F435924

General Info

Members Datasets Scaffolds Average Seq Length
405 276 810 287

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10007070|Ga0105245_100070704
Length 310
Sequence LRAAGGSMEDAFLPPQRLGFVGLGNMGAPMARHLAAAGFQVVAADSNPAALARFCDAVPCERAASLAHLGRACRLVITMLPDGASVRQVLLGEAGVAAGLAAGSVVLDMSSAEPVATRALASKLAEAALFLVDAPVSGGVKRAVEGKLAIMAGGEPAAIARCATVFAALGTVFRTGASGSGHAVKALNNYLSAVALAATAEAMMAGGKFGIDPALMLEILNHSTGRNTATEQKYPAYVLPRSFDSGFALGLMAKDLRIALGLAEAVGTPDSLLSECAALWQRAQRQLGFNADNTEIVRYLEASRGASADE

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
173 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.43
Nodule 0
Rhizoplane 4.2
Rhizosphere 88.64
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10007070 3300009098 Bacteria 9846
2 rootL2_10387348 3300003322 Bacteria 1534
3 Ga0065707_10013027 3300005295 Bacteria 2497
4 Ga0070658_10069179 3300005327 Bacteria 2888
5 Ga0070676_10061406 3300005328 Bacteria 2234
6 Ga0070690_100004936 3300005330 Bacteria 7464
7 Ga0068869_100022900 3300005334 Bacteria 4308
8 Ga0070666_10052142 3300005335 Bacteria 2756
9 Ga0070666_10203728 3300005335 Bacteria 1392
10 Ga0070680_100008738 3300005336 Bacteria 7767
11 Ga0070680_100009071 3300005336 Bacteria 7626
12 Ga0070682_100018697 3300005337 Bacteria 4056
13 Ga0068868_100007039 3300005338 Bacteria 7995
14 Ga0068868_100062411 3300005338 Bacteria 2953
15 Ga0070689_100011173 3300005340 Bacteria 6424
16 Ga0070691_10011666 3300005341 Bacteria 4018
17 Ga0070687_100024388 3300005343 Bacteria 2887
18 Ga0070692_10031166 3300005345 Bacteria 2671
19 Ga0070668_100226851 3300005347 Bacteria 1543
20 Ga0070671_100022626 3300005355 Bacteria 5134
21 Ga0070673_100015216 3300005364 Bacteria 5396
22 Ga0070667_100116331 3300005367 Bacteria 2322
23 Ga0070703_10034978 3300005406 Bacteria 1536
24 Ga0070709_10010186 3300005434 Bacteria 5195
25 Ga0070709_10026239 3300005434 Bacteria 3451
26 Ga0070714_100011162 3300005435 Bacteria 7120
27 Ga0070714_100100811 3300005435 Bacteria 2544
28 Ga0070713_100002483 3300005436 Bacteria 12043
29 Ga0070713_100014624 3300005436 Bacteria 5837
30 Ga0070713_100078237 3300005436 Bacteria 2815
31 Ga0070713_100085573 3300005436 Bacteria 2701
32 Ga0070701_10174952 3300005438 Bacteria 1252
33 Ga0070705_100001196 3300005440 Bacteria 14119
34 Ga0070705_100030711 3300005440 Bacteria 2969
35 Ga0070700_100011172 3300005441 Bacteria 4969
36 Ga0070694_100004615 3300005444 Bacteria 8289
37 Ga0070694_100040174 3300005444 Bacteria 3118
38 Ga0070708_100406318 3300005445 Bacteria 1284
39 Ga0070678_100051002 3300005456 Bacteria 2996
40 Ga0070678_100440749 3300005456 Bacteria 1139
41 Ga0070681_10001271 3300005458 Bacteria 21998
42 Ga0070681_10001645 3300005458 Bacteria 19946
43 Ga0068867_100043705 3300005459 Bacteria 3280
44 Ga0070679_100001170 3300005530 Bacteria 22959
45 Ga0070679_100040232 3300005530 Bacteria 4651
46 Ga0070679_100054778 3300005530 Unclassified 3972
47 Ga0068853_100164204 3300005539 Bacteria 2006
48 Ga0070686_100004674 3300005544 Bacteria 7550
49 Ga0070695_100007502 3300005545 Bacteria 6460
50 Ga0070696_100019744 3300005546 Bacteria 4566
51 Ga0070696_100104044 3300005546 Bacteria 2038
52 Ga0070696_100135615 3300005546 Bacteria 1794
53 Ga0070693_100000596 3300005547 Bacteria 16015
54 Ga0070704_100003780 3300005549 Bacteria 8714
55 Ga0070704_100042689 3300005549 Bacteria 3138
56 Ga0068855_100009074 3300005563 Bacteria 12017
57 Ga0068855_100164045 3300005563 Bacteria 2520
58 Ga0068854_100042814 3300005578 Bacteria 3206
59 Ga0068856_100009409 3300005614 Bacteria 9490
60 Ga0070702_100022271 3300005615 Bacteria 3346
61 Ga0070702_100386245 3300005615 Bacteria 997
62 Ga0068859_100080093 3300005617 Bacteria 3306
63 Ga0068859_100505355 3300005617 Bacteria 1304
64 Ga0068864_100131553 3300005618 Bacteria 2248
65 Ga0068866_10005789 3300005718 Bacteria 5127
66 Ga0068861_100003769 3300005719 Bacteria 10119
67 Ga0068861_100044700 3300005719 Bacteria 3331
68 Ga0068870_10206408 3300005840 Bacteria 1194
69 Ga0068858_100016723 3300005842 Bacteria 6888
70 Ga0068858_100099648 3300005842 Bacteria 2709
71 Ga0068860_100109781 3300005843 Bacteria 2636
72 Ga0068860_100123151 3300005843 Bacteria 2484
73 Ga0068862_100008599 3300005844 Bacteria 8448
74 Ga0068862_100248395 3300005844 Bacteria 1621
