F436454

General Info

Members Datasets Scaffolds Average Seq Length
407 232 815 182

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000069|Ga0105248_100000699
Length 216
Sequence MAAQRRADAAVPRPTAGHRLIWGQGGLSSRSAEDDMAQEIATLAGGCFWCVEAVFDDVIGVSSVESGYIGGQVSNPSYKQVCGGDTGHAEAIRISFDPDVISYGELLDIFFHVHDPTQLNRQGNDVGTQYRSAIFPHSPAQAAAARAAIERAQADWPQPIVTTIEPDAPWYPAEGYHQEYFAREGQNNGYCVMVVAPKLAKFRKSYAARLKDKAAV

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
146 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
154 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
168 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
169 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
190 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
191 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
198 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
205 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
213 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
214 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
219 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
222 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
225 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
228 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
229 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
230 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
231 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
232 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 0
Rhizoplane 3.44
Rhizosphere 84.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10000069 3300009177 Bacteria 120989
2 JGI24739J22299_10001474 3300001989 Bacteria 8879
3 JGI24737J22298_10000968 3300001990 Bacteria 10188
4 JGI24735J21928_10004823 3300002067 Bacteria 4500
5 JGI24749J21850_1000253 3300002076 Bacteria 8381
6 JGI24034J26672_10005062 3300002239 Bacteria 1883
7 JGI24751J29686_10000304 3300002459 Bacteria 18557
8 JGI24751J29686_10000575 3300002459 Bacteria 9950
9 JGI24751J29686_10065957 3300002459 Bacteria 745
10 rootH1_10068669 3300003316 Bacteria 1704
11 rootH1_10068669 3300003323 Bacteria 8036
12 rootH2_10145930 3300003320 Bacteria 2025
13 rootH1_10166812 3300003323 Bacteria 1312
14 Ga0065715_10394549 3300005293 Bacteria 890
15 Ga0065707_10083421 3300005295 Bacteria 9242
16 Ga0065707_10419611 3300005295 Bacteria 832
17 Ga0070658_10000055 3300005327 Bacteria 114800
18 Ga0070658_10010401 3300005327 Bacteria 7461
19 Ga0070683_100637353 3300005329 Bacteria 1020
20 Ga0070683_101318319 3300005329 Bacteria 694
21 Ga0070670_100000005 3300005331 Bacteria 351569
22 Ga0070670_100004915 3300005331 Bacteria 11248
23 Ga0070666_10009386 3300005335 Bacteria 6096
24 Ga0070666_10070570 3300005335 Bacteria 2377
25 Ga0070666_10088830 3300005335 Bacteria 2121
26 Ga0070666_10366211 3300005335 Bacteria 1033
27 Ga0068868_100234039 3300005338 Bacteria 1542
28 Ga0070660_100000690 3300005339 Bacteria 22362
29 Ga0070660_100006723 3300005339 Bacteria 7977
30 Ga0070660_100612701 3300005339 Bacteria 911
31 Ga0070689_100351118 3300005340 Bacteria 1237
32 Ga0070661_100005939 3300005344 Bacteria 8409
33 Ga0070661_100027959 3300005344 Bacteria 4065
34 Ga0070668_100000005 3300005347 Bacteria 187511
35 Ga0070668_100027635 3300005347 Bacteria 4307
36 Ga0070668_100086218 3300005347 Bacteria 2469
37 Ga0070669_100000141 3300005353 Bacteria 64131
38 Ga0070669_100026591 3300005353 Bacteria 4164
39 Ga0070669_100117803 3300005353 Bacteria 2022
40 Ga0070675_100080672 3300005354 Bacteria 2712
41 Ga0070675_101237080 3300005354 Bacteria 688
42 Ga0070671_100000069 3300005355 Bacteria 67279
43 Ga0070671_100000075 3300005355 Bacteria 63999
44 Ga0070671_100034313 3300005355 Bacteria 4200
45 Ga0070671_100049017 3300005355 Bacteria 3514
46 Ga0070671_100151382 3300005355 Bacteria 1959
47 Ga0070671_100511088 3300005355 Bacteria 1034
48 Ga0070674_100055779 3300005356 Bacteria 2738
49 Ga0070674_100099261 3300005356 Bacteria 2118
50 Ga0070673_100090602 3300005364 Bacteria 2498
