F435675
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 404 | 234 | 395 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300015679|Ga0183366_1010|Ga0183366_101021 |
| Length | 329 |
| Sequence | MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGDFMSLCKNAELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFTSPIKSKADVDKLPIPDPEGELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKAFTLIKKMMYAEPLALHMIFDTWGGVLTGRDYQQFSLYYMHKIVDGLLRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIADARRRVGDKVALQGNMDPSMLYAPPARIEEEVSTILSGFGQGEGHVFNLGHGIHQDVPPEHAGVFVEAVHRLSAQYHK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 2 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 3 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 4 | 2876601092 | Pantoea endophytica 596 | Isolate | Unclassified |
| 5 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 6 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 7 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 8 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 81 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 82 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 83 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 84 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 135 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 136 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 137 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 138 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 139 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 140 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 141 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 142 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 143 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 144 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 145 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 146 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 147 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 148 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 154 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 155 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 156 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 157 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 158 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 159 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 160 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 161 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 162 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 163 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 164 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 165 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 166 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 167 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 168 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 169 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 170 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 171 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 186 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 190 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 191 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 192 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 193 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 194 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 195 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 196 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 229 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 230 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 231 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 232 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 233 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 8016733728 | Pantoea sp. SORGH_AS 659 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0.99 |
| Isolates | 2.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.94 |
| Nodule | 0 |
| Rhizoplane | 2.97 |
| Rhizosphere | 81.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000566 | 3300002737 | Bacteria | 27108 |
| 2 | JGI25163J39215_1000154 | 3300002771 | Bacteria | 27108 |
| 3 | JGI25164J39214_1000364 | 3300002772 | Bacteria | 27108 |
| 4 | Ga0055538_1000270 | 3300003751 | Bacteria | 27108 |
| 5 | Ga0055539_1000298 | 3300003752 | Bacteria | 27108 |
| 6 | Ga0055533_1000280 | 3300003756 | Bacteria | 27108 |
| 7 | Ga0055525_1000404 | 3300003759 | Bacteria | 27108 |
| 8 | Ga0055541_1000193 | 3300003841 | Bacteria | 27108 |
| 9 | Ga0058692_1000726 | 3300003856 | Bacteria | 13425 |
| 10 | Ga0058692_1006413 | 3300003856 | Bacteria | 3239 |
| 11 | Ga0065704_10000027 | 3300005289 | Bacteria | 15467 |
| 12 | Ga0065704_10091977 | 3300005289 | Bacteria | 2682 |
| 13 | Ga0070658_10069153 | 3300005327 | Bacteria | 2888 |
| 14 | Ga0070658_10293498 | 3300005327 | Bacteria | 1386 |
| 15 | Ga0070676_10068834 | 3300005328 | Bacteria | 2120 |
| 16 | Ga0070670_100000134 | 3300005331 | Bacteria | 69571 |
| 17 | Ga0068869_100027409 | 3300005334 | Bacteria | 3972 |
| 18 | Ga0070666_10001051 | 3300005335 | Bacteria | 16889 |
| 19 | Ga0070666_10035201 | 3300005335 | Bacteria | 3320 |
| 20 | Ga0068868_100096707 | 3300005338 | Bacteria | 2385 |
| 21 | Ga0070660_100218842 | 3300005339 | Bacteria | 1547 |
| 22 | Ga0070661_100009642 | 3300005344 | Bacteria | 6692 |
| 23 | Ga0070661_100082840 | 3300005344 | Bacteria | 2369 |
| 24 | Ga0070668_100128698 | 3300005347 | Bacteria | 2030 |
| 25 | Ga0070669_100019050 | 3300005353 | Bacteria | 4906 |
| 26 | Ga0070675_100119371 | 3300005354 | Bacteria | 2240 |
| 27 | Ga0070671_100000231 | 3300005355 | Bacteria | 37362 |
| 28 | Ga0070671_100125067 | 3300005355 | Bacteria | 2165 |
| 29 | Ga0070688_100001631 | 3300005365 | Bacteria | 11236 |
| 30 | Ga0070667_100000060 | 3300005367 | Bacteria | 145801 |
| 31 | Ga0070667_100044506 | 3300005367 | Bacteria | 3728 |
| 32 | Ga0070667_100046924 | 3300005367 | Bacteria | 3634 |
| 33 | Ga0070678_100005981 | 3300005456 | Bacteria | 7090 |
| 34 | Ga0070662_100068767 | 3300005457 | Bacteria | 2604 |
| 35 | Ga0068867_100090549 | 3300005459 | Bacteria | 2321 |
| 36 | Ga0068867_100303126 | 3300005459 | Bacteria | 1318 |
| 37 | Ga0070685_10000063 | 3300005466 | Bacteria | 62658 |
| 38 | Ga0070685_10001527 | 3300005466 | Bacteria | 12204 |
| 39 | Ga0070698_100332811 | 3300005471 | Bacteria | 1450 |
| 40 | Ga0070679_100355805 | 3300005530 | Bacteria | 1412 |
| 41 | Ga0068853_100007334 | 3300005539 | Bacteria | 8826 |
| 42 | Ga0070696_100004921 | 3300005546 | Bacteria | 8917 |
| 43 | Ga0070665_100002146 | 3300005548 | Bacteria | 22025 |
| 44 | Ga0070665_100009514 | 3300005548 | Bacteria | 9828 |
| 45 | Ga0070665_100186910 | 3300005548 | Bacteria | 2073 |
| 46 | Ga0070665_100358266 | 3300005548 | Bacteria | 1464 |
| 47 | Ga0068855_100025019 | 3300005563 | Bacteria | 7145 |
| 48 | Ga0070664_100299188 | 3300005564 | Bacteria | 1454 |
| 49 | Ga0070664_100318097 | 3300005564 | Bacteria | 1409 |
| 50 | Ga0068857_100388233 | 3300005577 | Bacteria | 1297 |
| 51 | Ga0068854_100003283 | 3300005578 | Bacteria | 10078 |
| 52 | Ga0068854_100008791 | 3300005578 | Bacteria | 6499 |
| 53 | Ga0068854_100367575 | 3300005578 | Bacteria | 1182 |
| 54 | Ga0068856_100009925 | 3300005614 | Bacteria | 9249 |