75 Ga0068862_100253564 3300005844 Bacteria 1604
76 Ga0081538_10012994 3300005981 Bacteria 6624
77 Ga0070717_10047017 3300006028 Bacteria 3534
78 Ga0075365_10165536 3300006038 Bacteria 1542
79 Ga0075368_10018809 3300006042 Bacteria 2601
80 Ga0075363_100009552 3300006048 Bacteria 4563
81 Ga0070715_10002442 3300006163 Bacteria 5704
82 Ga0070716_100004587 3300006173 Bacteria 6623
83 Ga0075367_10043871 3300006178 Bacteria 2619
84 Ga0075369_10013099 3300006186 Bacteria 3284
85 Ga0097621_100032927 3300006237 Bacteria 4123
86 Ga0097621_100062373 3300006237 Bacteria 3060
87 Ga0068871_100001839 3300006358 Bacteria 14339
88 Ga0075428_100006116 3300006844 Bacteria 13392
89 Ga0075430_100002048 3300006846 Bacteria 16610
90 Ga0075430_100021774 3300006846 Bacteria 5449
91 Ga0075430_100125497 3300006846 Bacteria 2139
92 Ga0075430_100350356 3300006846 Bacteria 1219
93 Ga0075430_100356658 3300006846 Bacteria 1207
94 Ga0075431_100200685 3300006847 Bacteria 2041
95 Ga0075431_100331966 3300006847 Bacteria 1531
96 Ga0075433_10114670 3300006852 Bacteria 2391
97 Ga0075434_100000277 3300006871 Bacteria 36475
98 Ga0075434_100084118 3300006871 Bacteria 3180
99 Ga0075429_100128440 3300006880 Bacteria 2217
100 Ga0075429_100195137 3300006880 Bacteria 1773
101 Ga0068865_100011230 3300006881 Bacteria 5598
102 Ga0068865_100032814 3300006881 Bacteria 3472
103 Ga0097620_100080098 3300006931 Bacteria 3306
104 Ga0097620_100505351 3300006931 Bacteria 1304
105 Ga0075435_100003208 3300007076 Bacteria 11072
106 Ga0105240_10006203 3300009093 Bacteria 17595
107 Ga0111539_10117250 3300009094 Bacteria 3121
108 Ga0105245_10015653 3300009098 Bacteria 6615
109 Ga0114129_10162391 3300009147 Bacteria 3050
110 Ga0114129_10477692 3300009147 Bacteria 1631
111 Ga0114129_10764059 3300009147 Bacteria 1236
112 Ga0105243_10038745 3300009148 Bacteria 3712
113 Ga0105243_10134365 3300009148 Bacteria 2103
114 Ga0105241_10014405 3300009174 Bacteria 5789
115 Ga0105241_10036611 3300009174 Bacteria 3694
116 Ga0105242_10006099 3300009176 Bacteria 9292
117 Ga0105248_10020113 3300009177 Bacteria 7395
118 Ga0105237_10028038 3300009545 Bacteria 5738
119 Ga0105238_10005786 3300009551 Bacteria 12236
120 Ga0105238_10069843 3300009551 Bacteria 3512
121 Ga0105238_10581946 3300009551 Bacteria 1126
122 Ga0105249_10022163 3300009553 Bacteria 5688
123 Ga0105239_10052833 3300010375 Bacteria 4456
124 Ga0105239_10069249 3300010375 Bacteria 3877
125 Ga0157370_10001728 3300013104 Bacteria 26885
126 Ga0157369_10002578 3300013105 Bacteria 21694
127 Ga0157369_10211896 3300013105 Bacteria 2030
128 Ga0157374_10012968 3300013296 Bacteria 7266
129 Ga0157378_10009318 3300013297 Bacteria 8552
130 Ga0157378_10019499 3300013297 Bacteria 5962
131 Ga0157372_10186811 3300013307 Bacteria 2400
132 Ga0157375_10262235 3300013308 Bacteria 1890
133 Ga0157380_10222057 3300014326 Bacteria 1691
134 Ga0157379_10073970 3300014968 Bacteria 3050
135 Ga0157376_10118037 3300014969 Bacteria 2347
136 Ga0209148_1004405 3300025254 Bacteria 3479
137 Ga0207653_10031496 3300025885 Bacteria 1713
138 Ga0207642_10002700 3300025899 Bacteria 5539
139 Ga0207642_10023788 3300025899 Bacteria 2453
140 Ga0207688_10047878 3300025901 Bacteria 2388
141 Ga0207680_10045656 3300025903 Bacteria 2584
142 Ga0207680_10238750 3300025903 Bacteria 1252
143 Ga0207699_10016158 3300025906 Bacteria 3897
144 Ga0207643_10121194 3300025908 Bacteria 1550
145 Ga0207654_10094600 3300025911 Bacteria 1829
146 Ga0207654_10193112 3300025911 Bacteria 1336
147 Ga0207707_10000202 3300025912 Bacteria 63576
148 Ga0207707_10024695 3300025912 Bacteria 5258
149 Ga0207695_10032413 3300025913 Bacteria 5717
150 Ga0207671_10213272 3300025914 Bacteria 1511
151 Ga0207693_10000237 3300025915 Bacteria 50696
152 Ga0207693_10018144 3300025915 Bacteria 5608
153 Ga0207660_10007707 3300025917 Bacteria 6970
154 Ga0207660_10010122 3300025917 Bacteria 6109
155 Ga0207660_10186145 3300025917 Bacteria 1615
156 Ga0207660_10337674 3300025917 Bacteria 1205
157 Ga0207662_10001351 3300025918 Bacteria 11846
158 Ga0207652_10001509 3300025921 Bacteria 20550
159 Ga0207652_10039523 3300025921 Unclassified 4004
160 Ga0207652_10075583 3300025921 Bacteria 2936
161 Ga0207652_10108658 3300025921 Bacteria 2458