51 Ga0070659_100044604 3300005366 Bacteria 3472
52 Ga0070667_100000004 3300005367 Bacteria 444091
53 Ga0070667_100004419 3300005367 Bacteria 11861
54 Ga0070667_100203142 3300005367 Bacteria 1759
55 Ga0070667_100229317 3300005367 Bacteria 1656
56 Ga0070667_100480288 3300005367 Bacteria 1138
57 Ga0070711_100090842 3300005439 Bacteria 2200
58 Ga0070663_100004582 3300005455 Bacteria 8142
59 Ga0070663_100368244 3300005455 Bacteria 1167
60 Ga0070663_100648442 3300005455 Bacteria 893
61 Ga0070678_100009859 3300005456 Bacteria 5806
62 Ga0070678_100166721 3300005456 Bacteria 1790
63 Ga0070662_100000340 3300005457 Bacteria 28030
64 Ga0070662_100047097 3300005457 Bacteria 3100
65 Ga0070681_10383532 3300005458 Bacteria 1316
66 Ga0068867_100003972 3300005459 Bacteria 10404
67 Ga0070685_10365518 3300005466 Bacteria 990
68 Ga0070684_100030231 3300005535 Bacteria 4600
69 Ga0068853_100005128 3300005539 Bacteria 10239
70 Ga0068853_100084235 3300005539 Bacteria 2785
71 Ga0068853_100380644 3300005539 Bacteria 1318
72 Ga0068853_100418631 3300005539 Bacteria 1256
73 Ga0070672_100213432 3300005543 Bacteria 1617
74 Ga0070686_100457346 3300005544 Bacteria 983
75 Ga0070665_100028912 3300005548 Bacteria 5580
76 Ga0070665_100178615 3300005548 Bacteria 2124
77 Ga0070665_100297282 3300005548 Bacteria 1617
78 Ga0068855_100003919 3300005563 Bacteria 18171
79 Ga0070664_100010088 3300005564 Bacteria 7657
80 Ga0070664_100023128 3300005564 Bacteria 5131
81 Ga0068857_100013297 3300005577 Bacteria 7170
82 Ga0068857_100066119 3300005577 Bacteria 3216
83 Ga0068857_100655854 3300005577 Bacteria 995
84 Ga0068854_100008478 3300005578 Bacteria 6610
85 Ga0068854_100032053 3300005578 Bacteria 3654
86 Ga0068856_100000121 3300005614 Bacteria 78250
87 Ga0068856_100009906 3300005614 Bacteria 9256
88 Ga0068856_100215159 3300005614 Bacteria 1937
89 Ga0070702_100277960 3300005615 Bacteria 1148
90 Ga0068852_100001320 3300005616 Bacteria 16608
91 Ga0068852_100001886 3300005616 Bacteria 14284
92 Ga0068852_100010595 3300005616 Bacteria 6897
93 Ga0068859_100000375 3300005617 Bacteria 44582
94 Ga0068859_100028547 3300005617 Bacteria 5594
95 Ga0068859_100169670 3300005617 Bacteria 2263
96 Ga0068859_100184006 3300005617 Bacteria 2173
97 Ga0068864_100000011 3300005618 Bacteria 350056
98 Ga0068864_100005071 3300005618 Bacteria 10787
99 Ga0068864_100097748 3300005618 Bacteria 2600
100 Ga0068861_100009696 3300005719 Bacteria 6657
101 Ga0068861_100227863 3300005719 Bacteria 1579
102 Ga0068851_10016106 3300005834 Bacteria 3573
103 Ga0068863_100009326 3300005841 Bacteria 9575
104 Ga0068863_100009784 3300005841 Bacteria 9346
105 Ga0068863_100020878 3300005841 Bacteria 6255
106 Ga0068863_100023472 3300005841 Bacteria 5889
107 Ga0068858_100000248 3300005842 Bacteria 57728
108 Ga0068858_100751884 3300005842 Bacteria 950
109 Ga0068860_100000002 3300005843 Bacteria 627849
110 Ga0068860_100014310 3300005843 Bacteria 7779
111 Ga0068860_100024978 3300005843 Bacteria 5769
112 Ga0068860_100156445 3300005843 Bacteria 2197
113 Ga0068862_100000011 3300005844 Bacteria 270105
114 Ga0068862_100000187 3300005844 Bacteria 68303
115 Ga0068862_100006582 3300005844 Bacteria 9632
116 Ga0068862_100302037 3300005844 Bacteria 1473
117 Ga0075364_10017790 3300006051 Bacteria 4445
118 Ga0075366_10055515 3300006195 Bacteria 2353
119 Ga0075366_10109449 3300006195 Bacteria 1661
120 Ga0097621_100597842 3300006237 Bacteria 1008
121 Ga0068871_100161673 3300006358 Bacteria 1916
122 Ga0097620_100000375 3300006931 Bacteria 44582
123 Ga0097620_100028547 3300006931 Bacteria 5594
124 Ga0097620_100169668 3300006931 Bacteria 2263
125 Ga0097620_100183995 3300006931 Bacteria 2173
126 Ga0105240_10024541 3300009093 Bacteria 7946
127 Ga0105240_10502106 3300009093 Bacteria 1348
128 Ga0105243_10292473 3300009148 Bacteria 1472
129 Ga0105243_10965587 3300009148 Bacteria 852
130 Ga0105242_10041645 3300009176 Bacteria 3705
131 Ga0105248_10073934 3300009177 Bacteria 3831