| 55 | Ga0068856_100122535 | 3300005614 | Bacteria | 2602 |
| 56 | Ga0068852_100004195 | 3300005616 | Bacteria | 10157 |
| 57 | Ga0068852_100024140 | 3300005616 | Bacteria | 4909 |
| 58 | Ga0068852_100159911 | 3300005616 | Bacteria | 2102 |
| 59 | Ga0068864_100000143 | 3300005618 | Bacteria | 69296 |
| 60 | Ga0068851_10010948 | 3300005834 | Bacteria | 4242 |
| 61 | Ga0068851_10018942 | 3300005834 | Bacteria | 3322 |
| 62 | Ga0068870_10086639 | 3300005840 | Bacteria | 1743 |
| 63 | Ga0068863_100051902 | 3300005841 | Bacteria | 3886 |
| 64 | Ga0068863_100367995 | 3300005841 | Bacteria | 1402 |
| 65 | Ga0068862_100000759 | 3300005844 | Bacteria | 32206 |
| 66 | Ga0075364_10012642 | 3300006051 | Bacteria | 5170 |
| 67 | Ga0097621_100037304 | 3300006237 | Bacteria | 3893 |
| 68 | Ga0097621_100162481 | 3300006237 | Bacteria | 1920 |
| 69 | Ga0068871_100015289 | 3300006358 | Bacteria | 5740 |
| 70 | Ga0068865_100011849 | 3300006881 | Bacteria | 5470 |
| 71 | Ga0068865_100018995 | 3300006881 | Bacteria | 4444 |
| 72 | Ga0068865_100026705 | 3300006881 | Bacteria | 3808 |
| 73 | Ga0099795_10017290 | 3300007788 | Bacteria | 2297 |
| 74 | Ga0105244_10002890 | 3300009036 | Bacteria | 12697 |
| 75 | Ga0105244_10006262 | 3300009036 | Bacteria | 7748 |
| 76 | Ga0105250_10001252 | 3300009092 | Bacteria | 14068 |
| 77 | Ga0105240_10018746 | 3300009093 | Bacteria | 9272 |
| 78 | Ga0105240_10047885 | 3300009093 | Bacteria | 5406 |
| 79 | Ga0105240_10073068 | 3300009093 | Bacteria | 4236 |
| 80 | Ga0105245_10080781 | 3300009098 | Bacteria | 2971 |
| 81 | Ga0105241_10005103 | 3300009174 | Bacteria | 9685 |
| 82 | Ga0105241_10205479 | 3300009174 | Bacteria | 1647 |
| 83 | Ga0105242_10040028 | 3300009176 | Bacteria | 3775 |
| 84 | Ga0105242_10041552 | 3300009176 | Bacteria | 3709 |
| 85 | Ga0105248_10006836 | 3300009177 | Bacteria | 12503 |
| 86 | Ga0105248_10079779 | 3300009177 | Bacteria | 3678 |
| 87 | Ga0105248_10081332 | 3300009177 | Bacteria | 3641 |
| 88 | Ga0105237_10042108 | 3300009545 | Bacteria | 4606 |
| 89 | Ga0105238_10001884 | 3300009551 | Bacteria | 21060 |
| 90 | Ga0105238_10003883 | 3300009551 | Bacteria | 14834 |
| 91 | Ga0105238_10004857 | 3300009551 | Bacteria | 13302 |
| 92 | Ga0105238_10124658 | 3300009551 | Bacteria | 2555 |
| 93 | Ga0105249_10026196 | 3300009553 | Bacteria | 5252 |
| 94 | Ga0105239_10005085 | 3300010375 | Bacteria | 15526 |
| 95 | Ga0105239_10008615 | 3300010375 | Bacteria | 11564 |
| 96 | Ga0105239_10042053 | 3300010375 | Bacteria | 5007 |
| 97 | Ga0105239_10087534 | 3300010375 | Bacteria | 3434 |
| 98 | Ga0157373_10000898 | 3300013100 | Bacteria | 23045 |
| 99 | Ga0157373_10012564 | 3300013100 | Bacteria | 6224 |
| 100 | Ga0157371_10003217 | 3300013102 | Bacteria | 14984 |
| 101 | Ga0157371_10007769 | 3300013102 | Bacteria | 8621 |
| 102 | Ga0157370_10004164 | 3300013104 | Bacteria | 16737 |
| 103 | Ga0157370_10179263 | 3300013104 | Bacteria | 1969 |
| 104 | Ga0157369_10006998 | 3300013105 | Bacteria | 13013 |
| 105 | Ga0157369_10352190 | 3300013105 | Bacteria | 1529 |
| 106 | Ga0157374_10093178 | 3300013296 | Bacteria | 2876 |
| 107 | Ga0157378_10000322 | 3300013297 | Bacteria | 47146 |
| 108 | Ga0163162_10017677 | 3300013306 | Bacteria | 6977 |
| 109 | Ga0163162_10023502 | 3300013306 | Bacteria | 6083 |
| 110 | Ga0163162_10077131 | 3300013306 | Bacteria | 3396 |
| 111 | Ga0157372_10003066 | 3300013307 | Bacteria | 18004 |
| 112 | Ga0157372_10015544 | 3300013307 | Bacteria | 8157 |
| 113 | Ga0157372_10683192 | 3300013307 | Bacteria | 1195 |
| 114 | Ga0157375_10002283 | 3300013308 | Bacteria | 16584 |
| 115 | Ga0157375_10115091 | 3300013308 | Bacteria | 2792 |
| 116 | Ga0157375_10129791 | 3300013308 | Bacteria | 2639 |
| 117 | Ga0163163_10000404 | 3300014325 | Bacteria | 40714 |
| 118 | Ga0163163_10000604 | 3300014325 | Bacteria | 31347 |
| 119 | Ga0157376_10002810 | 3300014969 | Bacteria | 11896 |
| 120 | Ga0183366_1010 | 3300015679 | Bacteria | 29263 |
| 121 | Ga0183370_1010 | 3300015680 | Bacteria | 29263 |
| 122 | Ga0183369_1025 | 3300015685 | Bacteria | 29263 |
| 123 | Ga0183368_1013 | 3300015687 | Bacteria | 29263 |
| 124 | Ga0209760_100180 | 3300025207 | Bacteria | 33283 |
| 125 | Ga0209784_100291 | 3300025224 | Bacteria | 27389 |
| 126 | Ga0209566_100498 | 3300025225 | Bacteria | 27389 |
| 127 | Ga0209674_100342 | 3300025226 | Bacteria | 27389 |
| 128 | Ga0209563_100230 | 3300025230 | Bacteria | 27389 |
| 129 | Ga0207427_100370 | 3300025231 | Bacteria | 27389 |
| 130 | Ga0209437_100515 | 3300025233 | Bacteria | 27389 |
| 131 | Ga0209677_100373 | 3300025253 | Bacteria | 27389 |
| 132 | Ga0209233_1001153 | 3300025261 | Bacteria | 10740 |
| 133 | Ga0209233_1001156 | 3300025261 | Bacteria | 10712 |
| 134 | Ga0207696_1000599 | 3300025711 | Bacteria | 27115 |
| 135 | Ga0207655_1001372 | 3300025728 | Bacteria | 22808 |
| 136 | Ga0207655_1001476 | 3300025728 | Bacteria | 21609 |
| 137 | Ga0207710_10026563 | 3300025900 | Bacteria | 2503 |
| 138 | Ga0207680_10000218 | 3300025903 | Bacteria | 27690 |
| 139 | Ga0207680_10057392 | 3300025903 | Bacteria | 2355 |
| 140 | Ga0207680_10156488 | 3300025903 | Bacteria | 1524 |
| 141 | Ga0207680_10284459 | 3300025903 | Bacteria | 1150 |
| 142 | Ga0207647_10000019 | 3300025904 | Bacteria | 123924 |
| 143 | Ga0207647_10004212 | 3300025904 | Bacteria | 10668 |
| 144 | Ga0207645_10010692 | 3300025907 | Bacteria | 6293 |
| 145 | Ga0207705_10053924 | 3300025909 | Bacteria | 2898 |
| 146 | Ga0207654_10001464 | 3300025911 | Bacteria | 12504 |
| 147 | Ga0207654_10095827 | 3300025911 | Bacteria | 1818 |
| 148 | Ga0207695_10000014 | 3300025913 | Bacteria | 812599 |
| 149 | Ga0207695_10000330 | 3300025913 | Bacteria | 113210 |
| 150 | Ga0207695_10015627 | 3300025913 | Bacteria | 8929 |
| 151 | Ga0207671_10006159 | 3300025914 | Bacteria | 10779 |
| 152 | Ga0207671_10153568 | 3300025914 | Bacteria | 1780 |
| 153 | Ga0207663_10005533 | 3300025916 | Bacteria | 6372 |
| 154 | Ga0207657_10004311 | 3300025919 | Bacteria | 15074 |
| 155 | Ga0207649_10001385 | 3300025920 | Bacteria | 14363 |
| 156 | Ga0207649_10042956 | 3300025920 | Bacteria | 2761 |
| 157 | Ga0207694_10000266 | 3300025924 | Bacteria | 49793 |
| 158 | Ga0207694_10003489 | 3300025924 | Bacteria | 12503 |
| 159 | Ga0207650_10000013 | 3300025925 | Bacteria | 409471 |
| 160 | Ga0207650_10241726 | 3300025925 | Bacteria | 1459 |
| 161 | Ga0207644_10000189 | 3300025931 | Bacteria | 44445 |
| 162 | Ga0207706_10006488 | 3300025933 | Bacteria | 10860 |
| 163 | Ga0207686_10006533 | 3300025934 | Bacteria | 6280 |
| 164 | Ga0207669_10069659 | 3300025937 | Bacteria | 2202 |
| 165 | Ga0207704_10025972 | 3300025938 | Bacteria | 3205 |
| 166 | Ga0207704_10082334 | 3300025938 | Bacteria | 2085 |
| 167 | Ga0207691_10174750 | 3300025940 | Bacteria | 1879 |
| 168 | Ga0207711_10001271 | 3300025941 | Bacteria | 23909 |
| 169 | Ga0207711_10017624 | 3300025941 | Bacteria | 5932 |
| 170 | Ga0207711_10172713 | 3300025941 | Bacteria | 1962 |
| 171 | Ga0207661_10042304 | 3300025944 | Bacteria | 3591 |
| 172 | Ga0207667_10107440 | 3300025949 | Bacteria | 2879 |
| 173 | Ga0207667_10209842 | 3300025949 | Bacteria | 1996 |
| 174 | Ga0207712_10000325 | 3300025961 | Bacteria | 43665 |
| 175 | Ga0207658_10000005 | 3300025986 | Bacteria | 408341 |
| 176 | Ga0207658_10014107 | 3300025986 | Bacteria | 5473 |