162 Ga0207694_10024087 3300025924 Bacteria 4622
163 Ga0207659_10098714 3300025926 Bacteria 2197
164 Ga0207700_10100943 3300025928 Bacteria 2301
165 Ga0207700_10525350 3300025928 Bacteria 1049
166 Ga0207664_10011514 3300025929 Bacteria 6293
167 Ga0207686_10034645 3300025934 Bacteria 3023
168 Ga0207686_10194430 3300025934 Bacteria 1448
169 Ga0207709_10002403 3300025935 Bacteria 11783
170 Ga0207709_10020067 3300025935 Bacteria 3767
171 Ga0207670_10033543 3300025936 Bacteria 3309
172 Ga0207670_10097638 3300025936 Bacteria 2092
173 Ga0207669_10471717 3300025937 Bacteria 999
174 Ga0207704_10007909 3300025938 Bacteria 5051
175 Ga0207704_10013927 3300025938 Bacteria 4045
176 Ga0207704_10216214 3300025938 Bacteria 1414
177 Ga0207704_10366134 3300025938 Bacteria 1127
178 Ga0207665_10078677 3300025939 Bacteria 2265
179 Ga0207665_10103905 3300025939 Bacteria 1988
180 Ga0207711_10204143 3300025941 Bacteria 1804
181 Ga0207689_10011736 3300025942 Bacteria 7510
182 Ga0207661_10468742 3300025944 Bacteria 1149
183 Ga0207667_10034755 3300025949 Bacteria 5410
184 Ga0207667_10084016 3300025949 Bacteria 3296
185 Ga0207651_10016996 3300025960 Bacteria 4284
186 Ga0207712_10038011 3300025961 Bacteria 3289
187 Ga0207668_10005897 3300025972 Bacteria 7219
188 Ga0207640_10038401 3300025981 Bacteria 3021
189 Ga0207658_10137354 3300025986 Bacteria 1973
190 Ga0207677_10033858 3300026023 Bacteria 3302
191 Ga0207703_10109542 3300026035 Bacteria 2354
192 Ga0207639_10130016 3300026041 Bacteria 2083
193 Ga0207708_10004135 3300026075 Bacteria 10681
194 Ga0207708_10296255 3300026075 Bacteria 1314
195 Ga0207708_10299314 3300026075 Bacteria 1308
196 Ga0207648_10000443 3300026089 Bacteria 45890
197 Ga0207648_10011599 3300026089 Bacteria 8298
198 Ga0207674_10169243 3300026116 Bacteria 2139
199 Ga0207675_100008410 3300026118 Bacteria 9726
200 Ga0207675_100162778 3300026118 Bacteria 2129
201 Ga0207683_10001203 3300026121 Bacteria 23438
202 Ga0207683_10444712 3300026121 Bacteria 1195
203 Ga0209971_1009298 3300027682 Bacteria 2329
204 Ga0209998_10022945 3300027717 Bacteria 1347
205 Ga0209813_10009960 3300027866 Bacteria 2447
206 Ga0268266_10241276 3300028379 Bacteria 1668
207 Ga0268265_10033214 3300028380 Bacteria 3749
208 Ga0268265_10391679 3300028380 Bacteria 1281
209 Ga0268264_10053234 3300028381 Bacteria 3376
210 Ga0268264_10188968 3300028381 Bacteria 1876
211 Ga0268264_10333343 3300028381 Bacteria 1438
212 Ga0265338_10085607 3300028800 Bacteria 2626
213 Ga0307511_10000014 3300030521 Bacteria 127602
214 Ga0265327_10031537 3300031251 Bacteria 2976
215 Ga0265327_10035083 3300031251 Bacteria 2777
216 Ga0307509_10000038 3300031507 Bacteria 188458
217 Ga0307408_100155504 3300031548 Unclassified 1810
218 Ga0307410_10250962 3300031852 Bacteria 1375
219 Ga0307407_10039369 3300031903 Bacteria 2628
220 Ga0307416_100007274 3300032002 Bacteria 7019
221 Ga0307414_10014472 3300032004 Bacteria 4732
222 Ga0307507_10019511 3300033179 Bacteria 7632
223 Ga0373938_0011033 3300034957 Bacteria 1673
224 Ga0373926_0000005 3300035083 Bacteria 40279
225 Ga0373944_0000639 3300035089 Bacteria 8340
226 Ga0373936_0000321 3300035113 Bacteria 16218
227 Ga0373941_0004413 3300035115 Bacteria 3250
228 Ga0373945_0000924 3300035116 Bacteria 8725
229 Ga0373954_0000099 3300035118 Bacteria 29105
230 Ga0373954_0033898 3300035118 Bacteria 2363
231 Ga0373956_0109339 3300035119 Bacteria 1286
232 Ga0373943_0000236 3300035170 Bacteria 22705
233 Ga0373943_0036532 3300035170 Bacteria 2353
234 Ga0373946_0000036 3300035171 Bacteria 35276
235 Ga0373955_0035314 3300035172 Bacteria 2647
236 Ga0373955_0062044 3300035172 Bacteria 2066
237 Ga0373962_0024158 3300035242 Bacteria 1623
238 Ga0373924_0005599 3300035410 Bacteria 4455
239 Ga0373924_0013901 3300035410 Bacteria 3032
240 Ga0373931_0058247 3300035691 Bacteria 2074
241 Ga0373935_0000195 3300035692 Bacteria 28738
242 Ga0373927_0000238 3300035695 Bacteria 43099
243 Ga0373933_0090994 3300035724 Bacteria 1882
244 Ga0373947_0009125 3300035725 Bacteria 5699
245 Ga0373937_0034765 3300036401 Bacteria 4583
246 Ga0373937_0047041 3300036401 Bacteria 3946
247 Ga0373925_0000731 3300037068 Bacteria 30474
248 Ga0373925_0082972 3300037068 Bacteria 2440
249 Ga0436361_0976996 3300039447 Bacteria 1231