132 Ga0105248_10571806 3300009177 Bacteria 1275
133 Ga0105237_10021615 3300009545 Bacteria 6614
134 Ga0105237_10075605 3300009545 Bacteria 3359
135 Ga0105237_11310964 3300009545 Bacteria 730
136 Ga0105238_10075260 3300009551 Bacteria 3368
137 Ga0105249_10000666 3300009553 Bacteria 31174
138 Ga0105249_10230950 3300009553 Bacteria 1825
139 Ga0105249_10418235 3300009553 Bacteria 1374
140 Ga0105249_10862144 3300009553 Bacteria 971
141 Ga0105239_10000073 3300010375 Bacteria 140771
142 Ga0157327_1004133 3300012512 Bacteria 1109
143 Ga0157373_10000313 3300013100 Bacteria 39072
144 Ga0157371_10001341 3300013102 Bacteria 25918
145 Ga0157371_10078670 3300013102 Bacteria 2336
146 Ga0157369_10008450 3300013105 Bacteria 11809
147 Ga0157369_10645042 3300013105 Bacteria 1092
148 Ga0157374_10033166 3300013296 Bacteria 4710
149 Ga0157378_10191475 3300013297 Bacteria 1929
150 Ga0163162_10011285 3300013306 Bacteria 8711
151 Ga0157372_10005180 3300013307 Bacteria 13866
152 Ga0157372_10160909 3300013307 Bacteria 2595
153 Ga0157372_11324141 3300013307 Bacteria 831
154 Ga0157375_10273024 3300013308 Bacteria 1853
155 Ga0163163_10044474 3300014325 Bacteria 4356
156 Ga0157380_10011592 3300014326 Bacteria 6373
157 Ga0157380_10235591 3300014326 Bacteria 1647
158 Ga0157376_11184008 3300014969 Bacteria 792
159 Ga0157376_11243605 3300014969 Bacteria 773
160 Ga0163161_10021914 3300017792 Bacteria 4492
161 Ga0163161_10059013 3300017792 Bacteria 2790
162 Ga0163161_10439673 3300017792 Bacteria 1052
163 Ga0207680_10002329 3300025903 Bacteria 8837
164 Ga0207680_10151484 3300025903 Bacteria 1546
165 Ga0207680_10353131 3300025903 Bacteria 1033
166 Ga0207647_10000068 3300025904 Bacteria 81240
167 Ga0207647_10012600 3300025904 Bacteria 5880
168 Ga0207705_10000139 3300025909 Bacteria 78756
169 Ga0207705_10062381 3300025909 Bacteria 2692
170 Ga0207695_10029931 3300025913 Bacteria 6005
171 Ga0207695_10039642 3300025913 Bacteria 5060
172 Ga0207671_10011024 3300025914 Bacteria 7400
173 Ga0207671_10111285 3300025914 Bacteria 2083
174 Ga0207671_10759158 3300025914 Bacteria 770
175 Ga0207657_10001155 3300025919 Bacteria 28103
176 Ga0207657_10006223 3300025919 Bacteria 12404
177 Ga0207657_10254888 3300025919 Bacteria 1398
178 Ga0207657_10315940 3300025919 Bacteria 1236
179 Ga0207657_10675116 3300025919 Bacteria 803
180 Ga0207649_10011673 3300025920 Bacteria 4853
181 Ga0207649_10372510 3300025920 Bacteria 1062
182 Ga0207681_10000001 3300025923 Bacteria 1105841
183 Ga0207681_10000234 3300025923 Bacteria 43018
184 Ga0207681_10022563 3300025923 Bacteria 4016
185 Ga0207681_10100550 3300025923 Bacteria 2084
186 Ga0207694_10281943 3300025924 Bacteria 1365
187 Ga0207650_10000018 3300025925 Bacteria 352120
188 Ga0207650_10003749 3300025925 Bacteria 10394
189 Ga0207650_10010912 3300025925 Bacteria 6244
190 Ga0207650_10427877 3300025925 Bacteria 1099
191 Ga0207659_10067241 3300025926 Bacteria 2603
192 Ga0207644_10000004 3300025931 Bacteria 566613
193 Ga0207644_10000029 3300025931 Bacteria 139264
194 Ga0207644_10002447 3300025931 Bacteria 11978
195 Ga0207644_10272430 3300025931 Bacteria 1357
196 Ga0207644_10785204 3300025931 Bacteria 796
197 Ga0207690_10002511 3300025932 Bacteria 11088
198 Ga0207690_10004789 3300025932 Bacteria 7982
199 Ga0207690_10023168 3300025932 Bacteria 3873
200 Ga0207690_10041592 3300025932 Bacteria 3013
201 Ga0207706_10000351 3300025933 Bacteria 49664
202 Ga0207706_10051958 3300025933 Bacteria 3619
203 Ga0207706_10064834 3300025933 Bacteria 3217
204 Ga0207686_10189013 3300025934 Bacteria 1467
205 Ga0207709_10276952 3300025935 Bacteria 1237
206 Ga0207709_10721582 3300025935 Bacteria 799
207 Ga0207669_10037982 3300025937 Bacteria 2768
208 Ga0207669_10078366 3300025937 Bacteria 2105
209 Ga0207704_10035703 3300025938 Bacteria 2852
210 Ga0207691_10019794 3300025940 Bacteria 6366
211 Ga0207711_10003547 3300025941 Bacteria 13514
212 Ga0207711_10137528 3300025941 Bacteria 2195
213 Ga0207711_11044975 3300025941 Bacteria 757
214 Ga0207679_10004504 3300025945 Bacteria 8678