| 177 | Ga0207658_10089892 | 3300025986 | Bacteria | 2378 |
| 178 | Ga0207658_10189380 | 3300025986 | Bacteria | 1709 |
| 179 | Ga0207677_10003656 | 3300026023 | Bacteria | 8162 |
| 180 | Ga0207703_10017288 | 3300026035 | Bacteria | 5629 |
| 181 | Ga0207639_10000163 | 3300026041 | Bacteria | 51309 |
| 182 | Ga0207639_10019494 | 3300026041 | Bacteria | 4839 |
| 183 | Ga0207678_10029901 | 3300026067 | Bacteria | 4756 |
| 184 | Ga0207641_10161488 | 3300026088 | Bacteria | 2037 |
| 185 | Ga0207641_10161820 | 3300026088 | Bacteria | 2035 |
| 186 | Ga0207648_10009668 | 3300026089 | Bacteria | 9222 |
| 187 | Ga0207648_10055895 | 3300026089 | Bacteria | 3445 |
| 188 | Ga0207676_10000010 | 3300026095 | Bacteria | 519402 |
| 189 | Ga0207676_10098810 | 3300026095 | Bacteria | 2414 |
| 190 | Ga0207674_10029055 | 3300026116 | Bacteria | 5827 |
| 191 | Ga0207674_10032448 | 3300026116 | Bacteria | 5478 |
| 192 | Ga0207674_10190681 | 3300026116 | Bacteria | 1999 |
| 193 | Ga0207683_10328384 | 3300026121 | Bacteria | 1402 |
| 194 | Ga0207698_10095823 | 3300026142 | Bacteria | 2444 |
| 195 | Ga0209371_1001662 | 3300027312 | Bacteria | 14265 |
| 196 | Ga0209371_1001840 | 3300027312 | Bacteria | 13128 |
| 197 | Ga0209371_1003747 | 3300027312 | Bacteria | 7108 |
| 198 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 199 | Ga0268266_10184197 | 3300028379 | Bacteria | 1903 |
| 200 | Ga0268266_10293240 | 3300028379 | Bacteria | 1515 |
| 201 | Ga0268265_10002466 | 3300028380 | Bacteria | 13911 |
| 202 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 203 | Ga0268256_1001372 | 3300030500 | Bacteria | 14802 |
| 204 | Ga0268256_1001452 | 3300030500 | Bacteria | 14264 |
| 205 | Ga0316176_1221853 | 3300030732 | Bacteria | 2116 |
| 206 | Ga0314311_1090877 | 3300030733 | Bacteria | 4632 |
| 207 | Ga0316178_1091317 | 3300030735 | Bacteria | 1470 |
| 208 | Ga0265760_10000100 | 3300031090 | Bacteria | 22347 |
| 209 | Ga0307508_10275890 | 3300031616 | Bacteria | 1275 |
| 210 | Ga0316575_10000051 | 3300031665 | Bacteria | 29380 |
| 211 | Ga0316575_10012637 | 3300031665 | Bacteria | 3144 |
| 212 | Ga0316575_10067263 | 3300031665 | Bacteria | 1436 |
| 213 | Ga0316575_10082251 | 3300031665 | Bacteria | 1299 |
| 214 | Ga0316579_10084283 | 3300031691 | Bacteria | 1515 |
| 215 | Ga0316579_10108144 | 3300031691 | Bacteria | 1334 |
| 216 | Ga0316576_10008101 | 3300031727 | Bacteria | 6670 |
| 217 | Ga0316576_10014425 | 3300031727 | Bacteria | 5280 |
| 218 | Ga0316576_10042389 | 3300031727 | Bacteria | 3280 |
| 219 | Ga0316576_10077121 | 3300031727 | Bacteria | 2467 |
| 220 | Ga0316576_10084281 | 3300031727 | Bacteria | 2362 |
| 221 | Ga0316578_10027083 | 3300031728 | Bacteria | 3238 |
| 222 | Ga0316578_10035851 | 3300031728 | Bacteria | 2853 |
| 223 | Ga0316578_10068659 | 3300031728 | Bacteria | 2096 |
| 224 | Ga0316578_10126078 | 3300031728 | Bacteria | 1540 |
| 225 | Ga0307516_10000190 | 3300031730 | Bacteria | 79464 |
| 226 | Ga0307516_10079815 | 3300031730 | Bacteria | 3116 |
| 227 | Ga0316577_10054280 | 3300031733 | Bacteria | 2237 |
| 228 | Ga0316577_10102007 | 3300031733 | Bacteria | 1608 |
| 229 | Ga0316577_10153290 | 3300031733 | Bacteria | 1299 |
| 230 | Ga0316583_10005530 | 3300032133 | Bacteria | 4534 |
| 231 | Ga0316583_10006953 | 3300032133 | Bacteria | 4074 |
| 232 | Ga0316585_10007267 | 3300032137 | Bacteria | 3188 |
| 233 | Ga0316580_10016626 | 3300032139 | Bacteria | 2258 |
| 234 | Ga0316580_10025766 | 3300032139 | Bacteria | 1818 |
| 235 | Ga0316580_10038882 | 3300032139 | Bacteria | 1470 |
| 236 | Ga0316593_10005279 | 3300032168 | Bacteria | 3391 |
| 237 | Ga0316593_10011839 | 3300032168 | Bacteria | 2546 |
| 238 | Ga0316596_1012956 | 3300033541 | Bacteria | 2056 |
| 239 | Ga0373923_0035770 | 3300035111 | Bacteria | 2024 |
| 240 | Ga0316574_0000270 | 3300035398 | Bacteria | 19196 |
| 241 | Ga0316574_0001146 | 3300035398 | Bacteria | 12201 |
| 242 | Ga0316574_0004818 | 3300035398 | Bacteria | 7139 |
| 243 | Ga0316574_0005363 | 3300035398 | Bacteria | 6831 |
| 244 | Ga0316574_0006891 | 3300035398 | Bacteria | 6182 |
| 245 | Ga0316574_0026925 | 3300035398 | Bacteria | 3460 |
| 246 | Ga0316574_0032325 | 3300035398 | Bacteria | 3179 |
| 247 | Ga0316574_0039020 | 3300035398 | Bacteria | 2918 |
| 248 | Ga0316574_0040871 | 3300035398 | Bacteria | 2856 |
| 249 | Ga0316574_0045547 | 3300035398 | Bacteria | 2717 |
| 250 | Ga0316574_0046486 | 3300035398 | Bacteria | 2692 |
| 251 | Ga0316574_0066276 | 3300035398 | Bacteria | 2275 |
| 252 | Ga0316574_0082856 | 3300035398 | Bacteria | 2039 |
| 253 | Ga0316574_0092426 | 3300035398 | Bacteria | 1931 |
| 254 | Ga0316574_0092721 | 3300035398 | Bacteria | 1928 |
| 255 | Ga0316574_0149819 | 3300035398 | Bacteria | 1503 |
| 256 | Ga0316574_0210551 | 3300035398 | Bacteria | 1247 |
| 257 | Ga0373935_0074322 | 3300035692 | Bacteria | 2197 |
| 258 | Ga0316582_0002393 | 3300036647 | Bacteria | 8788 |
| 259 | Ga0316582_0002498 | 3300036647 | Bacteria | 8664 |
| 260 | Ga0316582_0004149 | 3300036647 | Bacteria | 7257 |
| 261 | Ga0316582_0010549 | 3300036647 | Bacteria | 5064 |
| 262 | Ga0316582_0080842 | 3300036647 | Bacteria | 2122 |
| 263 | Ga0316582_0083390 | 3300036647 | Bacteria | 2091 |
| 264 | Ga0316582_0142700 | 3300036647 | Bacteria | 1615 |
| 265 | Ga0316584_0018251 | 3300036712 | Bacteria | 5059 |
| 266 | Ga0316584_0053724 | 3300036712 | Bacteria | 3015 |
| 267 | Ga0316584_0067970 | 3300036712 | Bacteria | 2670 |
| 268 | Ga0316584_0158285 | 3300036712 | Bacteria | 1683 |
| 269 | Ga0316584_0176386 | 3300036712 | Bacteria | 1583 |
| 270 | Ga0316581_0004787 | 3300037588 | Bacteria | 3483 |
| 271 | Ga0316581_0005309 | 3300037588 | Bacteria | 3346 |
| 272 | Ga0316581_0037851 | 3300037588 | Bacteria | 1466 |
| 273 | Ga0400488_05079 | 3300038741 | Bacteria | 2905 |
| 274 | Ga0400483_094960 | 3300039062 | Bacteria | 2748 |
| 275 | Ga0400483_154898 | 3300039062 | Bacteria | 5896 |
| 276 | Ga0400489_63367 | 3300039093 | Bacteria | 11246 |
| 277 | Ga0439438_000065 | 3300041405 | Bacteria | 49586 |
| 278 | Ga0439447_004811 | 3300041407 | Bacteria | 4587 |
| 279 | Ga0451802_0739338 | 3300041460 | Bacteria | 4505 |
| 280 | Ga0451804_0627905 | 3300041463 | Bacteria | 1854 |
| 281 | Ga0439432_002070 | 3300042006 | Bacteria | 7580 |
| 282 | Ga0439432_044414 | 3300042006 | Bacteria | 1400 |
| 283 | Ga0439446_0000058 | 3300042156 | Bacteria | 17452 |
| 284 | Ga0450908_012249 | 3300042184 | Bacteria | 1559 |
| 285 | Ga0439434_0002716 | 3300042435 | Bacteria | 5154 |
| 286 | Ga0451577_0000084 | 3300042876 | Bacteria | 213553 |
| 287 | Ga0466972_0005412 | 3300044658 | Bacteria | 6394 |
| 288 | Ga0453684_0002985 | 3300044712 | Bacteria | 39370 |
| 289 | Ga0453684_0003652 | 3300044712 | Bacteria | 34170 |
| 290 | Ga0453684_0062154 | 3300044712 | Bacteria | 4786 |
| 291 | Ga0466970_0001519 | 3300044765 | Bacteria | 11162 |
| 292 | Ga0495591_000637 | 3300046458 | Bacteria | 25949 |
| 293 | Ga0495650_0001197 | 3300046471 | Bacteria | 27412 |
| 294 | Ga0495616_0000926 | 3300046513 | Bacteria | 21101 |
| 295 | Ga0495632_0041976 | 3300046519 | Bacteria | 2295 |
| 296 | Ga0495644_0000046 | 3300046523 | Bacteria | 59289 |
| 297 | Ga0495654_0000715 | 3300046530 | Bacteria | 25958 |
| 298 | Ga0495668_0024298 | 3300046616 | Bacteria | 3448 |
| 299 | Ga0495611_0035101 | 3300046648 | Bacteria | 2220 |
| 300 | Ga0495661_0013022 | 3300046665 | Bacteria | 5603 |