250 Ga0439453_0005776 3300041408 Bacteria 1900
251 Ga0451807_1130075 3300041486 Bacteria 2593
252 Ga0439441_002995 3300042001 Bacteria 2441
253 Ga0450913_002343 3300042117 Bacteria 1154
254 Ga0439435_0002763 3300042436 Bacteria 3544
255 Ga0439444_0000942 3300042437 Bacteria 3558
256 Ga0439460_0010026 3300042461 Bacteria 2416
257 Ga0451577_0029868 3300042876 Bacteria 4925
258 Ga0451577_0342090 3300042876 Bacteria 1357
259 Ga0466969_0012760 3300044656 Bacteria 4427
260 Ga0466966_0002138 3300044684 Bacteria 12813
261 Ga0466961_0004834 3300044693 Bacteria 8471
262 Ga0466964_0003337 3300044706 Bacteria 5851
263 Ga0453684_0112567 3300044712 Bacteria 3303
264 Ga0466971_0005974 3300044719 Bacteria 5297
265 Ga0466968_0010165 3300044735 Unclassified 3641
266 Ga0466970_0020529 3300044765 Bacteria 3433
267 Ga0466957_0011059 3300044842 Bacteria 5193
268 Ga0466959_0008529 3300045049 Bacteria 7252
269 Ga0451576_0002244 3300045051 Bacteria 29629
270 Ga0451576_0697243 3300045051 Bacteria 1067
271 Ga0466967_0007049 3300045976 Bacteria 8052
272 Ga0495603_0001491 3300046455 Bacteria 13623
273 Ga0495629_0263420 3300046459 Bacteria 1185
274 Ga0495580_0000129 3300046472 Bacteria 52542
275 Ga0495580_0081486 3300046472 Bacteria 2256
276 Ga0495582_0021384 3300046473 Bacteria 3541
277 Ga0495639_0003300 3300046475 Bacteria 7003
278 Ga0495584_0174147 3300046491 Bacteria 1094
279 Ga0495630_0070743 3300046517 Bacteria 2625
280 Ga0495630_0084589 3300046517 Bacteria 2395
281 Ga0495666_0033073 3300046526 Bacteria 2528
282 Ga0495665_0118801 3300046531 Bacteria 1385
283 Ga0495586_0001860 3300046535 Bacteria 11493
284 Ga0495622_0045594 3300046557 Bacteria 2037
285 Ga0495588_0006752 3300046674 Bacteria 5189
286 Ga0495657_0082280 3300046675 Bacteria 2081
287 Ga0495623_0083542 3300046679 Bacteria 1972
288 Ga0495647_0000276 3300046681 Bacteria 14253
289 Ga0495658_0001156 3300046683 Bacteria 13927
290 Ga0495669_0032251 3300046684 Bacteria 2302
291 Ga0495669_0062690 3300046684 Bacteria 1685
292 Ga0495600_0093002 3300046809 Bacteria 1967
293 Ga0495680_0254008 3300047322 Bacteria 1245
294 Ga0495686_0047390 3300047472 Bacteria 2714
295 Ga0495602_0048345 3300048088 Bacteria 3824
296 Ga0496102_0032307 3300048905 Bacteria 4702
297 Ga0496102_0118175 3300048905 Bacteria 2474
298 Ga0496103_0044775 3300048906 Bacteria 2728
299 Ga0496104_0358087 3300048907 Bacteria 1371
300 Ga0496105_0125612 3300048908 Bacteria 2114
301 Ga0496106_0035177 3300048909 Bacteria 3745
302 Ga0496106_0162829 3300048909 Bacteria 1765
303 Ga0496107_0056986 3300048910 Bacteria 2824
304 Ga0496108_0009457 3300048911 Bacteria 7895
305 Ga0496109_0032685 3300048912 Unclassified 4679
306 Ga0496109_0042494 3300048912 Bacteria 4117
307 Ga0496110_0004894 3300048913 Bacteria 10449
308 Ga0496111_0015677 3300048914 Bacteria 5208
309 Ga0496112_0209440 3300048915 Bacteria 1907
310 Ga0496113_0177605 3300048916 Bacteria 1687
311 Ga0496114_0008654 3300048917 Bacteria 8067
312 Ga0496118_0067294 3300048921 Bacteria 2609
313 Ga0496122_0013732 3300048925 Bacteria 7898
314 Ga0496123_0001429 3300048926 Bacteria 33355
315 Ga0501031_0011714 3300049568 Bacteria 5720
316 Ga0501031_0211369 3300049568 Bacteria 1264
317 Ga0501032_0029309 3300049569 Bacteria 3777
318 Ga0501033_0005878 3300049570 Bacteria 9644
319 Ga0501034_0228959 3300049571 Bacteria 1808
320 Ga0501036_0003081 3300049572 Bacteria 13296
321 Ga0501036_0182931 3300049572 Bacteria 1764
322 Ga0501036_0262746 3300049572 Bacteria 1446
323 Ga0501036_0296660 3300049572 Bacteria 1352
324 Ga0501039_0014020 3300049575 Bacteria 6133
325 Ga0501039_0070894 3300049575 Bacteria 2707
326 Ga0501040_0008678 3300049576 Bacteria 6600
327 Ga0501040_0027262 3300049576 Bacteria 3845
328 Ga0501040_0027547 3300049576 Bacteria 3827
329 Ga0501041_0010170 3300049577 Bacteria 5544
330 Ga0501041_0013055 3300049577 Bacteria 4923
331 Ga0501041_0027283 3300049577 Bacteria 3441
332 Ga0501046_0003104 3300049580 Bacteria 15323
333 Ga0501046_0019396 3300049580 Bacteria 5642
334 Ga0501048_0005471 3300049582 Bacteria 9664
335 Ga0501048_0064207 3300049582 Bacteria 2597
336 Ga0501048_0067944 3300049582 Bacteria 2518
337 Ga0501070_0105791 3300049586 Bacteria 2326
338 Ga0501071_0021668 3300049587 Bacteria 4478
339 Ga0501071_0025974 3300049587 Bacteria 4106