215 Ga0207679_10025076 3300025945 Bacteria 4096
216 Ga0207651_10122225 3300025960 Bacteria 1976
217 Ga0207651_10640704 3300025960 Bacteria 932
218 Ga0207712_10000048 3300025961 Bacteria 160050
219 Ga0207712_10018624 3300025961 Bacteria 4525
220 Ga0207668_10000008 3300025972 Bacteria 189904
221 Ga0207668_10019617 3300025972 Bacteria 4277
222 Ga0207668_10115285 3300025972 Bacteria 2024
223 Ga0207640_10011296 3300025981 Bacteria 5052
224 Ga0207640_10153161 3300025981 Bacteria 1696
225 Ga0207658_10000002 3300025986 Bacteria 1364188
226 Ga0207658_10003064 3300025986 Bacteria 11957
227 Ga0207658_10316691 3300025986 Bacteria 1349
228 Ga0207658_10608477 3300025986 Bacteria 982
229 Ga0207677_10288037 3300026023 Bacteria 1351
230 Ga0207703_10000313 3300026035 Bacteria 52703
231 Ga0207703_10502282 3300026035 Bacteria 1138
232 Ga0207703_11268483 3300026035 Bacteria 708
233 Ga0207639_10002265 3300026041 Bacteria 12933
234 Ga0207639_10145548 3300026041 Bacteria 1979
235 Ga0207678_10002339 3300026067 Bacteria 17182
236 Ga0207678_10313893 3300026067 Bacteria 1348
237 Ga0207702_10004957 3300026078 Bacteria 11693
238 Ga0207702_10058963 3300026078 Bacteria 3268
239 Ga0207641_10002849 3300026088 Bacteria 15717
240 Ga0207641_10003066 3300026088 Bacteria 15065
241 Ga0207641_10004321 3300026088 Bacteria 12343
242 Ga0207641_10008744 3300026088 Bacteria 8366
243 Ga0207648_10024655 3300026089 Bacteria 5366
244 Ga0207676_10000004 3300026095 Bacteria 725417
245 Ga0207676_10011030 3300026095 Bacteria 6448
246 Ga0207676_10343324 3300026095 Bacteria 1378
247 Ga0207674_10016670 3300026116 Bacteria 8030
248 Ga0207674_10020980 3300026116 Bacteria 7046
249 Ga0207674_10515997 3300026116 Bacteria 1154
250 Ga0207675_100000119 3300026118 Bacteria 64605
251 Ga0207675_100099706 3300026118 Bacteria 2736
252 Ga0207683_10007938 3300026121 Bacteria 9084
253 Ga0207683_10186837 3300026121 Bacteria 1880
254 Ga0207698_10000373 3300026142 Bacteria 26175
255 Ga0207698_10062825 3300026142 Bacteria 2903
256 Ga0207698_10619527 3300026142 Bacteria 1069
257 Ga0268266_10007896 3300028379 Bacteria 9528
258 Ga0268266_10236912 3300028379 Bacteria 1683
259 Ga0268266_10655497 3300028379 Bacteria 1010
260 Ga0268265_10000002 3300028380 Bacteria 1035381
261 Ga0268265_10000209 3300028380 Bacteria 68317
262 Ga0268265_10001446 3300028380 Bacteria 20015
263 Ga0268265_10079894 3300028380 Bacteria 2578
264 Ga0268265_10165003 3300028380 Bacteria 1887
265 Ga0268264_10000001 3300028381 Bacteria 1221000
266 Ga0268264_10001688 3300028381 Bacteria 20359
267 Ga0268264_10588767 3300028381 Bacteria 1095
268 Ga0316182_1268712 3300030745 Bacteria 832
269 Ga0307513_10044357 3300031456 Bacteria 4872
270 Ga0307408_100005491 3300031548 Bacteria 8476
271 Ga0307408_100316668 3300031548 Bacteria 1313
272 Ga0307408_100595079 3300031548 Bacteria 982
273 Ga0307405_10071367 3300031731 Bacteria 2234
274 Ga0307405_10357630 3300031731 Bacteria 1128
275 Ga0307405_10833325 3300031731 Bacteria 775
276 Ga0307413_10419989 3300031824 Bacteria 1053
277 Ga0307410_10775169 3300031852 Bacteria 814
278 Ga0307406_10001555 3300031901 Bacteria 12669
279 Ga0307407_10204414 3300031903 Bacteria 1326
280 Ga0307407_10631442 3300031903 Bacteria 800
281 Ga0307412_10033641 3300031911 Bacteria 3260
282 Ga0307409_100006013 3300031995 Bacteria 7075
283 Ga0307409_100559806 3300031995 Bacteria 1124
284 Ga0307416_100215487 3300032002 Bacteria 1836
285 Ga0307414_11588437 3300032004 Bacteria 609
286 Ga0307411_10131234 3300032005 Bacteria 1831
287 Ga0307411_10198261 3300032005 Bacteria 1539
288 Ga0307415_100019779 3300032126 Bacteria 4095
289 Ga0307415_100173041 3300032126 Bacteria 1686
290 Ga0307415_100860942 3300032126 Bacteria 832
291 Ga0373934_0185556 3300035086 Bacteria 855
292 Ga0373953_0076864 3300035117 Bacteria 1384
293 Ga0373937_0039612 3300036401 Bacteria 4294
294 Ga0373937_0129180 3300036401 Bacteria 2359
295 Ga0373925_0423278 3300037068 Bacteria 1088
296 Ga0395899_0018378 3300037312 Bacteria 5315