| 301 | Ga0495671_0001609 | 3300046692 | Bacteria | 14858 |
| 302 | Ga0495660_0000474 | 3300046810 | Bacteria | 33386 |
| 303 | Ga0495593_0001336 | 3300047673 | Bacteria | 14425 |
| 304 | Ga0496100_0050729 | 3300048903 | Bacteria | 2690 |
| 305 | Ga0496100_0054672 | 3300048903 | Bacteria | 2605 |
| 306 | Ga0496101_0000454 | 3300048904 | Bacteria | 26040 |
| 307 | Ga0496104_0000041 | 3300048907 | Bacteria | 161394 |
| 308 | Ga0496104_0002509 | 3300048907 | Bacteria | 15796 |
| 309 | Ga0496104_0290433 | 3300048907 | Bacteria | 1547 |
| 310 | Ga0496105_0000022 | 3300048908 | Bacteria | 161208 |
| 311 | Ga0496105_0026392 | 3300048908 | Bacteria | 4737 |
| 312 | Ga0496107_0095624 | 3300048910 | Bacteria | 2174 |
| 313 | Ga0496116_0001114 | 3300048919 | Bacteria | 32173 |
| 314 | Ga0496116_0002300 | 3300048919 | Bacteria | 20263 |
| 315 | Ga0496116_0007635 | 3300048919 | Bacteria | 9543 |
| 316 | Ga0496117_0008738 | 3300048920 | Bacteria | 9568 |
| 317 | Ga0496117_0010355 | 3300048920 | Bacteria | 8516 |
| 318 | Ga0496118_0000101 | 3300048921 | Bacteria | 159577 |
| 319 | Ga0496118_0005889 | 3300048921 | Bacteria | 13726 |
| 320 | Ga0496118_0094084 | 3300048921 | Bacteria | 2050 |
| 321 | Ga0496119_0005956 | 3300048922 | Bacteria | 11467 |
| 322 | Ga0496119_0009753 | 3300048922 | Bacteria | 8173 |
| 323 | Ga0496119_0010782 | 3300048922 | Bacteria | 7652 |
| 324 | Ga0496120_0002042 | 3300048923 | Bacteria | 21850 |
| 325 | Ga0496120_0003605 | 3300048923 | Bacteria | 13904 |
| 326 | Ga0496120_0007439 | 3300048923 | Bacteria | 8142 |
| 327 | Ga0496122_0002332 | 3300048925 | Bacteria | 27370 |
| 328 | Ga0496122_0009974 | 3300048925 | Bacteria | 9889 |
| 329 | Ga0496123_0003414 | 3300048926 | Bacteria | 17880 |
| 330 | Ga0496123_0147090 | 3300048926 | Bacteria | 1277 |
| 331 | Ga0496124_0002542 | 3300048927 | Bacteria | 23661 |
| 332 | Ga0496124_0009961 | 3300048927 | Bacteria | 9710 |
| 333 | Ga0496124_0064328 | 3300048927 | Bacteria | 3062 |
| 334 | Ga0496125_0002049 | 3300048928 | Bacteria | 27227 |
| 335 | Ga0496125_0050993 | 3300048928 | Bacteria | 3418 |
| 336 | Ga0496126_0002654 | 3300048929 | Bacteria | 23701 |
| 337 | Ga0496126_0064697 | 3300048929 | Bacteria | 3275 |
| 338 | Ga0501032_0018166 | 3300049569 | Bacteria | 4928 |
| 339 | Ga0501033_0001414 | 3300049570 | Bacteria | 21325 |
| 340 | Ga0501034_0012615 | 3300049571 | Bacteria | 8719 |
| 341 | Ga0501036_0007237 | 3300049572 | Bacteria | 9035 |
| 342 | Ga0501036_0011009 | 3300049572 | Bacteria | 7481 |
| 343 | Ga0501036_0031544 | 3300049572 | Bacteria | 4478 |
| 344 | Ga0501037_0006148 | 3300049573 | Bacteria | 8769 |
| 345 | Ga0501038_0000645 | 3300049574 | Bacteria | 30998 |
| 346 | Ga0501038_0006069 | 3300049574 | Bacteria | 11178 |
| 347 | Ga0501038_0088771 | 3300049574 | Bacteria | 2594 |
| 348 | Ga0501039_0000681 | 3300049575 | Bacteria | 24450 |
| 349 | Ga0501039_0000959 | 3300049575 | Bacteria | 21007 |
| 350 | Ga0501040_0076755 | 3300049576 | Bacteria | 2310 |
| 351 | Ga0501041_0053060 | 3300049577 | Bacteria | 2472 |
| 352 | Ga0501042_0024922 | 3300049578 | Bacteria | 4198 |
| 353 | Ga0501042_0241144 | 3300049578 | Bacteria | 1304 |
| 354 | Ga0501043_0007367 | 3300049579 | Bacteria | 8730 |
| 355 | Ga0501043_0097435 | 3300049579 | Bacteria | 2312 |
| 356 | Ga0501043_0114680 | 3300049579 | Bacteria | 2115 |
| 357 | Ga0501046_0006636 | 3300049580 | Bacteria | 10222 |
| 358 | Ga0501046_0122329 | 3300049580 | Bacteria | 1979 |
| 359 | Ga0501047_0002496 | 3300049581 | Bacteria | 17539 |
| 360 | Ga0501047_0007429 | 3300049581 | Bacteria | 10314 |
| 361 | Ga0501047_0247068 | 3300049581 | Bacteria | 1633 |
| 362 | Ga0501067_0001270 | 3300049583 | Bacteria | 13727 |
| 363 | Ga0501067_0029677 | 3300049583 | Bacteria | 3031 |
| 364 | Ga0501068_0014727 | 3300049584 | Bacteria | 4475 |
| 365 | Ga0501069_0003501 | 3300049585 | Bacteria | 8088 |
| 366 | Ga0501070_0022531 | 3300049586 | Bacteria | 5276 |
| 367 | Ga0501070_0047279 | 3300049586 | Bacteria | 3577 |
| 368 | Ga0501070_0095366 | 3300049586 | Bacteria | 2461 |
| 369 | Ga0501071_0061805 | 3300049587 | Bacteria | 2713 |
| 370 | Ga0501072_0001569 | 3300049588 | Bacteria | 17055 |
| 371 | Ga0501073_0034902 | 3300049589 | Bacteria | 3577 |
| 372 | Ga0501073_0046859 | 3300049589 | Bacteria | 3039 |
| 373 | Ga0501074_0016701 | 3300049590 | Bacteria | 5326 |
| 374 | Ga0501074_0026992 | 3300049590 | Bacteria | 4161 |
| 375 | Ga0501075_0007392 | 3300049591 | Bacteria | 7621 |
| 376 | Ga0501076_0139183 | 3300049592 | Bacteria | 1971 |
| 377 | Ga0501079_0029545 | 3300049741 | Bacteria | 4209 |
| 378 | Ga0501080_0000934 | 3300049742 | Bacteria | 23868 |
| 379 | Ga0501080_0008075 | 3300049742 | Bacteria | 9539 |
| 380 | Ga0501080_0015701 | 3300049742 | Bacteria | 6982 |
| 381 | Ga0501080_0132066 | 3300049742 | Bacteria | 2312 |
| 382 | Ga0501083_0160239 | 3300049744 | Bacteria | 1472 |
| 383 | Ga0501035_0124845 | 3300049822 | Bacteria | 2247 |
| 384 | Ga0501035_0194734 | 3300049822 | Bacteria | 1741 |
| 385 | Ga0501044_0006953 | 3300049823 | Bacteria | 12450 |
| 386 | Ga0501044_0063762 | 3300049823 | Bacteria | 3763 |
| 387 | Ga0501045_0123763 | 3300049824 | Bacteria | 1920 |
| 388 | nmdc:mga0n895_192353_c1 | 3300050512 | Bacteria | 2071 |
| 389 | Ga0500610_0000128 | 3300053079 | Bacteria | 22908 |
| 390 | Ga0500651_0002661 | 3300053093 | Bacteria | 9498 |
| 391 | Ga0500654_109100 | 3300053099 | Bacteria | 1142 |
| 392 | Ga0500595_005786 | 3300053119 | Bacteria | 5338 |
| 393 | Ga0500564_018038 | 3300053138 | Bacteria | 3213 |
| 394 | Ga0501082_0078733 | 3300060353 | Bacteria | 2843 |
| 395 | Ga0501082_0084840 | 3300060353 | Bacteria | 2731 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300015679 | Ga0183366_1010 | Ga0183366_101021 | 329 |
| 2 | 3300015680 | Ga0183370_1010 | Ga0183370_101021 | 329 |
| 3 | 3300015685 | Ga0183369_1025 | Ga0183369_102521 | 329 |
| 4 | 3300015687 | Ga0183368_1013 | Ga0183368_101321 | 329 |
| 5 | 3300036712 | Ga0316584_0067970 | Ga0316584_0067970_723_1715 | 329 |
| 6 | 3300035398 | Ga0316574_0001146 | Ga0316574_0001146_6927_7925 | 330 |
| 7 | 3300042876 | Ga0451577_0000084 | Ga0451577_0000084_17426_18418 | 330 |
| 8 | 3300044712 | Ga0453684_0003652 | Ga0453684_0003652_20748_21740 | 330 |
| 9 | 3300049569 | Ga0501032_0018166 | Ga0501032_0018166_1815_2828 | 337 |
| 10 | 3300049572 | Ga0501036_0011009 | Ga0501036_0011009_6292_7305 | 337 |
| 11 | 3300049574 | Ga0501038_0088771 | Ga0501038_0088771_125_1138 | 337 |
| 12 | 3300049575 | Ga0501039_0000681 | Ga0501039_0000681_23147_24160 | 337 |
| 13 | 3300049576 | Ga0501040_0076755 | Ga0501040_0076755_687_1700 | 337 |
| 14 | 3300049577 | Ga0501041_0053060 | Ga0501041_0053060_46_1059 | 337 |
| 15 | 3300049578 | Ga0501042_0024922 | Ga0501042_0024922_2776_3789 | 337 |
| 16 | 3300049578 | Ga0501042_0241144 | Ga0501042_0241144_72_1085 | 337 |
| 17 | 3300049591 | Ga0501075_0007392 | Ga0501075_0007392_4794_5807 | 337 |
| 18 | 3300049592 | Ga0501076_0139183 | Ga0501076_0139183_289_1302 | 337 |
| 19 | 3300049742 | Ga0501080_0132066 | Ga0501080_0132066_16_1029 | 337 |
| 20 | 3300049822 | Ga0501035_0194734 | Ga0501035_0194734_76_1089 | 337 |
| 21 | 3300049824 | Ga0501045_0123763 | Ga0501045_0123763_491_1504 | 337 |
| 22 | 3300060353 | Ga0501082_0084840 | Ga0501082_0084840_43_1056 | 337 |