340 Ga0501071_0241640 3300049587 Bacteria 1362
341 Ga0501071_0460788 3300049587 Unclassified 973
342 Ga0501072_0001335 3300049588 Bacteria 18478
343 Ga0501072_0003018 3300049588 Bacteria 12695
344 Ga0501072_0063676 3300049588 Bacteria 2909
345 Ga0501073_0003783 3300049589 Bacteria 11375
346 Ga0501073_0181841 3300049589 Bacteria 1455
347 Ga0501075_0001304 3300049591 Bacteria 16162
348 Ga0501075_0003644 3300049591 Bacteria 10326
349 Ga0501076_0000532 3300049592 Bacteria 24285
350 Ga0501076_0000852 3300049592 Bacteria 19768
351 Ga0501076_0079093 3300049592 Bacteria 2639
352 Ga0501077_0005614 3300049593 Bacteria 7642
353 Ga0501077_0052492 3300049593 Bacteria 2589
354 Ga0501077_0199214 3300049593 Bacteria 1272
355 Ga0501079_0014796 3300049741 Bacteria 5948
356 Ga0501079_0043342 3300049741 Bacteria 3473
357 Ga0501079_0063607 3300049741 Bacteria 2846
358 Ga0501079_0334033 3300049741 Unclassified 1187
359 Ga0501080_0046221 3300049742 Bacteria 4055
360 Ga0501080_0056557 3300049742 Bacteria 3653
361 Ga0501081_0000878 3300049743 Bacteria 17731
362 Ga0501035_0068747 3300049822 Bacteria 3140
363 Ga0501045_0029557 3300049824 Bacteria 3962
364 Ga0501045_0063734 3300049824 Bacteria 2705
365 Ga0501045_0144916 3300049824 Bacteria 1766
366 nmdc:mga03683_64791_c1 3300050489 Bacteria 1552
367 nmdc:mga03n38_117779_c1 3300050490 Bacteria 1302
368 nmdc:mga00v17_48787_c1 3300050491 Bacteria 2567
369 nmdc:mga0k408_205846_c1 3300050493 Bacteria 1175
370 nmdc:mga06z11_83991_c1 3300050494 Bacteria 1715
371 nmdc:mga04h51_22673_c1 3300050495 Bacteria 1903
372 nmdc:mga07m45_24775_c1 3300050496 Bacteria 3289
373 nmdc:mga05p37_327730_c1 3300050507 Bacteria 1810
374 nmdc:mga09592_237984_c1 3300050508 Bacteria 1577
375 nmdc:mga0qj67_190437_c1 3300050509 Bacteria 1667
376 nmdc:mga0qj67_2787_c1 3300050509 Bacteria 12543
377 nmdc:mga0qj67_6177_c1 3300050509 Bacteria 8787
378 nmdc:mga06r32_4751_c1 3300050510 Bacteria 12210
379 nmdc:mga06r32_84037_c1 3300050510 Bacteria 3102
380 nmdc:mga08y16_342382_c1 3300050511 Bacteria 1537
381 nmdc:mga08y16_79626_c1 3300050511 Bacteria 3415
382 nmdc:mga0n895_216165_c1 3300050512 Bacteria 1946
383 nmdc:mga0n895_21986_c1 3300050512 Bacteria 5976
384 nmdc:mga0n895_3616_c1 3300050512 Bacteria 12498
385 nmdc:mga0rr50_4401_c1 3300050513 Bacteria 8279
386 nmdc:mga0rr50_5972_c1 3300050513 Bacteria 7342
387 nmdc:mga08x19_327362_c1 3300050514 Unclassified 1067
388 nmdc:mga0a205_36774_c1 3300050515 Bacteria 4706
389 nmdc:mga0a205_39395_c2 3300050515 Bacteria 1465
390 nmdc:mga0sz30_22898_c1 3300050516 Bacteria 2538
391 Ga0500646_0001198 3300053090 Bacteria 6972
392 Ga0500583_0057320 3300053092 Bacteria 1829
393 Ga0500594_0021379 3300053118 Bacteria 1622
394 Ga0500568_0000017 3300053139 Bacteria 197578
395 Ga0500568_0063456 3300053139 Bacteria 1425
396 Ga0500604_0004218 3300053151 Bacteria 3822
397 Ga0500627_0114567 3300053158 Bacteria 1214
398 Ga0501084_0072645 3300054114 Bacteria 2881
399 Ga0501084_0141746 3300054114 Bacteria 2024
400 Ga0590074_007955 3300059423 Bacteria 1768
401 Ga0501082_0085571 3300060353 Bacteria 2719
402 Ga0501082_0218670 3300060353 Bacteria 1657
403 Ga0466962_0002148 3300061719 Bacteria 9314
404 Ga0530510_0001154 3300061734 Bacteria 17527
405 Ga0530510_0001479 3300061734 Bacteria 15770
406 Ga0105245_10007070
407 rootL2_10387348
408 Ga0065707_10013027
409 Ga0070658_10069179
410 Ga0070676_10061406
411 Ga0070690_100004936
412 Ga0068869_100022900
413 Ga0070666_10052142
414 Ga0070666_10203728
415 Ga0070680_100008738
416 Ga0070680_100009071
417 Ga0070682_100018697
418 Ga0068868_100007039
419 Ga0068868_100062411
420 Ga0070689_100011173
421 Ga0070691_10011666
422 Ga0070687_100024388
423 Ga0070692_10031166
424 Ga0070668_100226851
425 Ga0070671_100022626
426 Ga0070673_100015216
427 Ga0070667_100116331
428 Ga0070703_10034978
429 Ga0070709_10010186
430 Ga0070709_10026239
431 Ga0070714_100011162
432 Ga0070714_100100811
433 Ga0070713_100002483
434 Ga0070713_100014624
435 Ga0070713_100078237
436 Ga0070713_100085573
437 Ga0070701_10174952
438 Ga0070705_100001196
439 Ga0070705_100030711
440 Ga0070700_100011172
441 Ga0070694_100004615
442 Ga0070694_100040174
443 Ga0070708_100406318
444 Ga0070678_100051002
445 Ga0070678_100440749
446 Ga0070681_10001271
447 Ga0070681_10001645
448 Ga0068867_100043705
449 Ga0070679_100001170
450 Ga0070679_100040232
451 Ga0070679_100054778
452 Ga0068853_100164204
453 Ga0070686_100004674
454 Ga0070695_100007502
455 Ga0070696_100019744
456 Ga0070696_100104044
457 Ga0070696_100135615
458 Ga0070693_100000596
459 Ga0070704_100003780
460 Ga0070704_100042689
461 Ga0068855_100009074
462 Ga0068855_100164045
463 Ga0068854_100042814
464 Ga0068856_100009409
465 Ga0070702_100022271
466 Ga0070702_100386245
467 Ga0068859_100080093
468 Ga0068859_100505355
469 Ga0068864_100131553
470 Ga0068866_10005789
471 Ga0068861_100003769
472 Ga0068861_100044700
473 Ga0068870_10206408
474 Ga0068858_100016723
475 Ga0068858_100099648
476 Ga0068860_100109781
477 Ga0068860_100123151
478 Ga0068862_100008599
479 Ga0068862_100248395
480 Ga0068862_100253564
481 Ga0081538_10012994
482 Ga0070717_10047017
483 Ga0075365_10165536
484 Ga0075368_10018809
485 Ga0075363_100009552
486 Ga0070715_10002442
487 Ga0070716_100004587
488 Ga0075367_10043871
489 Ga0075369_10013099
490 Ga0097621_100032927
491 Ga0097621_100062373
492 Ga0068871_100001839
493 Ga0075428_100006116
494 Ga0075430_100002048
495 Ga0075430_100021774
496 Ga0075430_100125497
497 Ga0075430_100350356
498 Ga0075430_100356658
499 Ga0075431_100200685
500 Ga0075431_100331966
501 Ga0075433_10114670
502 Ga0075434_100000277
503 Ga0075434_100084118
504 Ga0075429_100128440
505 Ga0075429_100195137
506 Ga0068865_100011230
507 Ga0068865_100032814
508 Ga0097620_100080098
509 Ga0097620_100505351
510 Ga0075435_100003208
511 Ga0105240_10006203
512 Ga0111539_10117250
513 Ga0105245_10015653
514 Ga0114129_10162391
515 Ga0114129_10477692
516 Ga0114129_10764059
517 Ga0105243_10038745
518 Ga0105243_10134365
519 Ga0105241_10014405
520 Ga0105241_10036611
521 Ga0105242_10006099
522 Ga0105248_10020113
523 Ga0105237_10028038
524 Ga0105238_10005786
525 Ga0105238_10069843
526 Ga0105238_10581946
527 Ga0105249_10022163
528 Ga0105239_10052833
529 Ga0105239_10069249
530 Ga0157370_10001728
531 Ga0157369_10002578
532 Ga0157369_10211896
533 Ga0157374_10012968
534 Ga0157378_10009318
535 Ga0157378_10019499
536 Ga0157372_10186811
537 Ga0157375_10262235
538 Ga0157380_10222057
539 Ga0157379_10073970
540 Ga0157376_10118037
541 Ga0209148_1004405
542 Ga0207653_10031496
543 Ga0207642_10002700
544 Ga0207642_10023788
545 Ga0207688_10047878
546 Ga0207680_10045656
547 Ga0207680_10238750
548 Ga0207699_10016158
549 Ga0207643_10121194
550 Ga0207654_10094600
551 Ga0207654_10193112
552 Ga0207707_10000202
553 Ga0207707_10024695
554 Ga0207695_10032413
555 Ga0207671_10213272
556 Ga0207693_10000237
557 Ga0207693_10018144
558 Ga0207660_10007707
559 Ga0207660_10010122
560 Ga0207660_10186145
561 Ga0207660_10337674
562 Ga0207662_10001351
563 Ga0207652_10001509
564 Ga0207652_10039523
565 Ga0207652_10075583
566 Ga0207652_10108658
567 Ga0207694_10024087
568 Ga0207659_10098714
569 Ga0207700_10100943
570 Ga0207700_10525350
571 Ga0207664_10011514
572 Ga0207686_10034645
573 Ga0207686_10194430
574 Ga0207709_10002403
575 Ga0207709_10020067
576 Ga0207670_10033543
577 Ga0207670_10097638
578 Ga0207669_10471717
579 Ga0207704_10007909
580 Ga0207704_10013927
581 Ga0207704_10216214
582 Ga0207704_10366134
583 Ga0207665_10078677
584 Ga0207665_10103905
585 Ga0207711_10204143
586 Ga0207689_10011736
587 Ga0207661_10468742
588 Ga0207667_10034755
589 Ga0207667_10084016
590 Ga0207651_10016996
591 Ga0207712_10038011
592 Ga0207668_10005897
593 Ga0207640_10038401
594 Ga0207658_10137354
595 Ga0207677_10033858
596 Ga0207703_10109542
597 Ga0207639_10130016
598 Ga0207708_10004135
599 Ga0207708_10296255
600 Ga0207708_10299314
601 Ga0207648_10000443
602 Ga0207648_10011599
603 Ga0207674_10169243
604 Ga0207675_100008410
605 Ga0207675_100162778
606 Ga0207683_10001203
607 Ga0207683_10444712
608 Ga0209971_1009298
609 Ga0209998_10022945
610 Ga0209813_10009960
611 Ga0268266_10241276
612 Ga0268265_10033214
613 Ga0268265_10391679
614 Ga0268264_10053234
615 Ga0268264_10188968
616 Ga0268264_10333343
617 Ga0265338_10085607
618 Ga0307511_10000014
619 Ga0265327_10031537
620 Ga0265327_10035083
621 Ga0307509_10000038
622 Ga0307408_100155504
623 Ga0307410_10250962
624 Ga0307407_10039369
625 Ga0307416_100007274
626 Ga0307414_10014472
627 Ga0307507_10019511