297 Ga0395899_0064400 3300037312 Bacteria 2695
298 Ga0395900_0001258 3300037418 Bacteria 31050
299 Ga0395900_0103428 3300037418 Bacteria 2925
300 Ga0395898_0287231 3300037466 Bacteria 1569
301 Ga0395898_1036142 3300037466 Bacteria 755
302 Ga0395905_0001084 3300037471 Bacteria 34224
303 Ga0395905_0199047 3300037471 Bacteria 1878
304 Ga0395905_0405776 3300037471 Bacteria 1258
305 Ga0395901_0067713 3300038443 Bacteria 3719
306 Ga0395901_0073728 3300038443 Bacteria 3560
307 Ga0395901_0101233 3300038443 Bacteria 3023
308 Ga0237819_00389 3300038705 Bacteria 15393
309 Ga0237816_02093 3300039145 Bacteria 1562
310 Ga0436365_0821190 3300039437 Bacteria 17086
311 Ga0439436_0046209 3300041404 Bacteria 1237
312 Ga0439439_0001789 3300041406 Bacteria 4389
313 Ga0439448_0004024 3300042005 Bacteria 4129
314 Ga0439448_0040655 3300042005 Bacteria 1502
315 Ga0439455_0001104 3300042012 Bacteria 4314
316 Ga0439455_0001486 3300042012 Bacteria 3936
317 Ga0439455_0017634 3300042012 Bacteria 1666
318 Ga0439462_0091107 3300042015 Bacteria 836
319 Ga0450920_077873 3300042122 Bacteria 678
320 Ga0439458_0001894 3300042157 Bacteria 5182
321 Ga0466972_0015349 3300044658 Bacteria 3829
322 Ga0466961_0198191 3300044693 Bacteria 1242
323 Ga0466963_0001228 3300044694 Bacteria 13526
324 Ga0466964_0006002 3300044706 Bacteria 4528
325 Ga0466968_0046567 3300044735 Bacteria 1842
326 Ga0466970_0016791 3300044765 Bacteria 3778
327 Ga0466960_0005879 3300044901 Bacteria 4890
328 Ga0466958_0017992 3300045836 Bacteria 4096
329 Ga0466958_0247615 3300045836 Bacteria 1139
330 Ga0466967_0012709 3300045976 Bacteria 6460
331 Ga0495629_0120744 3300046459 Bacteria 1826
332 Ga0495664_0004496 3300046477 Bacteria 7630
333 Ga0495583_0140133 3300046506 Bacteria 1007
334 Ga0495637_0040985 3300046520 Bacteria 1990
335 Ga0495643_0040838 3300046522 Bacteria 2532
336 Ga0495597_0032177 3300046542 Bacteria 2381
337 Ga0495645_0082854 3300046543 Bacteria 2299
338 Ga0495622_0298821 3300046557 Bacteria 702
339 Ga0495625_0419222 3300046660 Bacteria 833
340 Ga0495674_0342900 3300047319 Bacteria 1214
341 Ga0495673_0013165 3300047469 Bacteria 4354
342 Ga0495681_0056302 3300047470 Bacteria 1830
343 Ga0495686_0000141 3300047472 Bacteria 144510
344 Ga0496100_0008165 3300048903 Bacteria 5829
345 Ga0496101_0550132 3300048904 Bacteria 912
346 Ga0496102_0046455 3300048905 Bacteria 3944
347 Ga0496102_0708504 3300048905 Bacteria 929
348 Ga0496104_0087550 3300048907 Bacteria 2974
349 Ga0496106_0000129 3300048909 Bacteria 58082
350 Ga0496106_0000971 3300048909 Bacteria 20941
351 Ga0496107_0004669 3300048910 Bacteria 9297
352 Ga0496108_0575880 3300048911 Bacteria 981
353 Ga0496109_0052074 3300048912 Bacteria 3730
354 Ga0496110_0161308 3300048913 Bacteria 2032
355 Ga0496111_0010824 3300048914 Bacteria 6132
356 Ga0496112_0255283 3300048915 Bacteria 1703
357 Ga0496113_0008317 3300048916 Bacteria 6753
358 Ga0496118_0015442 3300048921 Bacteria 7067
359 Ga0496119_0056304 3300048922 Bacteria 2383
360 Ga0496120_0214278 3300048923 Bacteria 924
361 Ga0496121_0001743 3300048924 Bacteria 35549
362 Ga0496121_0008548 3300048924 Bacteria 12008
363 Ga0496122_0001884 3300048925 Bacteria 31769
364 Ga0496122_0304953 3300048925 Bacteria 856
365 Ga0496123_0027474 3300048926 Bacteria 4237
366 Ga0496124_0062081 3300048927 Bacteria 3128
367 Ga0496126_0318618 3300048929 Bacteria 1279
368 Ga0501290_000774 3300049513 Bacteria 4736
369 Ga0501293_008454 3300049516 Bacteria 865
370 Ga0501032_0028062 3300049569 Bacteria 3868
371 Ga0501043_0056104 3300049579 Bacteria 3094
372 Ga0501047_0007066 3300049581 Bacteria 10544
373 Ga0501257_000005 3300049686 Bacteria 58189
374 Ga0501079_0988747 3300049741 Bacteria 663
375 Ga0501241_010062 3300049758 Bacteria 1720
376 Ga0501280_000636 3300049776 Bacteria 7906
377 nmdc:mga00v17_20567_c1 3300050491 Bacteria 3783
378 nmdc:mga07m45_151379_c1 3300050496 Bacteria 1345
379 nmdc:mga07m45_438260_c1 3300050496 Bacteria 758
380 Ga0495601_0094711 3300053077 Bacteria 1925