| 23 | 3300035398 | Ga0316574_0210551 | Ga0316574_0210551_11_1039 | 341 |
| 24 | 3300005327 | Ga0070658_10293498 | Ga0070658_102934982 | 347 |
| 25 | 3300005327 | Ga0070658_10069153 | Ga0070658_100691533 | 348 |
| 26 | 3300005328 | Ga0070676_10068834 | Ga0070676_100688342 | 348 |
| 27 | 3300005334 | Ga0068869_100027409 | Ga0068869_1000274093 | 348 |
| 28 | 3300005335 | Ga0070666_10001051 | Ga0070666_1000105110 | 348 |
| 29 | 3300005335 | Ga0070666_10035201 | Ga0070666_100352013 | 348 |
| 30 | 3300005339 | Ga0070660_100218842 | Ga0070660_1002188421 | 348 |
| 31 | 3300005344 | Ga0070661_100009642 | Ga0070661_1000096425 | 348 |
| 32 | 3300005344 | Ga0070661_100082840 | Ga0070661_1000828402 | 348 |
| 33 | 3300005347 | Ga0070668_100128698 | Ga0070668_1001286983 | 348 |
| 34 | 3300005353 | Ga0070669_100019050 | Ga0070669_1000190503 | 348 |
| 35 | 3300005354 | Ga0070675_100119371 | Ga0070675_1001193712 | 348 |
| 36 | 3300005456 | Ga0070678_100005981 | Ga0070678_1000059815 | 348 |
| 37 | 3300005539 | Ga0068853_100007334 | Ga0068853_10000733411 | 348 |
| 38 | 3300005548 | Ga0070665_100186910 | Ga0070665_1001869102 | 348 |
| 39 | 3300005563 | Ga0068855_100025019 | Ga0068855_1000250193 | 348 |
| 40 | 3300005577 | Ga0068857_100388233 | Ga0068857_1003882331 | 348 |
| 41 | 3300005578 | Ga0068854_100003283 | Ga0068854_1000032834 | 348 |
| 42 | 3300005578 | Ga0068854_100367575 | Ga0068854_1003675751 | 348 |
| 43 | 3300005614 | Ga0068856_100009925 | Ga0068856_10000992510 | 348 |
| 44 | 3300005614 | Ga0068856_100122535 | Ga0068856_1001225352 | 348 |
| 45 | 3300005616 | Ga0068852_100004195 | Ga0068852_1000041957 | 348 |
| 46 | 3300005834 | Ga0068851_10018942 | Ga0068851_100189422 | 348 |
| 47 | 3300005840 | Ga0068870_10086639 | Ga0068870_100866391 | 348 |
| 48 | 3300006881 | Ga0068865_100011849 | Ga0068865_1000118492 | 348 |
| 49 | 3300009093 | Ga0105240_10047885 | Ga0105240_100478853 | 348 |
| 50 | 3300009093 | Ga0105240_10073068 | Ga0105240_100730682 | 348 |
| 51 | 3300009098 | Ga0105245_10080781 | Ga0105245_100807812 | 348 |
| 52 | 3300009174 | Ga0105241_10005103 | Ga0105241_100051033 | 348 |
| 53 | 3300009545 | Ga0105237_10042108 | Ga0105237_100421083 | 348 |
| 54 | 3300009551 | Ga0105238_10003883 | Ga0105238_100038837 | 348 |
| 55 | 3300009551 | Ga0105238_10124658 | Ga0105238_101246582 | 348 |
| 56 | 3300010375 | Ga0105239_10042053 | Ga0105239_100420533 | 348 |
| 57 | 3300013104 | Ga0157370_10179263 | Ga0157370_101792631 | 348 |
| 58 | 3300013105 | Ga0157369_10006998 | Ga0157369_100069984 | 348 |
| 59 | 3300013307 | Ga0157372_10003066 | Ga0157372_100030669 | 348 |
| 60 | 3300014325 | Ga0163163_10000404 | Ga0163163_1000040426 | 348 |
| 61 | 3300025903 | Ga0207680_10000218 | Ga0207680_1000021823 | 348 |
| 62 | 3300025903 | Ga0207680_10156488 | Ga0207680_101564882 | 348 |
| 63 | 3300025904 | Ga0207647_10004212 | Ga0207647_100042121 | 348 |
| 64 | 3300025907 | Ga0207645_10010692 | Ga0207645_100106923 | 348 |
| 65 | 3300025909 | Ga0207705_10053924 | Ga0207705_100539243 | 348 |
| 66 | 3300025911 | Ga0207654_10001464 | Ga0207654_1000146410 | 348 |
| 67 | 3300025911 | Ga0207654_10095827 | Ga0207654_100958273 | 348 |
| 68 | 3300025913 | Ga0207695_10000330 | Ga0207695_1000033011 | 348 |
| 69 | 3300025914 | Ga0207671_10006159 | Ga0207671_1000615911 | 348 |
| 70 | 3300025914 | Ga0207671_10153568 | Ga0207671_101535682 | 348 |
| 71 | 3300025919 | Ga0207657_10004311 | Ga0207657_100043119 | 348 |
| 72 | 3300025920 | Ga0207649_10001385 | Ga0207649_100013859 | 348 |
| 73 | 3300025920 | Ga0207649_10042956 | Ga0207649_100429562 | 348 |
| 74 | 3300025938 | Ga0207704_10082334 | Ga0207704_100823342 | 348 |
| 75 | 3300025944 | Ga0207661_10042304 | Ga0207661_100423042 | 348 |
| 76 | 3300025949 | Ga0207667_10107440 | Ga0207667_101074402 | 348 |
| 77 | 3300026023 | Ga0207677_10003656 | Ga0207677_1000365611 | 348 |
| 78 | 3300026041 | Ga0207639_10019494 | Ga0207639_100194942 | 348 |
| 79 | 3300026116 | Ga0207674_10029055 | Ga0207674_100290553 | 348 |
| 80 | 3300028379 | Ga0268266_10293240 | Ga0268266_102932402 | 348 |
| 81 | 3300031730 | Ga0307516_10079815 | Ga0307516_100798153 | 348 |
| 82 | 3300049579 | Ga0501043_0114680 | Ga0501043_0114680_39_1085 | 348 |
| 83 | 3300049580 | Ga0501046_0122329 | Ga0501046_0122329_351_1397 | 348 |
| 84 | 3300049581 | Ga0501047_0002496 | Ga0501047_0002496_14835_15881 | 348 |
| 85 | 3300049586 | Ga0501070_0047279 | Ga0501070_0047279_1562_2608 | 348 |
| 86 | 3300049590 | Ga0501074_0026992 | Ga0501074_0026992_2768_3814 | 348 |
| 87 | 3300049742 | Ga0501080_0000934 | Ga0501080_0000934_16409_17455 | 348 |
| 88 | 3300005355 | Ga0070671_100125067 | Ga0070671_1001250671 | 349 |
| 89 | 3300005459 | Ga0068867_100090549 | Ga0068867_1000905493 | 349 |
| 90 | 3300005459 | Ga0068867_100303126 | Ga0068867_1003031261 | 349 |
| 91 | 3300005564 | Ga0070664_100318097 | Ga0070664_1003180972 | 349 |
| 92 | 3300005841 | Ga0068863_100051902 | Ga0068863_1000519024 | 349 |
| 93 | 3300006358 | Ga0068871_100015289 | Ga0068871_1000152895 | 349 |
| 94 | 3300006881 | Ga0068865_100026705 | Ga0068865_1000267052 | 349 |
| 95 | 3300009176 | Ga0105242_10041552 | Ga0105242_100415523 | 349 |
| 96 | 3300010375 | Ga0105239_10005085 | Ga0105239_1000508513 | 349 |
| 97 | 3300013297 | Ga0157378_10000322 | Ga0157378_1000032213 | 349 |
| 98 | 3300013306 | Ga0163162_10017677 | Ga0163162_100176776 | 349 |
| 99 | 3300013308 | Ga0157375_10115091 | Ga0157375_101150912 | 349 |
| 100 | 3300013308 | Ga0157375_10129791 | Ga0157375_101297912 | 349 |
| 101 | 3300025903 | Ga0207680_10284459 | Ga0207680_102844591 | 349 |
| 102 | 3300025937 | Ga0207669_10069659 | Ga0207669_100696592 | 349 |
| 103 | 3300025938 | Ga0207704_10025972 | Ga0207704_100259722 | 349 |
| 104 | 3300025940 | Ga0207691_10174750 | Ga0207691_101747502 | 349 |
| 105 | 3300025986 | Ga0207658_10189380 | Ga0207658_101893802 | 349 |
| 106 | 3300026089 | Ga0207648_10009668 | Ga0207648_1000966810 | 349 |
| 107 | 3300026089 | Ga0207648_10055895 | Ga0207648_100558954 | 349 |
| 108 | 3300026095 | Ga0207676_10098810 | Ga0207676_100988102 | 349 |
| 109 | 3300026116 | Ga0207674_10190681 | Ga0207674_101906812 | 349 |
| 110 | 3300031616 | Ga0307508_10275890 | Ga0307508_102758902 | 349 |
| 111 | 3300048907 | Ga0496104_0000041 | Ga0496104_0000041_31769_32818 | 349 |
| 112 | 3300048908 | Ga0496105_0000022 | Ga0496105_0000022_31629_32678 | 349 |
| 113 | 3300005338 | Ga0068868_100096707 | Ga0068868_1000967073 | 350 |
| 114 | 3300005471 | Ga0070698_100332811 | Ga0070698_1003328111 | 350 |
| 115 | 3300005530 | Ga0070679_100355805 | Ga0070679_1003558052 | 350 |
| 116 | 3300005548 | Ga0070665_100358266 | Ga0070665_1003582661 | 350 |
| 117 | 3300006237 | Ga0097621_100037304 | Ga0097621_1000373044 | 350 |
| 118 | 3300006237 | Ga0097621_100162481 | Ga0097621_1001624813 | 350 |
| 119 | 3300009176 | Ga0105242_10040028 | Ga0105242_100400283 | 350 |
| 120 | 3300010375 | Ga0105239_10008615 | Ga0105239_100086156 | 350 |
| 121 | 3300013306 | Ga0163162_10077131 | Ga0163162_100771312 | 350 |
| 122 | 3300014969 | Ga0157376_10002810 | Ga0157376_100028106 | 350 |
| 123 | 3300025934 | Ga0207686_10006533 | Ga0207686_100065335 | 350 |
| 124 | 3300026121 | Ga0207683_10328384 | Ga0207683_103283842 | 350 |
| 125 | 3300050512 | nmdc:mga0n895_192353_c1 | nmdc:mga0n895_192353_c1_418_1470 | 350 |
| 126 | iso_pu_bacteria | 2511231025 | 2511381733 | 350 |
| 127 | iso_pu_bacteria | 2667528173 | 2671111048 | 350 |
