 Alkylhydroperoxidase 0.9782 36 131 GO:0051920
AF-A0A2V8VM71-F1-model_v4 Alkylhydroperoxidase 0.9777 3 97 GO:0051920

Map