381 Ga0500643_003074 3300053087 Bacteria 8200
382 Ga0500643_004579 3300053087 Bacteria 6192
383 Ga0500643_006324 3300053087 Bacteria 4963
384 Ga0500583_0268031 3300053092 Bacteria 841
385 Ga0500651_0004270 3300053093 Bacteria 7981
386 Ga0500566_0000251 3300053094 Bacteria 28795
387 Ga0500641_0027501 3300053096 Bacteria 2215
388 Ga0500592_000936 3300053116 Bacteria 4756
389 Ga0500614_038114 3300053123 Bacteria 1209
390 Ga0500618_008250 3300053125 Bacteria 2922
391 Ga0500642_0000429 3300053130 Bacteria 13702
392 Ga0500655_000021 3300053133 Bacteria 43984
393 Ga0500655_047582 3300053133 Bacteria 850
394 Ga0500658_0009116 3300053134 Bacteria 3662
395 Ga0500559_0062058 3300053136 Bacteria 1668
396 Ga0500622_0107901 3300053156 Bacteria 1363
397 Ga0500639_225446 3300053163 Bacteria 777
398 Ga0500636_0139343 3300053177 Bacteria 1344
399 Ga0500570_007566 3300053724 Bacteria 5958
400 Ga0500552_009706 3300053733 Bacteria 1167
401 Ga0466962_0000271 3300061719 Bacteria 21889
402 Ga0466962_0058209 3300061719 Bacteria 1845
403 2585260662 2582581305 Bacteria 4895574
404 2643730482 2643221541 Bacteria 5498788
405 2644037102 2643221605 Bacteria 4772303
406 2644043651 2643221606 Bacteria 5588032
407 2644125416 2643221622 Bacteria 4212502
408 2644393810 2643221671 Bacteria 5496681
409 Ga0105248_10000069
410 JGI24739J22299_10001474
411 JGI24737J22298_10000968
412 JGI24735J21928_10004823
413 JGI24749J21850_1000253
414 JGI24034J26672_10005062
415 JGI24751J29686_10000304
416 JGI24751J29686_10000575
417 JGI24751J29686_10065957
418 rootH1_10068669
419 rootH2_10145930
420 rootH1_10166812
421 Ga0065715_10394549
422 Ga0065707_10083421
423 Ga0065707_10419611
424 Ga0070658_10000055
425 Ga0070658_10010401
426 Ga0070683_100637353
427 Ga0070683_101318319
428 Ga0070670_100000005
429 Ga0070670_100004915
430 Ga0070666_10009386
431 Ga0070666_10070570
432 Ga0070666_10088830
433 Ga0070666_10366211
434 Ga0068868_100234039
435 Ga0070660_100000690
436 Ga0070660_100006723
437 Ga0070660_100612701
438 Ga0070689_100351118
439 Ga0070661_100005939
440 Ga0070661_100027959
441 Ga0070668_100000005
442 Ga0070668_100027635
443 Ga0070668_100086218
444 Ga0070669_100000141
445 Ga0070669_100026591
446 Ga0070669_100117803
447 Ga0070675_100080672
448 Ga0070675_101237080
449 Ga0070671_100000069
450 Ga0070671_100000075
451 Ga0070671_100034313
452 Ga0070671_100049017
453 Ga0070671_100151382
454 Ga0070671_100511088
455 Ga0070674_100055779
456 Ga0070674_100099261
457 Ga0070673_100090602
458 Ga0070659_100044604
459 Ga0070667_100000004
460 Ga0070667_100004419
461 Ga0070667_100203142
462 Ga0070667_100229317
463 Ga0070667_100480288
464 Ga0070711_100090842
465 Ga0070663_100004582
466 Ga0070663_100368244
467 Ga0070663_100648442
468 Ga0070678_100009859
469 Ga0070678_100166721
470 Ga0070662_100000340
471 Ga0070662_100047097
472 Ga0070681_10383532
473 Ga0068867_100003972
474 Ga0070685_10365518
475 Ga0070684_100030231
476 Ga0068853_100005128
477 Ga0068853_100084235
478 Ga0068853_100380644
479 Ga0068853_100418631
480 Ga0070672_100213432
481 Ga0070686_100457346
482 Ga0070665_100028912
483 Ga0070665_100178615
484 Ga0070665_100297282
485 Ga0068855_100003919
486 Ga0070664_100010088
487 Ga0070664_100023128
488 Ga0068857_100013297
489 Ga0068857_100066119
490 Ga0068857_100655854
491 Ga0068854_100008478
492 Ga0068854_100032053
493 Ga0068856_100000121
494 Ga0068856_100009906
495 Ga0068856_100215159
496 Ga0070702_100277960
497 Ga0068852_100001320
498 Ga0068852_100001886
499 Ga0068852_100010595
500 Ga0068859_100000375
501 Ga0068859_100028547
502 Ga0068859_100169670
503 Ga0068859_100184006
504 Ga0068864_100000011
505 Ga0068864_100005071
506 Ga0068864_100097748
507 Ga0068861_100009696
508 Ga0068861_100227863
509 Ga0068851_10016106
510 Ga0068863_100009326
511 Ga0068863_100009784
512 Ga0068863_100020878
513 Ga0068863_100023472
514 Ga0068858_100000248
515 Ga0068858_100751884
516 Ga0068860_100000002
517 Ga0068860_100014310
518 Ga0068860_100024978
519 Ga0068860_100156445