| 128 | iso_pu_bacteria | 2852103415 | 2852106408 | 350 |
| 129 | iso_pu_bacteria | 2876601092 | 2876602473 | 350 |
| 130 | iso_pu_bacteria | 2904474040 | 2904479179 | 350 |
| 131 | iso_pu_bacteria | 2919150387 | 2919155588 | 350 |
| 132 | iso_pu_bacteria | 2927143783 | 2927148946 | 350 |
| 133 | iso_pu_bacteria | 2939602548 | 2939607189 | 350 |
| 134 | iso_pu_bacteria | 8016733728 | 8016737670 | 350 |
| 135 | 3300005367 | Ga0070667_100044506 | Ga0070667_1000445063 | 351 |
| 136 | 3300005367 | Ga0070667_100046924 | Ga0070667_1000469243 | 351 |
| 137 | 3300005457 | Ga0070662_100068767 | Ga0070662_1000687671 | 351 |
| 138 | 3300005466 | Ga0070685_10001527 | Ga0070685_100015272 | 351 |
| 139 | 3300005546 | Ga0070696_100004921 | Ga0070696_1000049217 | 351 |
| 140 | 3300005548 | Ga0070665_100002146 | Ga0070665_10000214612 | 351 |
| 141 | 3300005564 | Ga0070664_100299188 | Ga0070664_1002991882 | 351 |
| 142 | 3300005578 | Ga0068854_100008791 | Ga0068854_1000087914 | 351 |
| 143 | 3300005616 | Ga0068852_100024140 | Ga0068852_1000241403 | 351 |
| 144 | 3300005616 | Ga0068852_100159911 | Ga0068852_1001599112 | 351 |
| 145 | 3300005834 | Ga0068851_10010948 | Ga0068851_100109482 | 351 |
| 146 | 3300006881 | Ga0068865_100018995 | Ga0068865_1000189954 | 351 |
| 147 | 3300007788 | Ga0099795_10017290 | Ga0099795_100172902 | 351 |
| 148 | 3300009093 | Ga0105240_10018746 | Ga0105240_100187466 | 351 |
| 149 | 3300009174 | Ga0105241_10205479 | Ga0105241_102054792 | 351 |
| 150 | 3300009551 | Ga0105238_10001884 | Ga0105238_100018842 | 351 |
| 151 | 3300009551 | Ga0105238_10004857 | Ga0105238_1000485711 | 351 |
| 152 | 3300010375 | Ga0105239_10087534 | Ga0105239_100875342 | 351 |
| 153 | 3300013105 | Ga0157369_10352190 | Ga0157369_103521902 | 351 |
| 154 | 3300013296 | Ga0157374_10093178 | Ga0157374_100931782 | 351 |
| 155 | 3300025261 | Ga0209233_1001156 | Ga0209233_10011564 | 351 |
| 156 | 3300025903 | Ga0207680_10057392 | Ga0207680_100573923 | 351 |
| 157 | 3300025904 | Ga0207647_10000019 | Ga0207647_100000193 | 351 |
| 158 | 3300025913 | Ga0207695_10000014 | Ga0207695_10000014293 | 351 |
| 159 | 3300025913 | Ga0207695_10015627 | Ga0207695_100156274 | 351 |
| 160 | 3300025924 | Ga0207694_10000266 | Ga0207694_100002668 | 351 |
| 161 | 3300025924 | Ga0207694_10003489 | Ga0207694_100034894 | 351 |
| 162 | 3300025925 | Ga0207650_10241726 | Ga0207650_102417261 | 351 |
| 163 | 3300025933 | Ga0207706_10006488 | Ga0207706_100064883 | 351 |
| 164 | 3300025949 | Ga0207667_10209842 | Ga0207667_102098422 | 351 |
| 165 | 3300025961 | Ga0207712_10000325 | Ga0207712_1000032536 | 351 |
| 166 | 3300025986 | Ga0207658_10014107 | Ga0207658_100141073 | 351 |
| 167 | 3300025986 | Ga0207658_10089892 | Ga0207658_100898922 | 351 |
| 168 | 3300026041 | Ga0207639_10000163 | Ga0207639_1000016322 | 351 |
| 169 | 3300026067 | Ga0207678_10029901 | Ga0207678_100299013 | 351 |
| 170 | 3300026116 | Ga0207674_10032448 | Ga0207674_100324484 | 351 |
| 171 | 3300026142 | Ga0207698_10095823 | Ga0207698_100958233 | 351 |
| 172 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007566 | 351 |
| 173 | 3300030732 | Ga0316176_1221853 | Ga0316176_12218532 | 351 |
| 174 | 3300030733 | Ga0314311_1090877 | Ga0314311_10908772 | 351 |
| 175 | 3300030735 | Ga0316178_1091317 | Ga0316178_10913172 | 351 |
| 176 | 3300031090 | Ga0265760_10000100 | Ga0265760_1000010017 | 351 |
| 177 | 3300031730 | Ga0307516_10000190 | Ga0307516_1000019059 | 351 |
| 178 | 3300048921 | Ga0496118_0094084 | Ga0496118_0094084_615_1670 | 351 |
| 179 | 3300049571 | Ga0501034_0012615 | Ga0501034_0012615_2256_3329 | 351 |
| 180 | 3300049572 | Ga0501036_0031544 | Ga0501036_0031544_858_1931 | 351 |
| 181 | 3300049574 | Ga0501038_0006069 | Ga0501038_0006069_837_1910 | 351 |
| 182 | 3300049579 | Ga0501043_0097435 | Ga0501043_0097435_759_1832 | 351 |
| 183 | 3300049581 | Ga0501047_0007429 | Ga0501047_0007429_4467_5540 | 351 |
| 184 | 3300049583 | Ga0501067_0001270 | Ga0501067_0001270_3373_4446 | 351 |
| 185 | 3300049584 | Ga0501068_0014727 | Ga0501068_0014727_3305_4378 | 351 |
| 186 | 3300049585 | Ga0501069_0003501 | Ga0501069_0003501_6537_7610 | 351 |
| 187 | 3300049586 | Ga0501070_0022531 | Ga0501070_0022531_2768_3841 | 351 |
| 188 | 3300049588 | Ga0501072_0001569 | Ga0501072_0001569_14951_16024 | 351 |
| 189 | 3300049589 | Ga0501073_0034902 | Ga0501073_0034902_908_1981 | 351 |
| 190 | 3300049589 | Ga0501073_0046859 | Ga0501073_0046859_515_1588 | 351 |
| 191 | 3300049741 | Ga0501079_0029545 | Ga0501079_0029545_2619_3692 | 351 |
| 192 | 3300049742 | Ga0501080_0015701 | Ga0501080_0015701_482_1555 | 351 |
| 193 | 3300049823 | Ga0501044_0006953 | Ga0501044_0006953_10465_11538 | 351 |
| 194 | 3300049823 | Ga0501044_0063762 | Ga0501044_0063762_165_1238 | 351 |
| 195 | 3300009177 | Ga0105248_10006836 | Ga0105248_1000683611 | 352 |
| 196 | 3300013308 | Ga0157375_10002283 | Ga0157375_1000228311 | 352 |
| 197 | 3300025941 | Ga0207711_10017624 | Ga0207711_100176244 | 352 |
| 198 | 3300028379 | Ga0268266_10184197 | Ga0268266_101841971 | 352 |
| 199 | 3300041460 | Ga0451802_0739338 | Ga0451802_0739338_1430_2491 | 352 |
| 200 | 3300041463 | Ga0451804_0627905 | Ga0451804_0627905_158_1216 | 352 |
| 201 | 3300044658 | Ga0466972_0005412 | Ga0466972_0005412_4244_5302 | 352 |
| 202 | 3300044765 | Ga0466970_0001519 | Ga0466970_0001519_5913_6971 | 352 |
| 203 | 3300049581 | Ga0501047_0247068 | Ga0501047_0247068_305_1369 | 352 |
| 204 | 3300049822 | Ga0501035_0124845 | Ga0501035_0124845_1131_2195 | 352 |
| 205 | 3300053079 | Ga0500610_0000128 | Ga0500610_0000128_18731_19792 | 352 |
| 206 | 3300053093 | Ga0500651_0002661 | Ga0500651_0002661_5360_6421 | 352 |
| 207 | 3300031665 | Ga0316575_10000051 | Ga0316575_100000517 | 353 |
| 208 | 3300031727 | Ga0316576_10014425 | Ga0316576_100144252 | 353 |
| 209 | 3300031727 | Ga0316576_10042389 | Ga0316576_100423893 | 353 |
| 210 | 3300032139 | Ga0316580_10038882 | Ga0316580_100388822 | 353 |
| 211 | 3300035398 | Ga0316574_0082856 | Ga0316574_0082856_486_1547 | 353 |
| 212 | 3300046513 | Ga0495616_0000926 | Ga0495616_0000926_8710_9774 | 353 |
| 213 | 3300046523 | Ga0495644_0000046 | Ga0495644_0000046_44504_45568 | 353 |
| 214 | 3300046648 | Ga0495611_0035101 | Ga0495611_0035101_491_1555 | 353 |
| 215 | 3300046665 | Ga0495661_0013022 | Ga0495661_0013022_2116_3180 | 353 |
| 216 | 3300046692 | Ga0495671_0001609 | Ga0495671_0001609_8696_9760 | 353 |
| 217 | 3300047673 | Ga0495593_0001336 | Ga0495593_0001336_12506_13570 | 353 |
| 218 | 3300053119 | Ga0500595_005786 | Ga0500595_005786_3908_4996 | 353 |
| 219 | 3300002737 | JGI25162J39368_1000566 | JGI25162J39368_10005667 | 354 |
| 220 | 3300002771 | JGI25163J39215_1000154 | JGI25163J39215_100015419 | 354 |
| 221 | 3300002772 | JGI25164J39214_1000364 | JGI25164J39214_10003647 | 354 |
| 222 | 3300003751 | Ga0055538_1000270 | Ga0055538_10002707 | 354 |
| 223 | 3300003752 | Ga0055539_1000298 | Ga0055539_10002987 | 354 |
| 224 | 3300003756 | Ga0055533_1000280 | Ga0055533_10002807 | 354 |
| 225 | 3300003759 | Ga0055525_1000404 | Ga0055525_10004047 | 354 |
| 226 | 3300003841 | Ga0055541_1000193 | Ga0055541_10001937 | 354 |
| 227 | 3300003856 | Ga0058692_1000726 | Ga0058692_10007269 | 354 |
| 228 | 3300003856 | Ga0058692_1006413 | Ga0058692_10064132 | 354 |
| 229 | 3300005289 | Ga0065704_10000027 | Ga0065704_100000276 | 354 |