628 Ga0373938_0011033
629 Ga0373926_0000005
630 Ga0373944_0000639
631 Ga0373936_0000321
632 Ga0373941_0004413
633 Ga0373945_0000924
634 Ga0373954_0000099
635 Ga0373954_0033898
636 Ga0373956_0109339
637 Ga0373943_0000236
638 Ga0373943_0036532
639 Ga0373946_0000036
640 Ga0373955_0035314
641 Ga0373955_0062044
642 Ga0373962_0024158
643 Ga0373924_0005599
644 Ga0373924_0013901
645 Ga0373931_0058247
646 Ga0373935_0000195
647 Ga0373927_0000238
648 Ga0373933_0090994
649 Ga0373947_0009125
650 Ga0373937_0034765
651 Ga0373937_0047041
652 Ga0373925_0000731
653 Ga0373925_0082972
654 Ga0436361_0976996
655 Ga0439453_0005776
656 Ga0451807_1130075
657 Ga0439441_002995
658 Ga0450913_002343
659 Ga0439435_0002763
660 Ga0439444_0000942
661 Ga0439460_0010026
662 Ga0451577_0029868
663 Ga0451577_0342090
664 Ga0466969_0012760
665 Ga0466966_0002138
666 Ga0466961_0004834
667 Ga0466964_0003337
668 Ga0453684_0112567
669 Ga0466971_0005974
670 Ga0466968_0010165
671 Ga0466970_0020529
672 Ga0466957_0011059
673 Ga0466959_0008529
674 Ga0451576_0002244
675 Ga0451576_0697243
676 Ga0466967_0007049
677 Ga0495603_0001491
678 Ga0495629_0263420
679 Ga0495580_0000129
680 Ga0495580_0081486
681 Ga0495582_0021384
682 Ga0495639_0003300
683 Ga0495584_0174147
684 Ga0495630_0070743
685 Ga0495630_0084589
686 Ga0495666_0033073
687 Ga0495665_0118801
688 Ga0495586_0001860
689 Ga0495622_0045594
690 Ga0495588_0006752
691 Ga0495657_0082280
692 Ga0495623_0083542
693 Ga0495647_0000276
694 Ga0495658_0001156
695 Ga0495669_0032251
696 Ga0495669_0062690
697 Ga0495600_0093002
698 Ga0495680_0254008
699 Ga0495686_0047390
700 Ga0495602_0048345
701 Ga0496102_0032307
702 Ga0496102_0118175
703 Ga0496103_0044775
704 Ga0496104_0358087
705 Ga0496105_0125612
706 Ga0496106_0035177
707 Ga0496106_0162829
708 Ga0496107_0056986
709 Ga0496108_0009457
710 Ga0496109_0032685
711 Ga0496109_0042494
712 Ga0496110_0004894
713 Ga0496111_0015677
714 Ga0496112_0209440
715 Ga0496113_0177605
716 Ga0496114_0008654
717 Ga0496118_0067294
718 Ga0496122_0013732
719 Ga0496123_0001429
720 Ga0501031_0011714
721 Ga0501031_0211369
722 Ga0501032_0029309
723 Ga0501033_0005878
724 Ga0501034_0228959
725 Ga0501036_0003081
726 Ga0501036_0182931
727 Ga0501036_0262746
728 Ga0501036_0296660
729 Ga0501039_0014020
730 Ga0501039_0070894
731 Ga0501040_0008678
732 Ga0501040_0027262
733 Ga0501040_0027547
734 Ga0501041_0010170
735 Ga0501041_0013055
736 Ga0501041_0027283
737 Ga0501046_0003104
738 Ga0501046_0019396
739 Ga0501048_0005471
740 Ga0501048_0064207
741 Ga0501048_0067944
742 Ga0501070_0105791
743 Ga0501071_0021668
744 Ga0501071_0025974
745 Ga0501071_0241640
746 Ga0501071_0460788
747 Ga0501072_0001335
748 Ga0501072_0003018
749 Ga0501072_0063676
750 Ga0501073_0003783
751 Ga0501073_0181841
752 Ga0501075_0001304
753 Ga0501075_0003644
754 Ga0501076_0000532
755 Ga0501076_0000852
756 Ga0501076_0079093
757 Ga0501077_0005614
758 Ga0501077_0052492
759 Ga0501077_0199214
760 Ga0501079_0014796
761 Ga0501079_0043342
762 Ga0501079_0063607
763 Ga0501079_0334033
764 Ga0501080_0046221
765 Ga0501080_0056557
766 Ga0501081_0000878
767 Ga0501035_0068747
768 Ga0501045_0029557
769 Ga0501045_0063734
770 Ga0501045_0144916
771 nmdc:mga03683_64791_c1
772 nmdc:mga03n38_117779_c1
773 nmdc:mga00v17_48787_c1
774 nmdc:mga0k408_205846_c1
775 nmdc:mga06z11_83991_c1
776 nmdc:mga04h51_22673_c1
777 nmdc:mga07m45_24775_c1
778 nmdc:mga05p37_327730_c1
779 nmdc:mga09592_237984_c1
780 nmdc:mga0qj67_190437_c1
781 nmdc:mga0qj67_2787_c1
782 nmdc:mga0qj67_6177_c1
783 nmdc:mga06r32_4751_c1
784 nmdc:mga06r32_84037_c1
785 nmdc:mga08y16_342382_c1
786 nmdc:mga08y16_79626_c1
787 nmdc:mga0n895_216165_c1
788 nmdc:mga0n895_21986_c1
789 nmdc:mga0n895_3616_c1
790 nmdc:mga0rr50_4401_c1
791 nmdc:mga0rr50_5972_c1
792 nmdc:mga08x19_327362_c1
793 nmdc:mga0a205_36774_c1
794 nmdc:mga0a205_39395_c2
795 nmdc:mga0sz30_22898_c1
796 Ga0500646_0001198
797 Ga0500583_0057320
798 Ga0500594_0021379
799 Ga0500568_0000017
800 Ga0500568_0063456
801 Ga0500604_0004218
802 Ga0500627_0114567
803 Ga0501084_0072645
804 Ga0501084_0141746
805 Ga0590074_007955
806 Ga0501082_0085571
807 Ga0501082_0218670
808 Ga0466962_0002148
809 Ga0530510_0001154
810 Ga0530510_0001479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14833

NAD_binding_11

NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase

179

300

0.99

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

17

177

0.97

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

7

134

0.87

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

17

84

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cvz-assembly1.cif.gz_D structure of hydroxyisobutyrate dehydrogenase from thermus thermophilus hb8 0.9613 8 292
3cky-assembly1.cif.gz_A structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9531 6 294
3cky-assembly2.cif.gz_D structural and kinetic properties of a beta-hydroxyacid dehydrogenase involved in nicotinate fermentation 0.9528 58 294
2gf2-assembly1.cif.gz_A crystal structure of human hydroxyisobutyrate dehydrogenase 0.9497 7 291
5y8g-assembly1.cif.gz_A mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) 0.9388 7 293
ID Description Score Start End Superfamily
af_P0A9V8_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 6 163 3.40.50.720
1vpdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9633 9 169 3.40.50.720
5y8iB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 5 168 3.40.50.720
4dllB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9605 8 164 3.40.50.720
af_F4IAP5_318_484_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 7 165 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E4NDU7-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9748 7 294 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A6A7LTY5-F1-model_v4 NAD-binding protein 0.9681 6 292 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A183U7X3-F1-model_v4 3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31) 0.9663 90 173 GO:0005739
GO:0006574
GO:0008442
GO:0050661
AF-A0A0Q8P2L7-F1-model_v4 2-hydroxy-3-oxopropionate reductase 0.9655 7 298 GO:0016054
GO:0016616
GO:0050661
GO:0051287
AF-A0A031JPA8-F1-model_v4 deleted 0.9644 7 296

Map