520 Ga0068862_100000011
521 Ga0068862_100000187
522 Ga0068862_100006582
523 Ga0068862_100302037
524 Ga0075364_10017790
525 Ga0075366_10055515
526 Ga0075366_10109449
527 Ga0097621_100597842
528 Ga0068871_100161673
529 Ga0097620_100000375
530 Ga0097620_100028547
531 Ga0097620_100169668
532 Ga0097620_100183995
533 Ga0105240_10024541
534 Ga0105240_10502106
535 Ga0105243_10292473
536 Ga0105243_10965587
537 Ga0105242_10041645
538 Ga0105248_10073934
539 Ga0105248_10571806
540 Ga0105237_10021615
541 Ga0105237_10075605
542 Ga0105237_11310964
543 Ga0105238_10075260
544 Ga0105249_10000666
545 Ga0105249_10230950
546 Ga0105249_10418235
547 Ga0105249_10862144
548 Ga0105239_10000073
549 Ga0157327_1004133
550 Ga0157373_10000313
551 Ga0157371_10001341
552 Ga0157371_10078670
553 Ga0157369_10008450
554 Ga0157369_10645042
555 Ga0157374_10033166
556 Ga0157378_10191475
557 Ga0163162_10011285
558 Ga0157372_10005180
559 Ga0157372_10160909
560 Ga0157372_11324141
561 Ga0157375_10273024
562 Ga0163163_10044474
563 Ga0157380_10011592
564 Ga0157380_10235591
565 Ga0157376_11184008
566 Ga0157376_11243605
567 Ga0163161_10021914
568 Ga0163161_10059013
569 Ga0163161_10439673
570 Ga0207680_10002329
571 Ga0207680_10151484
572 Ga0207680_10353131
573 Ga0207647_10000068
574 Ga0207647_10012600
575 Ga0207705_10000139
576 Ga0207705_10062381
577 Ga0207695_10029931
578 Ga0207695_10039642
579 Ga0207671_10011024
580 Ga0207671_10111285
581 Ga0207671_10759158
582 Ga0207657_10001155
583 Ga0207657_10006223
584 Ga0207657_10254888
585 Ga0207657_10315940
586 Ga0207657_10675116
587 Ga0207649_10011673
588 Ga0207649_10372510
589 Ga0207681_10000001
590 Ga0207681_10000234
591 Ga0207681_10022563
592 Ga0207681_10100550
593 Ga0207694_10281943
594 Ga0207650_10000018
595 Ga0207650_10003749
596 Ga0207650_10010912
597 Ga0207650_10427877
598 Ga0207659_10067241
599 Ga0207644_10000004
600 Ga0207644_10000029
601 Ga0207644_10002447
602 Ga0207644_10272430
603 Ga0207644_10785204
604 Ga0207690_10002511
605 Ga0207690_10004789
606 Ga0207690_10023168
607 Ga0207690_10041592
608 Ga0207706_10000351
609 Ga0207706_10051958
610 Ga0207706_10064834
611 Ga0207686_10189013
612 Ga0207709_10276952
613 Ga0207709_10721582
614 Ga0207669_10037982
615 Ga0207669_10078366
616 Ga0207704_10035703
617 Ga0207691_10019794
618 Ga0207711_10003547
619 Ga0207711_10137528
620 Ga0207711_11044975
621 Ga0207679_10004504
622 Ga0207679_10025076
623 Ga0207651_10122225
624 Ga0207651_10640704
625 Ga0207712_10000048
626 Ga0207712_10018624
627 Ga0207668_10000008
628 Ga0207668_10019617
629 Ga0207668_10115285
630 Ga0207640_10011296
631 Ga0207640_10153161
632 Ga0207658_10000002
633 Ga0207658_10003064
634 Ga0207658_10316691
635 Ga0207658_10608477
636 Ga0207677_10288037
637 Ga0207703_10000313
638 Ga0207703_10502282
639 Ga0207703_11268483
640 Ga0207639_10002265
641 Ga0207639_10145548
642 Ga0207678_10002339
643 Ga0207678_10313893
644 Ga0207702_10004957
645 Ga0207702_10058963
646 Ga0207641_10002849
647 Ga0207641_10003066
648 Ga0207641_10004321
649 Ga0207641_10008744
650 Ga0207648_10024655
651 Ga0207676_10000004
652 Ga0207676_10011030
653 Ga0207676_10343324
654 Ga0207674_10016670
655 Ga0207674_10020980
656 Ga0207674_10515997
657 Ga0207675_100000119
658 Ga0207675_100099706
659 Ga0207683_10007938
660 Ga0207683_10186837
661 Ga0207698_10000373
662 Ga0207698_10062825
663 Ga0207698_10619527
664 Ga0268266_10007896
665 Ga0268266_10236912
666 Ga0268266_10655497
667 Ga0268265_10000002
668 Ga0268265_10000209
669 Ga0268265_10001446
670 Ga0268265_10079894
671 Ga0268265_10165003
672 Ga0268264_10000001
673 Ga0268264_10001688
674 Ga0268264_10588767
675 Ga0316182_1268712
676 Ga0307513_10044357
677 Ga0307408_100005491
678 Ga0307408_100316668
679 Ga0307408_100595079
680 Ga0307405_10071367
681 Ga0307405_10357630
682 Ga0307405_10833325
683 Ga0307413_10419989
684 Ga0307410_10775169
685 Ga0307406_10001555
686 Ga0307407_10204414
687 Ga0307407_10631442
688 Ga0307412_10033641
689 Ga0307409_100006013
690 Ga0307409_100559806
691 Ga0307416_100215487