| 230 | 3300005289 | Ga0065704_10091977 | Ga0065704_100919772 | 354 |
| 231 | 3300005331 | Ga0070670_100000134 | Ga0070670_10000013435 | 354 |
| 232 | 3300005355 | Ga0070671_100000231 | Ga0070671_1000002313 | 354 |
| 233 | 3300005365 | Ga0070688_100001631 | Ga0070688_1000016312 | 354 |
| 234 | 3300005367 | Ga0070667_100000060 | Ga0070667_100000060123 | 354 |
| 235 | 3300005466 | Ga0070685_10000063 | Ga0070685_1000006345 | 354 |
| 236 | 3300005548 | Ga0070665_100009514 | Ga0070665_10000951411 | 354 |
| 237 | 3300005618 | Ga0068864_100000143 | Ga0068864_10000014334 | 354 |
| 238 | 3300005841 | Ga0068863_100367995 | Ga0068863_1003679951 | 354 |
| 239 | 3300005844 | Ga0068862_100000759 | Ga0068862_10000075918 | 354 |
| 240 | 3300006051 | Ga0075364_10012642 | Ga0075364_100126422 | 354 |
| 241 | 3300009036 | Ga0105244_10002890 | Ga0105244_1000289010 | 354 |
| 242 | 3300009036 | Ga0105244_10006262 | Ga0105244_100062622 | 354 |
| 243 | 3300009092 | Ga0105250_10001252 | Ga0105250_100012525 | 354 |
| 244 | 3300009177 | Ga0105248_10079779 | Ga0105248_100797792 | 354 |
| 245 | 3300009177 | Ga0105248_10081332 | Ga0105248_100813324 | 354 |
| 246 | 3300009553 | Ga0105249_10026196 | Ga0105249_100261963 | 354 |
| 247 | 3300013100 | Ga0157373_10000898 | Ga0157373_1000089811 | 354 |
| 248 | 3300013100 | Ga0157373_10012564 | Ga0157373_100125643 | 354 |
| 249 | 3300013102 | Ga0157371_10003217 | Ga0157371_100032178 | 354 |
| 250 | 3300013102 | Ga0157371_10007769 | Ga0157371_100077697 | 354 |
| 251 | 3300013104 | Ga0157370_10004164 | Ga0157370_1000416410 | 354 |
| 252 | 3300013306 | Ga0163162_10023502 | Ga0163162_100235024 | 354 |
| 253 | 3300013307 | Ga0157372_10015544 | Ga0157372_100155444 | 354 |
| 254 | 3300013307 | Ga0157372_10683192 | Ga0157372_106831921 | 354 |
| 255 | 3300014325 | Ga0163163_10000604 | Ga0163163_100006046 | 354 |
| 256 | 3300025207 | Ga0209760_100180 | Ga0209760_10018029 | 354 |
| 257 | 3300025224 | Ga0209784_100291 | Ga0209784_10029118 | 354 |
| 258 | 3300025225 | Ga0209566_100498 | Ga0209566_10049818 | 354 |
| 259 | 3300025226 | Ga0209674_100342 | Ga0209674_10034218 | 354 |
| 260 | 3300025230 | Ga0209563_100230 | Ga0209563_10023018 | 354 |
| 261 | 3300025231 | Ga0207427_100370 | Ga0207427_10037018 | 354 |
| 262 | 3300025233 | Ga0209437_100515 | Ga0209437_10051518 | 354 |
| 263 | 3300025253 | Ga0209677_100373 | Ga0209677_10037318 | 354 |
| 264 | 3300025261 | Ga0209233_1001153 | Ga0209233_10011535 | 354 |
| 265 | 3300025711 | Ga0207696_1000599 | Ga0207696_100059918 | 354 |
| 266 | 3300025728 | Ga0207655_1001372 | Ga0207655_10013727 | 354 |
| 267 | 3300025728 | Ga0207655_1001476 | Ga0207655_100147611 | 354 |
| 268 | 3300025900 | Ga0207710_10026563 | Ga0207710_100265632 | 354 |
| 269 | 3300025916 | Ga0207663_10005533 | Ga0207663_100055333 | 354 |
| 270 | 3300025925 | Ga0207650_10000013 | Ga0207650_1000001335 | 354 |
| 271 | 3300025931 | Ga0207644_10000189 | Ga0207644_100001893 | 354 |
| 272 | 3300025941 | Ga0207711_10001271 | Ga0207711_1000127111 | 354 |
| 273 | 3300025941 | Ga0207711_10172713 | Ga0207711_101727132 | 354 |
| 274 | 3300025986 | Ga0207658_10000005 | Ga0207658_1000000536 | 354 |
| 275 | 3300026035 | Ga0207703_10017288 | Ga0207703_100172883 | 354 |
| 276 | 3300026088 | Ga0207641_10161488 | Ga0207641_101614882 | 354 |
| 277 | 3300026088 | Ga0207641_10161820 | Ga0207641_101618202 | 354 |
| 278 | 3300026095 | Ga0207676_10000010 | Ga0207676_10000010133 | 354 |
| 279 | 3300027312 | Ga0209371_1001662 | Ga0209371_10016628 | 354 |
| 280 | 3300027312 | Ga0209371_1001840 | Ga0209371_10018403 | 354 |
| 281 | 3300027312 | Ga0209371_1003747 | Ga0209371_10037475 | 354 |
| 282 | 3300028380 | Ga0268265_10002466 | Ga0268265_1000246612 | 354 |
| 283 | 3300028381 | Ga0268264_10000016 | Ga0268264_10000016116 | 354 |
| 284 | 3300030500 | Ga0268256_1001372 | Ga0268256_10013723 | 354 |
| 285 | 3300030500 | Ga0268256_1001452 | Ga0268256_10014528 | 354 |
| 286 | 3300031665 | Ga0316575_10012637 | Ga0316575_100126372 | 354 |
| 287 | 3300031665 | Ga0316575_10067263 | Ga0316575_100672632 | 354 |
| 288 | 3300031665 | Ga0316575_10082251 | Ga0316575_100822511 | 354 |
| 289 | 3300031691 | Ga0316579_10084283 | Ga0316579_100842831 | 354 |
| 290 | 3300031691 | Ga0316579_10108144 | Ga0316579_101081442 | 354 |
| 291 | 3300031727 | Ga0316576_10008101 | Ga0316576_100081013 | 354 |
| 292 | 3300031727 | Ga0316576_10077121 | Ga0316576_100771212 | 354 |
| 293 | 3300031727 | Ga0316576_10084281 | Ga0316576_100842812 | 354 |
| 294 | 3300031728 | Ga0316578_10027083 | Ga0316578_100270833 | 354 |
| 295 | 3300031728 | Ga0316578_10035851 | Ga0316578_100358511 | 354 |
| 296 | 3300031728 | Ga0316578_10068659 | Ga0316578_100686592 | 354 |
| 297 | 3300031728 | Ga0316578_10126078 | Ga0316578_101260782 | 354 |
| 298 | 3300031733 | Ga0316577_10054280 | Ga0316577_100542802 | 354 |
| 299 | 3300031733 | Ga0316577_10102007 | Ga0316577_101020072 | 354 |
| 300 | 3300031733 | Ga0316577_10153290 | Ga0316577_101532901 | 354 |
| 301 | 3300032133 | Ga0316583_10005530 | Ga0316583_100055303 | 354 |
| 302 | 3300032133 | Ga0316583_10006953 | Ga0316583_100069532 | 354 |
| 303 | 3300032137 | Ga0316585_10007267 | Ga0316585_100072672 | 354 |
| 304 | 3300032139 | Ga0316580_10016626 | Ga0316580_100166262 | 354 |
| 305 | 3300032139 | Ga0316580_10025766 | Ga0316580_100257662 | 354 |
| 306 | 3300032168 | Ga0316593_10005279 | Ga0316593_100052792 | 354 |
| 307 | 3300032168 | Ga0316593_10011839 | Ga0316593_100118392 | 354 |
| 308 | 3300033541 | Ga0316596_1012956 | Ga0316596_10129563 | 354 |
| 309 | 3300035111 | Ga0373923_0035770 | Ga0373923_0035770_60_1130 | 354 |
| 310 | 3300035398 | Ga0316574_0000270 | Ga0316574_0000270_211_1275 | 354 |
| 311 | 3300035398 | Ga0316574_0004818 | Ga0316574_0004818_5304_6395 | 354 |
| 312 | 3300035398 | Ga0316574_0005363 | Ga0316574_0005363_5401_6465 | 354 |
| 313 | 3300035398 | Ga0316574_0006891 | Ga0316574_0006891_1460_2524 | 354 |
| 314 | 3300035398 | Ga0316574_0026925 | Ga0316574_0026925_1977_3041 | 354 |
| 315 | 3300035398 | Ga0316574_0032325 | Ga0316574_0032325_1438_2661 | 354 |
| 316 | 3300035398 | Ga0316574_0039020 | Ga0316574_0039020_766_1836 | 354 |
| 317 | 3300035398 | Ga0316574_0040871 | Ga0316574_0040871_664_1728 | 354 |
| 318 | 3300035398 | Ga0316574_0045547 | Ga0316574_0045547_1343_2410 | 354 |
| 319 | 3300035398 | Ga0316574_0046486 | Ga0316574_0046486_1087_2151 | 354 |
| 320 | 3300035398 | Ga0316574_0066276 | Ga0316574_0066276_739_1803 | 354 |
| 321 | 3300035398 | Ga0316574_0092426 | Ga0316574_0092426_684_1748 | 354 |
| 322 | 3300035398 | Ga0316574_0092721 | Ga0316574_0092721_845_1909 | 354 |
| 323 | 3300035398 | Ga0316574_0149819 | Ga0316574_0149819_82_1149 | 354 |
| 324 | 3300035692 | Ga0373935_0074322 | Ga0373935_0074322_769_1839 | 354 |
| 325 | 3300036647 | Ga0316582_0002393 | Ga0316582_0002393_6667_7731 | 354 |
| 326 | 3300036647 | Ga0316582_0002498 | Ga0316582_0002498_2240_3331 | 354 |
| 327 | 3300036647 | Ga0316582_0004149 | Ga0316582_0004149_5605_6732 | 354 |
| 328 | 3300036647 | Ga0316582_0010549 | Ga0316582_0010549_276_1340 | 354 |
| 329 | 3300036647 | Ga0316582_0080842 | Ga0316582_0080842_518_1582 | 354 |
| 330 | 3300036647 | Ga0316582_0083390 | Ga0316582_0083390_665_1888 | 354 |
| 331 | 3300036647 | Ga0316582_0142700 | Ga0316582_0142700_351_1415 | 354 |
| 332 | 3300036712 | Ga0316584_0018251 | Ga0316584_0018251_1594_2658 | 354 |