692 Ga0307414_11588437
693 Ga0307411_10131234
694 Ga0307411_10198261
695 Ga0307415_100019779
696 Ga0307415_100173041
697 Ga0307415_100860942
698 Ga0373934_0185556
699 Ga0373953_0076864
700 Ga0373937_0039612
701 Ga0373937_0129180
702 Ga0373925_0423278
703 Ga0395899_0018378
704 Ga0395899_0064400
705 Ga0395900_0001258
706 Ga0395900_0103428
707 Ga0395898_0287231
708 Ga0395898_1036142
709 Ga0395905_0001084
710 Ga0395905_0199047
711 Ga0395905_0405776
712 Ga0395901_0067713
713 Ga0395901_0073728
714 Ga0395901_0101233
715 Ga0237819_00389
716 Ga0237816_02093
717 Ga0436365_0821190
718 Ga0439436_0046209
719 Ga0439439_0001789
720 Ga0439448_0004024
721 Ga0439448_0040655
722 Ga0439455_0001104
723 Ga0439455_0001486
724 Ga0439455_0017634
725 Ga0439462_0091107
726 Ga0450920_077873
727 Ga0439458_0001894
728 Ga0466972_0015349
729 Ga0466961_0198191
730 Ga0466963_0001228
731 Ga0466964_0006002
732 Ga0466968_0046567
733 Ga0466970_0016791
734 Ga0466960_0005879
735 Ga0466958_0017992
736 Ga0466958_0247615
737 Ga0466967_0012709
738 Ga0495629_0120744
739 Ga0495664_0004496
740 Ga0495583_0140133
741 Ga0495637_0040985
742 Ga0495643_0040838
743 Ga0495597_0032177
744 Ga0495645_0082854
745 Ga0495622_0298821
746 Ga0495625_0419222
747 Ga0495674_0342900
748 Ga0495673_0013165
749 Ga0495681_0056302
750 Ga0495686_0000141
751 Ga0496100_0008165
752 Ga0496101_0550132
753 Ga0496102_0046455
754 Ga0496102_0708504
755 Ga0496104_0087550
756 Ga0496106_0000129
757 Ga0496106_0000971
758 Ga0496107_0004669
759 Ga0496108_0575880
760 Ga0496109_0052074
761 Ga0496110_0161308
762 Ga0496111_0010824
763 Ga0496112_0255283
764 Ga0496113_0008317
765 Ga0496118_0015442
766 Ga0496119_0056304
767 Ga0496120_0214278
768 Ga0496121_0001743
769 Ga0496121_0008548
770 Ga0496122_0001884
771 Ga0496122_0304953
772 Ga0496123_0027474
773 Ga0496124_0062081
774 Ga0496126_0318618
775 Ga0501290_000774
776 Ga0501293_008454
777 Ga0501032_0028062
778 Ga0501043_0056104
779 Ga0501047_0007066
780 Ga0501257_000005
781 Ga0501079_0988747
782 Ga0501241_010062
783 Ga0501280_000636
784 nmdc:mga00v17_20567_c1
785 nmdc:mga07m45_151379_c1
786 nmdc:mga07m45_438260_c1
787 Ga0495601_0094711
788 Ga0500643_003074
789 Ga0500643_004579
790 Ga0500643_006324
791 Ga0500583_0268031
792 Ga0500651_0004270
793 Ga0500566_0000251
794 Ga0500641_0027501
795 Ga0500592_000936
796 Ga0500614_038114
797 Ga0500618_008250
798 Ga0500642_0000429
799 Ga0500655_000021
800 Ga0500655_047582
801 Ga0500658_0009116
802 Ga0500559_0062058
803 Ga0500622_0107901
804 Ga0500639_225446
805 Ga0500636_0139343
806 Ga0500570_007566
807 Ga0500552_009706
808 Ga0466962_0000271
809 Ga0466962_0058209
810 2585260662
811 2643730482
812 2644037102
813 2644043651
814 2644125416
815 2644393810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

40

192

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9587 3 150
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9461 3 151
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9408 3 149
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9392 3 147
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9381 2 153
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9606 4 148 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9511 3 150 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9436 4 153 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9416 4 148 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.93 3 148 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A383CBU7-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9869 4 101 GO:0008113
AF-A0A359BCQ3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9853 4 97 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A149V9T0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.984 2 112 GO:0008113
AF-A0A7J0GML4-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9838 3 88 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A352DYT2-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9835 3 97 GO:0008113

Map