| 333 | 3300036712 | Ga0316584_0053724 | Ga0316584_0053724_961_2028 | 354 |
| 334 | 3300036712 | Ga0316584_0158285 | Ga0316584_0158285_438_1502 | 354 |
| 335 | 3300036712 | Ga0316584_0176386 | Ga0316584_0176386_365_1429 | 354 |
| 336 | 3300037588 | Ga0316581_0004787 | Ga0316581_0004787_863_1927 | 354 |
| 337 | 3300037588 | Ga0316581_0005309 | Ga0316581_0005309_2072_3136 | 354 |
| 338 | 3300037588 | Ga0316581_0037851 | Ga0316581_0037851_35_1105 | 354 |
| 339 | 3300038741 | Ga0400488_05079 | Ga0400488_05079_1454_2518 | 354 |
| 340 | 3300039062 | Ga0400483_094960 | Ga0400483_094960_284_1348 | 354 |
| 341 | 3300039062 | Ga0400483_154898 | Ga0400483_154898_3365_4429 | 354 |
| 342 | 3300039093 | Ga0400489_63367 | Ga0400489_63367_1220_2284 | 354 |
| 343 | 3300041405 | Ga0439438_000065 | Ga0439438_000065_42631_43698 | 354 |
| 344 | 3300041407 | Ga0439447_004811 | Ga0439447_004811_575_1642 | 354 |
| 345 | 3300042006 | Ga0439432_002070 | Ga0439432_002070_2481_3548 | 354 |
| 346 | 3300042006 | Ga0439432_044414 | Ga0439432_044414_318_1382 | 354 |
| 347 | 3300042156 | Ga0439446_0000058 | Ga0439446_0000058_12939_14039 | 354 |
| 348 | 3300042184 | Ga0450908_012249 | Ga0450908_012249_128_1228 | 354 |
| 349 | 3300042435 | Ga0439434_0002716 | Ga0439434_0002716_3559_4659 | 354 |
| 350 | 3300044712 | Ga0453684_0002985 | Ga0453684_0002985_20671_21747 | 354 |
| 351 | 3300044712 | Ga0453684_0062154 | Ga0453684_0062154_767_1891 | 354 |
| 352 | 3300046458 | Ga0495591_000637 | Ga0495591_000637_18936_20003 | 354 |
| 353 | 3300046471 | Ga0495650_0001197 | Ga0495650_0001197_20071_21186 | 354 |
| 354 | 3300046519 | Ga0495632_0041976 | Ga0495632_0041976_170_1234 | 354 |
| 355 | 3300046530 | Ga0495654_0000715 | Ga0495654_0000715_5947_7014 | 354 |
| 356 | 3300046616 | Ga0495668_0024298 | Ga0495668_0024298_490_1557 | 354 |
| 357 | 3300046810 | Ga0495660_0000474 | Ga0495660_0000474_26109_27173 | 354 |
| 358 | 3300048903 | Ga0496100_0050729 | Ga0496100_0050729_1169_2236 | 354 |
| 359 | 3300048903 | Ga0496100_0054672 | Ga0496100_0054672_1522_2592 | 354 |
| 360 | 3300048904 | Ga0496101_0000454 | Ga0496101_0000454_19046_20113 | 354 |
| 361 | 3300048907 | Ga0496104_0002509 | Ga0496104_0002509_8785_9900 | 354 |
| 362 | 3300048907 | Ga0496104_0290433 | Ga0496104_0290433_461_1531 | 354 |
| 363 | 3300048908 | Ga0496105_0026392 | Ga0496105_0026392_1145_2215 | 354 |
| 364 | 3300048910 | Ga0496107_0095624 | Ga0496107_0095624_485_1555 | 354 |
| 365 | 3300048919 | Ga0496116_0001114 | Ga0496116_0001114_6045_7112 | 354 |
| 366 | 3300048919 | Ga0496116_0002300 | Ga0496116_0002300_6299_7363 | 354 |
| 367 | 3300048919 | Ga0496116_0007635 | Ga0496116_0007635_2836_3903 | 354 |
| 368 | 3300048920 | Ga0496117_0008738 | Ga0496117_0008738_1207_2274 | 354 |
| 369 | 3300048920 | Ga0496117_0010355 | Ga0496117_0010355_132_1196 | 354 |
| 370 | 3300048921 | Ga0496118_0000101 | Ga0496118_0000101_66191_67258 | 354 |
| 371 | 3300048921 | Ga0496118_0005889 | Ga0496118_0005889_4657_5721 | 354 |
| 372 | 3300048922 | Ga0496119_0005956 | Ga0496119_0005956_4271_5338 | 354 |
| 373 | 3300048922 | Ga0496119_0009753 | Ga0496119_0009753_2737_3804 | 354 |
| 374 | 3300048922 | Ga0496119_0010782 | Ga0496119_0010782_2264_3328 | 354 |
| 375 | 3300048923 | Ga0496120_0002042 | Ga0496120_0002042_6049_7116 | 354 |
| 376 | 3300048923 | Ga0496120_0003605 | Ga0496120_0003605_10577_11641 | 354 |
| 377 | 3300048923 | Ga0496120_0007439 | Ga0496120_0007439_1244_2311 | 354 |
| 378 | 3300048925 | Ga0496122_0002332 | Ga0496122_0002332_6227_7291 | 354 |
| 379 | 3300048925 | Ga0496122_0009974 | Ga0496122_0009974_3926_4993 | 354 |
| 380 | 3300048926 | Ga0496123_0003414 | Ga0496123_0003414_6227_7291 | 354 |
| 381 | 3300048926 | Ga0496123_0147090 | Ga0496123_0147090_187_1254 | 354 |
| 382 | 3300048927 | Ga0496124_0002542 | Ga0496124_0002542_2516_3580 | 354 |
| 383 | 3300048927 | Ga0496124_0009961 | Ga0496124_0009961_5908_6975 | 354 |
| 384 | 3300048927 | Ga0496124_0064328 | Ga0496124_0064328_558_1625 | 354 |
| 385 | 3300048928 | Ga0496125_0002049 | Ga0496125_0002049_6082_7146 | 354 |
| 386 | 3300048928 | Ga0496125_0050993 | Ga0496125_0050993_1444_2511 | 354 |
| 387 | 3300048929 | Ga0496126_0002654 | Ga0496126_0002654_2556_3620 | 354 |
| 388 | 3300048929 | Ga0496126_0064697 | Ga0496126_0064697_279_1346 | 354 |
| 389 | 3300049570 | Ga0501033_0001414 | Ga0501033_0001414_7664_8737 | 354 |
| 390 | 3300049572 | Ga0501036_0007237 | Ga0501036_0007237_4433_5506 | 354 |
| 391 | 3300049573 | Ga0501037_0006148 | Ga0501037_0006148_1608_2681 | 354 |
| 392 | 3300049574 | Ga0501038_0000645 | Ga0501038_0000645_13101_14174 | 354 |
| 393 | 3300049575 | Ga0501039_0000959 | Ga0501039_0000959_10187_11260 | 354 |
| 394 | 3300049579 | Ga0501043_0007367 | Ga0501043_0007367_6089_7162 | 354 |
| 395 | 3300049580 | Ga0501046_0006636 | Ga0501046_0006636_5408_6481 | 354 |
| 396 | 3300049583 | Ga0501067_0029677 | Ga0501067_0029677_837_1910 | 354 |
| 397 | 3300049586 | Ga0501070_0095366 | Ga0501070_0095366_331_1404 | 354 |
| 398 | 3300049587 | Ga0501071_0061805 | Ga0501071_0061805_1478_2551 | 354 |
| 399 | 3300049590 | Ga0501074_0016701 | Ga0501074_0016701_1256_2329 | 354 |
| 400 | 3300049742 | Ga0501080_0008075 | Ga0501080_0008075_1142_2215 | 354 |
| 401 | 3300049744 | Ga0501083_0160239 | Ga0501083_0160239_157_1230 | 354 |
| 402 | 3300053099 | Ga0500654_109100 | Ga0500654_109100_48_1115 | 354 |
| 403 | 3300053138 | Ga0500564_018038 | Ga0500564_018038_1610_2674 | 354 |
| 404 | 3300060353 | Ga0501082_0078733 | Ga0501082_0078733_1146_2219 | 354 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cyv-assembly1.cif.gz_A-2 | crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism | 0.9893 | 3 | 354 |
| 4wsh-assembly1.cif.gz_B | crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa | 0.9869 | 4 | 354 |
| 3cyv-assembly1.cif.gz_A-2 | crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism | 0.9866 | 3 | 354 |
| 4wsh-assembly1.cif.gz_A | crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa | 0.9863 | 1 | 354 |
| 4zr8-assembly1.cif.gz_B | structure of uroporphyrinogen decarboxylase from acinetobacter baumannii | 0.9836 | 4 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4wshB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9869 | 4 | 354 | 3.20.20.210 |
| 4wshB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9813 | 4 | 354 | 3.20.20.210 |
| af_C6TEE8_35_387_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9664 | 9 | 347 | 3.20.20.210 |
| 2ejaB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9531 | 5 | 345 | 3.20.20.210 |
| 1r3sA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9514 | 3 | 354 | 3.20.20.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447N066-F1-model_v4 | Uroporphyrinogen decarboxylase (EC 4.1.1.37) | 1.004 | 186 | 278 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A2X3FQ44-F1-model_v4 | Uroporphyrinogen III decarboxylase (EC 4.1.1.37) | 1.003 | 170 | 283 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A377XGI2-F1-model_v4 | Uroporphyrinogen III decarboxylase (EC 4.1.1.37) | 1.002 | 126 | 244 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A354XGL7-F1-model_v4 | Uroporphyrinogen decarboxylase (EC 4.1.1.37) | 1.001 | 79 | 230 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A6D0F9G1-F1-model_v4 | deleted | 1 | 112 | 316 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar