F435675

General Info

Members Datasets Scaffolds Average Seq Length
404 234 395 352

Family's Representative Sequence

Representative Sequence 3300015679|Ga0183366_1010|Ga0183366_101021
Length 329
Sequence MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGDFMSLCKNAELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFTSPIKSKADVDKLPIPDPEGELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKAFTLIKKMMYAEPLALHMIFDTWGGVLTGRDYQQFSLYYMHKIVDGLLRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIADARRRVGDKVALQGNMDPSMLYAPPARIEEEVSTILSGFGQGEGHVFNLGHGIHQDVPPEHAGVFVEAVHRLSAQYHK

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
3 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
4 2876601092 Pantoea endophytica 596 Isolate Unclassified
5 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
6 2919150387 Rahnella aceris 1817 Isolate Unclassified
7 2927143783 Rahnella sp. 2050 Isolate Unclassified
8 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
81 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
82 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
83 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
84 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
85 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
134 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
135 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
136 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
140 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
154 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
155 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
156 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
157 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
158 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
159 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
160 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
161 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
162 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
163 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
231 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
232 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.99
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.94
Nodule 0
Rhizoplane 2.97
Rhizosphere 81.68
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000566 3300002737 Bacteria 27108
2 JGI25163J39215_1000154 3300002771 Bacteria 27108
3 JGI25164J39214_1000364 3300002772 Bacteria 27108
4 Ga0055538_1000270 3300003751 Bacteria 27108
5 Ga0055539_1000298 3300003752 Bacteria 27108
6 Ga0055533_1000280 3300003756 Bacteria 27108
7 Ga0055525_1000404 3300003759 Bacteria 27108
8 Ga0055541_1000193 3300003841 Bacteria 27108
9 Ga0058692_1000726 3300003856 Bacteria 13425
10 Ga0058692_1006413 3300003856 Bacteria 3239
11 Ga0065704_10000027 3300005289 Bacteria 15467
12 Ga0065704_10091977 3300005289 Bacteria 2682
13 Ga0070658_10069153 3300005327 Bacteria 2888
14 Ga0070658_10293498 3300005327 Bacteria 1386
15 Ga0070676_10068834 3300005328 Bacteria 2120
16 Ga0070670_100000134 3300005331 Bacteria 69571
17 Ga0068869_100027409 3300005334 Bacteria 3972
18 Ga0070666_10001051 3300005335 Bacteria 16889
19 Ga0070666_10035201 3300005335 Bacteria 3320
20 Ga0068868_100096707 3300005338 Bacteria 2385
21 Ga0070660_100218842 3300005339 Bacteria 1547
22 Ga0070661_100009642 3300005344 Bacteria 6692
23 Ga0070661_100082840 3300005344 Bacteria 2369
24 Ga0070668_100128698 3300005347 Bacteria 2030
25 Ga0070669_100019050 3300005353 Bacteria 4906
26 Ga0070675_100119371 3300005354 Bacteria 2240
27 Ga0070671_100000231 3300005355 Bacteria 37362
28 Ga0070671_100125067 3300005355 Bacteria 2165
29 Ga0070688_100001631 3300005365 Bacteria 11236
30 Ga0070667_100000060 3300005367 Bacteria 145801
31 Ga0070667_100044506 3300005367 Bacteria 3728
32 Ga0070667_100046924 3300005367 Bacteria 3634
33 Ga0070678_100005981 3300005456 Bacteria 7090
34 Ga0070662_100068767 3300005457 Bacteria 2604
35 Ga0068867_100090549 3300005459 Bacteria 2321
36 Ga0068867_100303126 3300005459 Bacteria 1318
37 Ga0070685_10000063 3300005466 Bacteria 62658
38 Ga0070685_10001527 3300005466 Bacteria 12204
39 Ga0070698_100332811 3300005471 Bacteria 1450
40 Ga0070679_100355805 3300005530 Bacteria 1412
41 Ga0068853_100007334 3300005539 Bacteria 8826
42 Ga0070696_100004921 3300005546 Bacteria 8917
43 Ga0070665_100002146 3300005548 Bacteria 22025
44 Ga0070665_100009514 3300005548 Bacteria 9828
45 Ga0070665_100186910 3300005548 Bacteria 2073
46 Ga0070665_100358266 3300005548 Bacteria 1464
47 Ga0068855_100025019 3300005563 Bacteria 7145
48 Ga0070664_100299188 3300005564 Bacteria 1454
49 Ga0070664_100318097 3300005564 Bacteria 1409
50 Ga0068857_100388233 3300005577 Bacteria 1297
51 Ga0068854_100003283 3300005578 Bacteria 10078
52 Ga0068854_100008791 3300005578 Bacteria 6499
53 Ga0068854_100367575 3300005578 Bacteria 1182
54 Ga0068856_100009925 3300005614 Bacteria 9249
55 Ga0068856_100122535 3300005614 Bacteria 2602
56 Ga0068852_100004195 3300005616 Bacteria 10157
57 Ga0068852_100024140 3300005616 Bacteria 4909
58 Ga0068852_100159911 3300005616 Bacteria 2102
59 Ga0068864_100000143 3300005618 Bacteria 69296
60 Ga0068851_10010948 3300005834 Bacteria 4242
61 Ga0068851_10018942 3300005834 Bacteria 3322
62 Ga0068870_10086639 3300005840 Bacteria 1743
63 Ga0068863_100051902 3300005841 Bacteria 3886
64 Ga0068863_100367995 3300005841 Bacteria 1402
65 Ga0068862_100000759 3300005844 Bacteria 32206
66 Ga0075364_10012642 3300006051 Bacteria 5170
67 Ga0097621_100037304 3300006237 Bacteria 3893
68 Ga0097621_100162481 3300006237 Bacteria 1920
69 Ga0068871_100015289 3300006358 Bacteria 5740
70 Ga0068865_100011849 3300006881 Bacteria 5470
71 Ga0068865_100018995 3300006881 Bacteria 4444
72 Ga0068865_100026705 3300006881 Bacteria 3808
73 Ga0099795_10017290 3300007788 Bacteria 2297
74 Ga0105244_10002890 3300009036 Bacteria 12697
75 Ga0105244_10006262 3300009036 Bacteria 7748
76 Ga0105250_10001252 3300009092 Bacteria 14068
77 Ga0105240_10018746 3300009093 Bacteria 9272
78 Ga0105240_10047885 3300009093 Bacteria 5406
79 Ga0105240_10073068 3300009093 Bacteria 4236
80 Ga0105245_10080781 3300009098 Bacteria 2971
81 Ga0105241_10005103 3300009174 Bacteria 9685
82 Ga0105241_10205479 3300009174 Bacteria 1647
83 Ga0105242_10040028 3300009176 Bacteria 3775
84 Ga0105242_10041552 3300009176 Bacteria 3709
85 Ga0105248_10006836 3300009177 Bacteria 12503
86 Ga0105248_10079779 3300009177 Bacteria 3678
87 Ga0105248_10081332 3300009177 Bacteria 3641
88 Ga0105237_10042108 3300009545 Bacteria 4606
89 Ga0105238_10001884 3300009551 Bacteria 21060
90 Ga0105238_10003883 3300009551 Bacteria 14834
91 Ga0105238_10004857 3300009551 Bacteria 13302
92 Ga0105238_10124658 3300009551 Bacteria 2555
93 Ga0105249_10026196 3300009553 Bacteria 5252
94 Ga0105239_10005085 3300010375 Bacteria 15526
95 Ga0105239_10008615 3300010375 Bacteria 11564
96 Ga0105239_10042053 3300010375 Bacteria 5007
97 Ga0105239_10087534 3300010375 Bacteria 3434
98 Ga0157373_10000898 3300013100 Bacteria 23045
99 Ga0157373_10012564 3300013100 Bacteria 6224
100 Ga0157371_10003217 3300013102 Bacteria 14984
101 Ga0157371_10007769 3300013102 Bacteria 8621
102 Ga0157370_10004164 3300013104 Bacteria 16737
103 Ga0157370_10179263 3300013104 Bacteria 1969
104 Ga0157369_10006998 3300013105 Bacteria 13013
105 Ga0157369_10352190 3300013105 Bacteria 1529
106 Ga0157374_10093178 3300013296 Bacteria 2876
107 Ga0157378_10000322 3300013297 Bacteria 47146
108 Ga0163162_10017677 3300013306 Bacteria 6977
109 Ga0163162_10023502 3300013306 Bacteria 6083
110 Ga0163162_10077131 3300013306 Bacteria 3396
111 Ga0157372_10003066 3300013307 Bacteria 18004
112 Ga0157372_10015544 3300013307 Bacteria 8157
113 Ga0157372_10683192 3300013307 Bacteria 1195
114 Ga0157375_10002283 3300013308 Bacteria 16584
115 Ga0157375_10115091 3300013308 Bacteria 2792
116 Ga0157375_10129791 3300013308 Bacteria 2639
117 Ga0163163_10000404 3300014325 Bacteria 40714
118 Ga0163163_10000604 3300014325 Bacteria 31347
119 Ga0157376_10002810 3300014969 Bacteria 11896
120 Ga0183366_1010 3300015679 Bacteria 29263
121 Ga0183370_1010 3300015680 Bacteria 29263
122 Ga0183369_1025 3300015685 Bacteria 29263
123 Ga0183368_1013 3300015687 Bacteria 29263
124 Ga0209760_100180 3300025207 Bacteria 33283
125 Ga0209784_100291 3300025224 Bacteria 27389
126 Ga0209566_100498 3300025225 Bacteria 27389
127 Ga0209674_100342 3300025226 Bacteria 27389
128 Ga0209563_100230 3300025230 Bacteria 27389
129 Ga0207427_100370 3300025231 Bacteria 27389
130 Ga0209437_100515 3300025233 Bacteria 27389
131 Ga0209677_100373 3300025253 Bacteria 27389
132 Ga0209233_1001153 3300025261 Bacteria 10740
133 Ga0209233_1001156 3300025261 Bacteria 10712
134 Ga0207696_1000599 3300025711 Bacteria 27115
135 Ga0207655_1001372 3300025728 Bacteria 22808
136 Ga0207655_1001476 3300025728 Bacteria 21609
137 Ga0207710_10026563 3300025900 Bacteria 2503
138 Ga0207680_10000218 3300025903 Bacteria 27690
139 Ga0207680_10057392 3300025903 Bacteria 2355
140 Ga0207680_10156488 3300025903 Bacteria 1524
141 Ga0207680_10284459 3300025903 Bacteria 1150
142 Ga0207647_10000019 3300025904 Bacteria 123924
143 Ga0207647_10004212 3300025904 Bacteria 10668
144 Ga0207645_10010692 3300025907 Bacteria 6293
145 Ga0207705_10053924 3300025909 Bacteria 2898
146 Ga0207654_10001464 3300025911 Bacteria 12504
147 Ga0207654_10095827 3300025911 Bacteria 1818
148 Ga0207695_10000014 3300025913 Bacteria 812599
149 Ga0207695_10000330 3300025913 Bacteria 113210
150 Ga0207695_10015627 3300025913 Bacteria 8929
151 Ga0207671_10006159 3300025914 Bacteria 10779
152 Ga0207671_10153568 3300025914 Bacteria 1780
153 Ga0207663_10005533 3300025916 Bacteria 6372
154 Ga0207657_10004311 3300025919 Bacteria 15074
155 Ga0207649_10001385 3300025920 Bacteria 14363
156 Ga0207649_10042956 3300025920 Bacteria 2761
157 Ga0207694_10000266 3300025924 Bacteria 49793
158 Ga0207694_10003489 3300025924 Bacteria 12503
159 Ga0207650_10000013 3300025925 Bacteria 409471
160 Ga0207650_10241726 3300025925 Bacteria 1459
161 Ga0207644_10000189 3300025931 Bacteria 44445
162 Ga0207706_10006488 3300025933 Bacteria 10860
163 Ga0207686_10006533 3300025934 Bacteria 6280
164 Ga0207669_10069659 3300025937 Bacteria 2202
165 Ga0207704_10025972 3300025938 Bacteria 3205
166 Ga0207704_10082334 3300025938 Bacteria 2085
167 Ga0207691_10174750 3300025940 Bacteria 1879
168 Ga0207711_10001271 3300025941 Bacteria 23909
169 Ga0207711_10017624 3300025941 Bacteria 5932
170 Ga0207711_10172713 3300025941 Bacteria 1962
171 Ga0207661_10042304 3300025944 Bacteria 3591
172 Ga0207667_10107440 3300025949 Bacteria 2879
173 Ga0207667_10209842 3300025949 Bacteria 1996
174 Ga0207712_10000325 3300025961 Bacteria 43665
175 Ga0207658_10000005 3300025986 Bacteria 408341
176 Ga0207658_10014107 3300025986 Bacteria 5473
177 Ga0207658_10089892 3300025986 Bacteria 2378
178 Ga0207658_10189380 3300025986 Bacteria 1709
179 Ga0207677_10003656 3300026023 Bacteria 8162
180 Ga0207703_10017288 3300026035 Bacteria 5629
181 Ga0207639_10000163 3300026041 Bacteria 51309
182 Ga0207639_10019494 3300026041 Bacteria 4839
183 Ga0207678_10029901 3300026067 Bacteria 4756
184 Ga0207641_10161488 3300026088 Bacteria 2037
185 Ga0207641_10161820 3300026088 Bacteria 2035
186 Ga0207648_10009668 3300026089 Bacteria 9222
187 Ga0207648_10055895 3300026089 Bacteria 3445
188 Ga0207676_10000010 3300026095 Bacteria 519402
189 Ga0207676_10098810 3300026095 Bacteria 2414
190 Ga0207674_10029055 3300026116 Bacteria 5827
191 Ga0207674_10032448 3300026116 Bacteria 5478
192 Ga0207674_10190681 3300026116 Bacteria 1999
193 Ga0207683_10328384 3300026121 Bacteria 1402
194 Ga0207698_10095823 3300026142 Bacteria 2444
195 Ga0209371_1001662 3300027312 Bacteria 14265
196 Ga0209371_1001840 3300027312 Bacteria 13128
197 Ga0209371_1003747 3300027312 Bacteria 7108
198 Ga0268266_10000007 3300028379 Bacteria 1372921
199 Ga0268266_10184197 3300028379 Bacteria 1903
200 Ga0268266_10293240 3300028379 Bacteria 1515
201 Ga0268265_10002466 3300028380 Bacteria 13911
202 Ga0268264_10000016 3300028381 Bacteria 502537
203 Ga0268256_1001372 3300030500 Bacteria 14802
204 Ga0268256_1001452 3300030500 Bacteria 14264
205 Ga0316176_1221853 3300030732 Bacteria 2116
206 Ga0314311_1090877 3300030733 Bacteria 4632
207 Ga0316178_1091317 3300030735 Bacteria 1470
208 Ga0265760_10000100 3300031090 Bacteria 22347
209 Ga0307508_10275890 3300031616 Bacteria 1275
210 Ga0316575_10000051 3300031665 Bacteria 29380
211 Ga0316575_10012637 3300031665 Bacteria 3144
212 Ga0316575_10067263 3300031665 Bacteria 1436
213 Ga0316575_10082251 3300031665 Bacteria 1299
214 Ga0316579_10084283 3300031691 Bacteria 1515
215 Ga0316579_10108144 3300031691 Bacteria 1334
216 Ga0316576_10008101 3300031727 Bacteria 6670
217 Ga0316576_10014425 3300031727 Bacteria 5280
218 Ga0316576_10042389 3300031727 Bacteria 3280
219 Ga0316576_10077121 3300031727 Bacteria 2467
220 Ga0316576_10084281 3300031727 Bacteria 2362
221 Ga0316578_10027083 3300031728 Bacteria 3238
222 Ga0316578_10035851 3300031728 Bacteria 2853
223 Ga0316578_10068659 3300031728 Bacteria 2096
224 Ga0316578_10126078 3300031728 Bacteria 1540
225 Ga0307516_10000190 3300031730 Bacteria 79464
226 Ga0307516_10079815 3300031730 Bacteria 3116
227 Ga0316577_10054280 3300031733 Bacteria 2237
228 Ga0316577_10102007 3300031733 Bacteria 1608
229 Ga0316577_10153290 3300031733 Bacteria 1299
230 Ga0316583_10005530 3300032133 Bacteria 4534
231 Ga0316583_10006953 3300032133 Bacteria 4074
232 Ga0316585_10007267 3300032137 Bacteria 3188
233 Ga0316580_10016626 3300032139 Bacteria 2258
234 Ga0316580_10025766 3300032139 Bacteria 1818
235 Ga0316580_10038882 3300032139 Bacteria 1470
236 Ga0316593_10005279 3300032168 Bacteria 3391
237 Ga0316593_10011839 3300032168 Bacteria 2546
238 Ga0316596_1012956 3300033541 Bacteria 2056
239 Ga0373923_0035770 3300035111 Bacteria 2024
240 Ga0316574_0000270 3300035398 Bacteria 19196
241 Ga0316574_0001146 3300035398 Bacteria 12201
242 Ga0316574_0004818 3300035398 Bacteria 7139
243 Ga0316574_0005363 3300035398 Bacteria 6831
244 Ga0316574_0006891 3300035398 Bacteria 6182
245 Ga0316574_0026925 3300035398 Bacteria 3460
246 Ga0316574_0032325 3300035398 Bacteria 3179
247 Ga0316574_0039020 3300035398 Bacteria 2918
248 Ga0316574_0040871 3300035398 Bacteria 2856
249 Ga0316574_0045547 3300035398 Bacteria 2717
250 Ga0316574_0046486 3300035398 Bacteria 2692
251 Ga0316574_0066276 3300035398 Bacteria 2275
252 Ga0316574_0082856 3300035398 Bacteria 2039
253 Ga0316574_0092426 3300035398 Bacteria 1931
254 Ga0316574_0092721 3300035398 Bacteria 1928
255 Ga0316574_0149819 3300035398 Bacteria 1503
256 Ga0316574_0210551 3300035398 Bacteria 1247
257 Ga0373935_0074322 3300035692 Bacteria 2197
258 Ga0316582_0002393 3300036647 Bacteria 8788
259 Ga0316582_0002498 3300036647 Bacteria 8664
260 Ga0316582_0004149 3300036647 Bacteria 7257
261 Ga0316582_0010549 3300036647 Bacteria 5064
262 Ga0316582_0080842 3300036647 Bacteria 2122
263 Ga0316582_0083390 3300036647 Bacteria 2091
264 Ga0316582_0142700 3300036647 Bacteria 1615
265 Ga0316584_0018251 3300036712 Bacteria 5059
266 Ga0316584_0053724 3300036712 Bacteria 3015
267 Ga0316584_0067970 3300036712 Bacteria 2670
268 Ga0316584_0158285 3300036712 Bacteria 1683
269 Ga0316584_0176386 3300036712 Bacteria 1583
270 Ga0316581_0004787 3300037588 Bacteria 3483
271 Ga0316581_0005309 3300037588 Bacteria 3346
272 Ga0316581_0037851 3300037588 Bacteria 1466
273 Ga0400488_05079 3300038741 Bacteria 2905
274 Ga0400483_094960 3300039062 Bacteria 2748
275 Ga0400483_154898 3300039062 Bacteria 5896
276 Ga0400489_63367 3300039093 Bacteria 11246
277 Ga0439438_000065 3300041405 Bacteria 49586
278 Ga0439447_004811 3300041407 Bacteria 4587
279 Ga0451802_0739338 3300041460 Bacteria 4505
280 Ga0451804_0627905 3300041463 Bacteria 1854
281 Ga0439432_002070 3300042006 Bacteria 7580
282 Ga0439432_044414 3300042006 Bacteria 1400
283 Ga0439446_0000058 3300042156 Bacteria 17452
284 Ga0450908_012249 3300042184 Bacteria 1559
285 Ga0439434_0002716 3300042435 Bacteria 5154
286 Ga0451577_0000084 3300042876 Bacteria 213553
287 Ga0466972_0005412 3300044658 Bacteria 6394
288 Ga0453684_0002985 3300044712 Bacteria 39370
289 Ga0453684_0003652 3300044712 Bacteria 34170
290 Ga0453684_0062154 3300044712 Bacteria 4786
291 Ga0466970_0001519 3300044765 Bacteria 11162
292 Ga0495591_000637 3300046458 Bacteria 25949
293 Ga0495650_0001197 3300046471 Bacteria 27412
294 Ga0495616_0000926 3300046513 Bacteria 21101
295 Ga0495632_0041976 3300046519 Bacteria 2295
296 Ga0495644_0000046 3300046523 Bacteria 59289
297 Ga0495654_0000715 3300046530 Bacteria 25958
298 Ga0495668_0024298 3300046616 Bacteria 3448
299 Ga0495611_0035101 3300046648 Bacteria 2220
300 Ga0495661_0013022 3300046665 Bacteria 5603
301 Ga0495671_0001609 3300046692 Bacteria 14858
302 Ga0495660_0000474 3300046810 Bacteria 33386
303 Ga0495593_0001336 3300047673 Bacteria 14425
304 Ga0496100_0050729 3300048903 Bacteria 2690
305 Ga0496100_0054672 3300048903 Bacteria 2605
306 Ga0496101_0000454 3300048904 Bacteria 26040
307 Ga0496104_0000041 3300048907 Bacteria 161394
308 Ga0496104_0002509 3300048907 Bacteria 15796
309 Ga0496104_0290433 3300048907 Bacteria 1547
310 Ga0496105_0000022 3300048908 Bacteria 161208
311 Ga0496105_0026392 3300048908 Bacteria 4737
312 Ga0496107_0095624 3300048910 Bacteria 2174
313 Ga0496116_0001114 3300048919 Bacteria 32173
314 Ga0496116_0002300 3300048919 Bacteria 20263
315 Ga0496116_0007635 3300048919 Bacteria 9543
316 Ga0496117_0008738 3300048920 Bacteria 9568
317 Ga0496117_0010355 3300048920 Bacteria 8516
318 Ga0496118_0000101 3300048921 Bacteria 159577
319 Ga0496118_0005889 3300048921 Bacteria 13726
320 Ga0496118_0094084 3300048921 Bacteria 2050
321 Ga0496119_0005956 3300048922 Bacteria 11467
322 Ga0496119_0009753 3300048922 Bacteria 8173
323 Ga0496119_0010782 3300048922 Bacteria 7652
324 Ga0496120_0002042 3300048923 Bacteria 21850
325 Ga0496120_0003605 3300048923 Bacteria 13904
326 Ga0496120_0007439 3300048923 Bacteria 8142
327 Ga0496122_0002332 3300048925 Bacteria 27370
328 Ga0496122_0009974 3300048925 Bacteria 9889
329 Ga0496123_0003414 3300048926 Bacteria 17880
330 Ga0496123_0147090 3300048926 Bacteria 1277
331 Ga0496124_0002542 3300048927 Bacteria 23661
332 Ga0496124_0009961 3300048927 Bacteria 9710
333 Ga0496124_0064328 3300048927 Bacteria 3062
334 Ga0496125_0002049 3300048928 Bacteria 27227
335 Ga0496125_0050993 3300048928 Bacteria 3418
336 Ga0496126_0002654 3300048929 Bacteria 23701
337 Ga0496126_0064697 3300048929 Bacteria 3275
338 Ga0501032_0018166 3300049569 Bacteria 4928
339 Ga0501033_0001414 3300049570 Bacteria 21325
340 Ga0501034_0012615 3300049571 Bacteria 8719
341 Ga0501036_0007237 3300049572 Bacteria 9035
342 Ga0501036_0011009 3300049572 Bacteria 7481
343 Ga0501036_0031544 3300049572 Bacteria 4478
344 Ga0501037_0006148 3300049573 Bacteria 8769
345 Ga0501038_0000645 3300049574 Bacteria 30998
346 Ga0501038_0006069 3300049574 Bacteria 11178
347 Ga0501038_0088771 3300049574 Bacteria 2594
348 Ga0501039_0000681 3300049575 Bacteria 24450
349 Ga0501039_0000959 3300049575 Bacteria 21007
350 Ga0501040_0076755 3300049576 Bacteria 2310
351 Ga0501041_0053060 3300049577 Bacteria 2472
352 Ga0501042_0024922 3300049578 Bacteria 4198
353 Ga0501042_0241144 3300049578 Bacteria 1304
354 Ga0501043_0007367 3300049579 Bacteria 8730
355 Ga0501043_0097435 3300049579 Bacteria 2312
356 Ga0501043_0114680 3300049579 Bacteria 2115
357 Ga0501046_0006636 3300049580 Bacteria 10222
358 Ga0501046_0122329 3300049580 Bacteria 1979
359 Ga0501047_0002496 3300049581 Bacteria 17539
360 Ga0501047_0007429 3300049581 Bacteria 10314
361 Ga0501047_0247068 3300049581 Bacteria 1633
362 Ga0501067_0001270 3300049583 Bacteria 13727
363 Ga0501067_0029677 3300049583 Bacteria 3031
364 Ga0501068_0014727 3300049584 Bacteria 4475
365 Ga0501069_0003501 3300049585 Bacteria 8088
366 Ga0501070_0022531 3300049586 Bacteria 5276
367 Ga0501070_0047279 3300049586 Bacteria 3577
368 Ga0501070_0095366 3300049586 Bacteria 2461
369 Ga0501071_0061805 3300049587 Bacteria 2713
370 Ga0501072_0001569 3300049588 Bacteria 17055
371 Ga0501073_0034902 3300049589 Bacteria 3577
372 Ga0501073_0046859 3300049589 Bacteria 3039
373 Ga0501074_0016701 3300049590 Bacteria 5326
374 Ga0501074_0026992 3300049590 Bacteria 4161
375 Ga0501075_0007392 3300049591 Bacteria 7621
376 Ga0501076_0139183 3300049592 Bacteria 1971
377 Ga0501079_0029545 3300049741 Bacteria 4209
378 Ga0501080_0000934 3300049742 Bacteria 23868
379 Ga0501080_0008075 3300049742 Bacteria 9539
380 Ga0501080_0015701 3300049742 Bacteria 6982
381 Ga0501080_0132066 3300049742 Bacteria 2312
382 Ga0501083_0160239 3300049744 Bacteria 1472
383 Ga0501035_0124845 3300049822 Bacteria 2247
384 Ga0501035_0194734 3300049822 Bacteria 1741
385 Ga0501044_0006953 3300049823 Bacteria 12450
386 Ga0501044_0063762 3300049823 Bacteria 3763
387 Ga0501045_0123763 3300049824 Bacteria 1920
388 nmdc:mga0n895_192353_c1 3300050512 Bacteria 2071
389 Ga0500610_0000128 3300053079 Bacteria 22908
390 Ga0500651_0002661 3300053093 Bacteria 9498
391 Ga0500654_109100 3300053099 Bacteria 1142
392 Ga0500595_005786 3300053119 Bacteria 5338
393 Ga0500564_018038 3300053138 Bacteria 3213
394 Ga0501082_0078733 3300060353 Bacteria 2843
395 Ga0501082_0084840 3300060353 Bacteria 2731

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015679 Ga0183366_1010 Ga0183366_101021 329
2 3300015680 Ga0183370_1010 Ga0183370_101021 329
3 3300015685 Ga0183369_1025 Ga0183369_102521 329
4 3300015687 Ga0183368_1013 Ga0183368_101321 329
5 3300036712 Ga0316584_0067970 Ga0316584_0067970_723_1715 329
6 3300035398 Ga0316574_0001146 Ga0316574_0001146_6927_7925 330
7 3300042876 Ga0451577_0000084 Ga0451577_0000084_17426_18418 330
8 3300044712 Ga0453684_0003652 Ga0453684_0003652_20748_21740 330
9 3300049569 Ga0501032_0018166 Ga0501032_0018166_1815_2828 337
10 3300049572 Ga0501036_0011009 Ga0501036_0011009_6292_7305 337
11 3300049574 Ga0501038_0088771 Ga0501038_0088771_125_1138 337
12 3300049575 Ga0501039_0000681 Ga0501039_0000681_23147_24160 337
13 3300049576 Ga0501040_0076755 Ga0501040_0076755_687_1700 337
14 3300049577 Ga0501041_0053060 Ga0501041_0053060_46_1059 337
15 3300049578 Ga0501042_0024922 Ga0501042_0024922_2776_3789 337
16 3300049578 Ga0501042_0241144 Ga0501042_0241144_72_1085 337
17 3300049591 Ga0501075_0007392 Ga0501075_0007392_4794_5807 337
18 3300049592 Ga0501076_0139183 Ga0501076_0139183_289_1302 337
19 3300049742 Ga0501080_0132066 Ga0501080_0132066_16_1029 337
20 3300049822 Ga0501035_0194734 Ga0501035_0194734_76_1089 337
21 3300049824 Ga0501045_0123763 Ga0501045_0123763_491_1504 337
22 3300060353 Ga0501082_0084840 Ga0501082_0084840_43_1056 337
23 3300035398 Ga0316574_0210551 Ga0316574_0210551_11_1039 341
24 3300005327 Ga0070658_10293498 Ga0070658_102934982 347
25 3300005327 Ga0070658_10069153 Ga0070658_100691533 348
26 3300005328 Ga0070676_10068834 Ga0070676_100688342 348
27 3300005334 Ga0068869_100027409 Ga0068869_1000274093 348
28 3300005335 Ga0070666_10001051 Ga0070666_1000105110 348
29 3300005335 Ga0070666_10035201 Ga0070666_100352013 348
30 3300005339 Ga0070660_100218842 Ga0070660_1002188421 348
31 3300005344 Ga0070661_100009642 Ga0070661_1000096425 348
32 3300005344 Ga0070661_100082840 Ga0070661_1000828402 348
33 3300005347 Ga0070668_100128698 Ga0070668_1001286983 348
34 3300005353 Ga0070669_100019050 Ga0070669_1000190503 348
35 3300005354 Ga0070675_100119371 Ga0070675_1001193712 348
36 3300005456 Ga0070678_100005981 Ga0070678_1000059815 348
37 3300005539 Ga0068853_100007334 Ga0068853_10000733411 348
38 3300005548 Ga0070665_100186910 Ga0070665_1001869102 348
39 3300005563 Ga0068855_100025019 Ga0068855_1000250193 348
40 3300005577 Ga0068857_100388233 Ga0068857_1003882331 348
41 3300005578 Ga0068854_100003283 Ga0068854_1000032834 348
42 3300005578 Ga0068854_100367575 Ga0068854_1003675751 348
43 3300005614 Ga0068856_100009925 Ga0068856_10000992510 348
44 3300005614 Ga0068856_100122535 Ga0068856_1001225352 348
45 3300005616 Ga0068852_100004195 Ga0068852_1000041957 348
46 3300005834 Ga0068851_10018942 Ga0068851_100189422 348
47 3300005840 Ga0068870_10086639 Ga0068870_100866391 348
48 3300006881 Ga0068865_100011849 Ga0068865_1000118492 348
49 3300009093 Ga0105240_10047885 Ga0105240_100478853 348
50 3300009093 Ga0105240_10073068 Ga0105240_100730682 348
51 3300009098 Ga0105245_10080781 Ga0105245_100807812 348
52 3300009174 Ga0105241_10005103 Ga0105241_100051033 348
53 3300009545 Ga0105237_10042108 Ga0105237_100421083 348
54 3300009551 Ga0105238_10003883 Ga0105238_100038837 348
55 3300009551 Ga0105238_10124658 Ga0105238_101246582 348
56 3300010375 Ga0105239_10042053 Ga0105239_100420533 348
57 3300013104 Ga0157370_10179263 Ga0157370_101792631 348
58 3300013105 Ga0157369_10006998 Ga0157369_100069984 348
59 3300013307 Ga0157372_10003066 Ga0157372_100030669 348
60 3300014325 Ga0163163_10000404 Ga0163163_1000040426 348
61 3300025903 Ga0207680_10000218 Ga0207680_1000021823 348
62 3300025903 Ga0207680_10156488 Ga0207680_101564882 348
63 3300025904 Ga0207647_10004212 Ga0207647_100042121 348
64 3300025907 Ga0207645_10010692 Ga0207645_100106923 348
65 3300025909 Ga0207705_10053924 Ga0207705_100539243 348
66 3300025911 Ga0207654_10001464 Ga0207654_1000146410 348
67 3300025911 Ga0207654_10095827 Ga0207654_100958273 348
68 3300025913 Ga0207695_10000330 Ga0207695_1000033011 348
69 3300025914 Ga0207671_10006159 Ga0207671_1000615911 348
70 3300025914 Ga0207671_10153568 Ga0207671_101535682 348
71 3300025919 Ga0207657_10004311 Ga0207657_100043119 348
72 3300025920 Ga0207649_10001385 Ga0207649_100013859 348
73 3300025920 Ga0207649_10042956 Ga0207649_100429562 348
74 3300025938 Ga0207704_10082334 Ga0207704_100823342 348
75 3300025944 Ga0207661_10042304 Ga0207661_100423042 348
76 3300025949 Ga0207667_10107440 Ga0207667_101074402 348
77 3300026023 Ga0207677_10003656 Ga0207677_1000365611 348
78 3300026041 Ga0207639_10019494 Ga0207639_100194942 348
79 3300026116 Ga0207674_10029055 Ga0207674_100290553 348
80 3300028379 Ga0268266_10293240 Ga0268266_102932402 348
81 3300031730 Ga0307516_10079815 Ga0307516_100798153 348
82 3300049579 Ga0501043_0114680 Ga0501043_0114680_39_1085 348
83 3300049580 Ga0501046_0122329 Ga0501046_0122329_351_1397 348
84 3300049581 Ga0501047_0002496 Ga0501047_0002496_14835_15881 348
85 3300049586 Ga0501070_0047279 Ga0501070_0047279_1562_2608 348
86 3300049590 Ga0501074_0026992 Ga0501074_0026992_2768_3814 348
87 3300049742 Ga0501080_0000934 Ga0501080_0000934_16409_17455 348
88 3300005355 Ga0070671_100125067 Ga0070671_1001250671 349
89 3300005459 Ga0068867_100090549 Ga0068867_1000905493 349
90 3300005459 Ga0068867_100303126 Ga0068867_1003031261 349
91 3300005564 Ga0070664_100318097 Ga0070664_1003180972 349
92 3300005841 Ga0068863_100051902 Ga0068863_1000519024 349
93 3300006358 Ga0068871_100015289 Ga0068871_1000152895 349
94 3300006881 Ga0068865_100026705 Ga0068865_1000267052 349
95 3300009176 Ga0105242_10041552 Ga0105242_100415523 349
96 3300010375 Ga0105239_10005085 Ga0105239_1000508513 349
97 3300013297 Ga0157378_10000322 Ga0157378_1000032213 349
98 3300013306 Ga0163162_10017677 Ga0163162_100176776 349
99 3300013308 Ga0157375_10115091 Ga0157375_101150912 349
100 3300013308 Ga0157375_10129791 Ga0157375_101297912 349
101 3300025903 Ga0207680_10284459 Ga0207680_102844591 349
102 3300025937 Ga0207669_10069659 Ga0207669_100696592 349
103 3300025938 Ga0207704_10025972 Ga0207704_100259722 349
104 3300025940 Ga0207691_10174750 Ga0207691_101747502 349
105 3300025986 Ga0207658_10189380 Ga0207658_101893802 349
106 3300026089 Ga0207648_10009668 Ga0207648_1000966810 349
107 3300026089 Ga0207648_10055895 Ga0207648_100558954 349
108 3300026095 Ga0207676_10098810 Ga0207676_100988102 349
109 3300026116 Ga0207674_10190681 Ga0207674_101906812 349
110 3300031616 Ga0307508_10275890 Ga0307508_102758902 349
111 3300048907 Ga0496104_0000041 Ga0496104_0000041_31769_32818 349
112 3300048908 Ga0496105_0000022 Ga0496105_0000022_31629_32678 349
113 3300005338 Ga0068868_100096707 Ga0068868_1000967073 350
114 3300005471 Ga0070698_100332811 Ga0070698_1003328111 350
115 3300005530 Ga0070679_100355805 Ga0070679_1003558052 350
116 3300005548 Ga0070665_100358266 Ga0070665_1003582661 350
117 3300006237 Ga0097621_100037304 Ga0097621_1000373044 350
118 3300006237 Ga0097621_100162481 Ga0097621_1001624813 350
119 3300009176 Ga0105242_10040028 Ga0105242_100400283 350
120 3300010375 Ga0105239_10008615 Ga0105239_100086156 350
121 3300013306 Ga0163162_10077131 Ga0163162_100771312 350
122 3300014969 Ga0157376_10002810 Ga0157376_100028106 350
123 3300025934 Ga0207686_10006533 Ga0207686_100065335 350
124 3300026121 Ga0207683_10328384 Ga0207683_103283842 350
125 3300050512 nmdc:mga0n895_192353_c1 nmdc:mga0n895_192353_c1_418_1470 350
126 iso_pu_bacteria 2511231025 2511381733 350
127 iso_pu_bacteria 2667528173 2671111048 350
128 iso_pu_bacteria 2852103415 2852106408 350
129 iso_pu_bacteria 2876601092 2876602473 350
130 iso_pu_bacteria 2904474040 2904479179 350
131 iso_pu_bacteria 2919150387 2919155588 350
132 iso_pu_bacteria 2927143783 2927148946 350
133 iso_pu_bacteria 2939602548 2939607189 350
134 iso_pu_bacteria 8016733728 8016737670 350
135 3300005367 Ga0070667_100044506 Ga0070667_1000445063 351
136 3300005367 Ga0070667_100046924 Ga0070667_1000469243 351
137 3300005457 Ga0070662_100068767 Ga0070662_1000687671 351
138 3300005466 Ga0070685_10001527 Ga0070685_100015272 351
139 3300005546 Ga0070696_100004921 Ga0070696_1000049217 351
140 3300005548 Ga0070665_100002146 Ga0070665_10000214612 351
141 3300005564 Ga0070664_100299188 Ga0070664_1002991882 351
142 3300005578 Ga0068854_100008791 Ga0068854_1000087914 351
143 3300005616 Ga0068852_100024140 Ga0068852_1000241403 351
144 3300005616 Ga0068852_100159911 Ga0068852_1001599112 351
145 3300005834 Ga0068851_10010948 Ga0068851_100109482 351
146 3300006881 Ga0068865_100018995 Ga0068865_1000189954 351
147 3300007788 Ga0099795_10017290 Ga0099795_100172902 351
148 3300009093 Ga0105240_10018746 Ga0105240_100187466 351
149 3300009174 Ga0105241_10205479 Ga0105241_102054792 351
150 3300009551 Ga0105238_10001884 Ga0105238_100018842 351
151 3300009551 Ga0105238_10004857 Ga0105238_1000485711 351
152 3300010375 Ga0105239_10087534 Ga0105239_100875342 351
153 3300013105 Ga0157369_10352190 Ga0157369_103521902 351
154 3300013296 Ga0157374_10093178 Ga0157374_100931782 351
155 3300025261 Ga0209233_1001156 Ga0209233_10011564 351
156 3300025903 Ga0207680_10057392 Ga0207680_100573923 351
157 3300025904 Ga0207647_10000019 Ga0207647_100000193 351
158 3300025913 Ga0207695_10000014 Ga0207695_10000014293 351
159 3300025913 Ga0207695_10015627 Ga0207695_100156274 351
160 3300025924 Ga0207694_10000266 Ga0207694_100002668 351
161 3300025924 Ga0207694_10003489 Ga0207694_100034894 351
162 3300025925 Ga0207650_10241726 Ga0207650_102417261 351
163 3300025933 Ga0207706_10006488 Ga0207706_100064883 351
164 3300025949 Ga0207667_10209842 Ga0207667_102098422 351
165 3300025961 Ga0207712_10000325 Ga0207712_1000032536 351
166 3300025986 Ga0207658_10014107 Ga0207658_100141073 351
167 3300025986 Ga0207658_10089892 Ga0207658_100898922 351
168 3300026041 Ga0207639_10000163 Ga0207639_1000016322 351
169 3300026067 Ga0207678_10029901 Ga0207678_100299013 351
170 3300026116 Ga0207674_10032448 Ga0207674_100324484 351
171 3300026142 Ga0207698_10095823 Ga0207698_100958233 351
172 3300028379 Ga0268266_10000007 Ga0268266_10000007566 351
173 3300030732 Ga0316176_1221853 Ga0316176_12218532 351
174 3300030733 Ga0314311_1090877 Ga0314311_10908772 351
175 3300030735 Ga0316178_1091317 Ga0316178_10913172 351
176 3300031090 Ga0265760_10000100 Ga0265760_1000010017 351
177 3300031730 Ga0307516_10000190 Ga0307516_1000019059 351
178 3300048921 Ga0496118_0094084 Ga0496118_0094084_615_1670 351
179 3300049571 Ga0501034_0012615 Ga0501034_0012615_2256_3329 351
180 3300049572 Ga0501036_0031544 Ga0501036_0031544_858_1931 351
181 3300049574 Ga0501038_0006069 Ga0501038_0006069_837_1910 351
182 3300049579 Ga0501043_0097435 Ga0501043_0097435_759_1832 351
183 3300049581 Ga0501047_0007429 Ga0501047_0007429_4467_5540 351
184 3300049583 Ga0501067_0001270 Ga0501067_0001270_3373_4446 351
185 3300049584 Ga0501068_0014727 Ga0501068_0014727_3305_4378 351
186 3300049585 Ga0501069_0003501 Ga0501069_0003501_6537_7610 351
187 3300049586 Ga0501070_0022531 Ga0501070_0022531_2768_3841 351
188 3300049588 Ga0501072_0001569 Ga0501072_0001569_14951_16024 351
189 3300049589 Ga0501073_0034902 Ga0501073_0034902_908_1981 351
190 3300049589 Ga0501073_0046859 Ga0501073_0046859_515_1588 351
191 3300049741 Ga0501079_0029545 Ga0501079_0029545_2619_3692 351
192 3300049742 Ga0501080_0015701 Ga0501080_0015701_482_1555 351
193 3300049823 Ga0501044_0006953 Ga0501044_0006953_10465_11538 351
194 3300049823 Ga0501044_0063762 Ga0501044_0063762_165_1238 351
195 3300009177 Ga0105248_10006836 Ga0105248_1000683611 352
196 3300013308 Ga0157375_10002283 Ga0157375_1000228311 352
197 3300025941 Ga0207711_10017624 Ga0207711_100176244 352
198 3300028379 Ga0268266_10184197 Ga0268266_101841971 352
199 3300041460 Ga0451802_0739338 Ga0451802_0739338_1430_2491 352
200 3300041463 Ga0451804_0627905 Ga0451804_0627905_158_1216 352
201 3300044658 Ga0466972_0005412 Ga0466972_0005412_4244_5302 352
202 3300044765 Ga0466970_0001519 Ga0466970_0001519_5913_6971 352
203 3300049581 Ga0501047_0247068 Ga0501047_0247068_305_1369 352
204 3300049822 Ga0501035_0124845 Ga0501035_0124845_1131_2195 352
205 3300053079 Ga0500610_0000128 Ga0500610_0000128_18731_19792 352
206 3300053093 Ga0500651_0002661 Ga0500651_0002661_5360_6421 352
207 3300031665 Ga0316575_10000051 Ga0316575_100000517 353
208 3300031727 Ga0316576_10014425 Ga0316576_100144252 353
209 3300031727 Ga0316576_10042389 Ga0316576_100423893 353
210 3300032139 Ga0316580_10038882 Ga0316580_100388822 353
211 3300035398 Ga0316574_0082856 Ga0316574_0082856_486_1547 353
212 3300046513 Ga0495616_0000926 Ga0495616_0000926_8710_9774 353
213 3300046523 Ga0495644_0000046 Ga0495644_0000046_44504_45568 353
214 3300046648 Ga0495611_0035101 Ga0495611_0035101_491_1555 353
215 3300046665 Ga0495661_0013022 Ga0495661_0013022_2116_3180 353
216 3300046692 Ga0495671_0001609 Ga0495671_0001609_8696_9760 353
217 3300047673 Ga0495593_0001336 Ga0495593_0001336_12506_13570 353
218 3300053119 Ga0500595_005786 Ga0500595_005786_3908_4996 353
219 3300002737 JGI25162J39368_1000566 JGI25162J39368_10005667 354
220 3300002771 JGI25163J39215_1000154 JGI25163J39215_100015419 354
221 3300002772 JGI25164J39214_1000364 JGI25164J39214_10003647 354
222 3300003751 Ga0055538_1000270 Ga0055538_10002707 354
223 3300003752 Ga0055539_1000298 Ga0055539_10002987 354
224 3300003756 Ga0055533_1000280 Ga0055533_10002807 354
225 3300003759 Ga0055525_1000404 Ga0055525_10004047 354
226 3300003841 Ga0055541_1000193 Ga0055541_10001937 354
227 3300003856 Ga0058692_1000726 Ga0058692_10007269 354
228 3300003856 Ga0058692_1006413 Ga0058692_10064132 354
229 3300005289 Ga0065704_10000027 Ga0065704_100000276 354
230 3300005289 Ga0065704_10091977 Ga0065704_100919772 354
231 3300005331 Ga0070670_100000134 Ga0070670_10000013435 354
232 3300005355 Ga0070671_100000231 Ga0070671_1000002313 354
233 3300005365 Ga0070688_100001631 Ga0070688_1000016312 354
234 3300005367 Ga0070667_100000060 Ga0070667_100000060123 354
235 3300005466 Ga0070685_10000063 Ga0070685_1000006345 354
236 3300005548 Ga0070665_100009514 Ga0070665_10000951411 354
237 3300005618 Ga0068864_100000143 Ga0068864_10000014334 354
238 3300005841 Ga0068863_100367995 Ga0068863_1003679951 354
239 3300005844 Ga0068862_100000759 Ga0068862_10000075918 354
240 3300006051 Ga0075364_10012642 Ga0075364_100126422 354
241 3300009036 Ga0105244_10002890 Ga0105244_1000289010 354
242 3300009036 Ga0105244_10006262 Ga0105244_100062622 354
243 3300009092 Ga0105250_10001252 Ga0105250_100012525 354
244 3300009177 Ga0105248_10079779 Ga0105248_100797792 354
245 3300009177 Ga0105248_10081332 Ga0105248_100813324 354
246 3300009553 Ga0105249_10026196 Ga0105249_100261963 354
247 3300013100 Ga0157373_10000898 Ga0157373_1000089811 354
248 3300013100 Ga0157373_10012564 Ga0157373_100125643 354
249 3300013102 Ga0157371_10003217 Ga0157371_100032178 354
250 3300013102 Ga0157371_10007769 Ga0157371_100077697 354
251 3300013104 Ga0157370_10004164 Ga0157370_1000416410 354
252 3300013306 Ga0163162_10023502 Ga0163162_100235024 354
253 3300013307 Ga0157372_10015544 Ga0157372_100155444 354
254 3300013307 Ga0157372_10683192 Ga0157372_106831921 354
255 3300014325 Ga0163163_10000604 Ga0163163_100006046 354
256 3300025207 Ga0209760_100180 Ga0209760_10018029 354
257 3300025224 Ga0209784_100291 Ga0209784_10029118 354
258 3300025225 Ga0209566_100498 Ga0209566_10049818 354
259 3300025226 Ga0209674_100342 Ga0209674_10034218 354
260 3300025230 Ga0209563_100230 Ga0209563_10023018 354
261 3300025231 Ga0207427_100370 Ga0207427_10037018 354
262 3300025233 Ga0209437_100515 Ga0209437_10051518 354
263 3300025253 Ga0209677_100373 Ga0209677_10037318 354
264 3300025261 Ga0209233_1001153 Ga0209233_10011535 354
265 3300025711 Ga0207696_1000599 Ga0207696_100059918 354
266 3300025728 Ga0207655_1001372 Ga0207655_10013727 354
267 3300025728 Ga0207655_1001476 Ga0207655_100147611 354
268 3300025900 Ga0207710_10026563 Ga0207710_100265632 354
269 3300025916 Ga0207663_10005533 Ga0207663_100055333 354
270 3300025925 Ga0207650_10000013 Ga0207650_1000001335 354
271 3300025931 Ga0207644_10000189 Ga0207644_100001893 354
272 3300025941 Ga0207711_10001271 Ga0207711_1000127111 354
273 3300025941 Ga0207711_10172713 Ga0207711_101727132 354
274 3300025986 Ga0207658_10000005 Ga0207658_1000000536 354
275 3300026035 Ga0207703_10017288 Ga0207703_100172883 354
276 3300026088 Ga0207641_10161488 Ga0207641_101614882 354
277 3300026088 Ga0207641_10161820 Ga0207641_101618202 354
278 3300026095 Ga0207676_10000010 Ga0207676_10000010133 354
279 3300027312 Ga0209371_1001662 Ga0209371_10016628 354
280 3300027312 Ga0209371_1001840 Ga0209371_10018403 354
281 3300027312 Ga0209371_1003747 Ga0209371_10037475 354
282 3300028380 Ga0268265_10002466 Ga0268265_1000246612 354
283 3300028381 Ga0268264_10000016 Ga0268264_10000016116 354
284 3300030500 Ga0268256_1001372 Ga0268256_10013723 354
285 3300030500 Ga0268256_1001452 Ga0268256_10014528 354
286 3300031665 Ga0316575_10012637 Ga0316575_100126372 354
287 3300031665 Ga0316575_10067263 Ga0316575_100672632 354
288 3300031665 Ga0316575_10082251 Ga0316575_100822511 354
289 3300031691 Ga0316579_10084283 Ga0316579_100842831 354
290 3300031691 Ga0316579_10108144 Ga0316579_101081442 354
291 3300031727 Ga0316576_10008101 Ga0316576_100081013 354
292 3300031727 Ga0316576_10077121 Ga0316576_100771212 354
293 3300031727 Ga0316576_10084281 Ga0316576_100842812 354
294 3300031728 Ga0316578_10027083 Ga0316578_100270833 354
295 3300031728 Ga0316578_10035851 Ga0316578_100358511 354
296 3300031728 Ga0316578_10068659 Ga0316578_100686592 354
297 3300031728 Ga0316578_10126078 Ga0316578_101260782 354
298 3300031733 Ga0316577_10054280 Ga0316577_100542802 354
299 3300031733 Ga0316577_10102007 Ga0316577_101020072 354
300 3300031733 Ga0316577_10153290 Ga0316577_101532901 354
301 3300032133 Ga0316583_10005530 Ga0316583_100055303 354
302 3300032133 Ga0316583_10006953 Ga0316583_100069532 354
303 3300032137 Ga0316585_10007267 Ga0316585_100072672 354
304 3300032139 Ga0316580_10016626 Ga0316580_100166262 354
305 3300032139 Ga0316580_10025766 Ga0316580_100257662 354
306 3300032168 Ga0316593_10005279 Ga0316593_100052792 354
307 3300032168 Ga0316593_10011839 Ga0316593_100118392 354
308 3300033541 Ga0316596_1012956 Ga0316596_10129563 354
309 3300035111 Ga0373923_0035770 Ga0373923_0035770_60_1130 354
310 3300035398 Ga0316574_0000270 Ga0316574_0000270_211_1275 354
311 3300035398 Ga0316574_0004818 Ga0316574_0004818_5304_6395 354
312 3300035398 Ga0316574_0005363 Ga0316574_0005363_5401_6465 354
313 3300035398 Ga0316574_0006891 Ga0316574_0006891_1460_2524 354
314 3300035398 Ga0316574_0026925 Ga0316574_0026925_1977_3041 354
315 3300035398 Ga0316574_0032325 Ga0316574_0032325_1438_2661 354
316 3300035398 Ga0316574_0039020 Ga0316574_0039020_766_1836 354
317 3300035398 Ga0316574_0040871 Ga0316574_0040871_664_1728 354
318 3300035398 Ga0316574_0045547 Ga0316574_0045547_1343_2410 354
319 3300035398 Ga0316574_0046486 Ga0316574_0046486_1087_2151 354
320 3300035398 Ga0316574_0066276 Ga0316574_0066276_739_1803 354
321 3300035398 Ga0316574_0092426 Ga0316574_0092426_684_1748 354
322 3300035398 Ga0316574_0092721 Ga0316574_0092721_845_1909 354
323 3300035398 Ga0316574_0149819 Ga0316574_0149819_82_1149 354
324 3300035692 Ga0373935_0074322 Ga0373935_0074322_769_1839 354
325 3300036647 Ga0316582_0002393 Ga0316582_0002393_6667_7731 354
326 3300036647 Ga0316582_0002498 Ga0316582_0002498_2240_3331 354
327 3300036647 Ga0316582_0004149 Ga0316582_0004149_5605_6732 354
328 3300036647 Ga0316582_0010549 Ga0316582_0010549_276_1340 354
329 3300036647 Ga0316582_0080842 Ga0316582_0080842_518_1582 354
330 3300036647 Ga0316582_0083390 Ga0316582_0083390_665_1888 354
331 3300036647 Ga0316582_0142700 Ga0316582_0142700_351_1415 354
332 3300036712 Ga0316584_0018251 Ga0316584_0018251_1594_2658 354
333 3300036712 Ga0316584_0053724 Ga0316584_0053724_961_2028 354
334 3300036712 Ga0316584_0158285 Ga0316584_0158285_438_1502 354
335 3300036712 Ga0316584_0176386 Ga0316584_0176386_365_1429 354
336 3300037588 Ga0316581_0004787 Ga0316581_0004787_863_1927 354
337 3300037588 Ga0316581_0005309 Ga0316581_0005309_2072_3136 354
338 3300037588 Ga0316581_0037851 Ga0316581_0037851_35_1105 354
339 3300038741 Ga0400488_05079 Ga0400488_05079_1454_2518 354
340 3300039062 Ga0400483_094960 Ga0400483_094960_284_1348 354
341 3300039062 Ga0400483_154898 Ga0400483_154898_3365_4429 354
342 3300039093 Ga0400489_63367 Ga0400489_63367_1220_2284 354
343 3300041405 Ga0439438_000065 Ga0439438_000065_42631_43698 354
344 3300041407 Ga0439447_004811 Ga0439447_004811_575_1642 354
345 3300042006 Ga0439432_002070 Ga0439432_002070_2481_3548 354
346 3300042006 Ga0439432_044414 Ga0439432_044414_318_1382 354
347 3300042156 Ga0439446_0000058 Ga0439446_0000058_12939_14039 354
348 3300042184 Ga0450908_012249 Ga0450908_012249_128_1228 354
349 3300042435 Ga0439434_0002716 Ga0439434_0002716_3559_4659 354
350 3300044712 Ga0453684_0002985 Ga0453684_0002985_20671_21747 354
351 3300044712 Ga0453684_0062154 Ga0453684_0062154_767_1891 354
352 3300046458 Ga0495591_000637 Ga0495591_000637_18936_20003 354
353 3300046471 Ga0495650_0001197 Ga0495650_0001197_20071_21186 354
354 3300046519 Ga0495632_0041976 Ga0495632_0041976_170_1234 354
355 3300046530 Ga0495654_0000715 Ga0495654_0000715_5947_7014 354
356 3300046616 Ga0495668_0024298 Ga0495668_0024298_490_1557 354
357 3300046810 Ga0495660_0000474 Ga0495660_0000474_26109_27173 354
358 3300048903 Ga0496100_0050729 Ga0496100_0050729_1169_2236 354
359 3300048903 Ga0496100_0054672 Ga0496100_0054672_1522_2592 354
360 3300048904 Ga0496101_0000454 Ga0496101_0000454_19046_20113 354
361 3300048907 Ga0496104_0002509 Ga0496104_0002509_8785_9900 354
362 3300048907 Ga0496104_0290433 Ga0496104_0290433_461_1531 354
363 3300048908 Ga0496105_0026392 Ga0496105_0026392_1145_2215 354
364 3300048910 Ga0496107_0095624 Ga0496107_0095624_485_1555 354
365 3300048919 Ga0496116_0001114 Ga0496116_0001114_6045_7112 354
366 3300048919 Ga0496116_0002300 Ga0496116_0002300_6299_7363 354
367 3300048919 Ga0496116_0007635 Ga0496116_0007635_2836_3903 354
368 3300048920 Ga0496117_0008738 Ga0496117_0008738_1207_2274 354
369 3300048920 Ga0496117_0010355 Ga0496117_0010355_132_1196 354
370 3300048921 Ga0496118_0000101 Ga0496118_0000101_66191_67258 354
371 3300048921 Ga0496118_0005889 Ga0496118_0005889_4657_5721 354
372 3300048922 Ga0496119_0005956 Ga0496119_0005956_4271_5338 354
373 3300048922 Ga0496119_0009753 Ga0496119_0009753_2737_3804 354
374 3300048922 Ga0496119_0010782 Ga0496119_0010782_2264_3328 354
375 3300048923 Ga0496120_0002042 Ga0496120_0002042_6049_7116 354
376 3300048923 Ga0496120_0003605 Ga0496120_0003605_10577_11641 354
377 3300048923 Ga0496120_0007439 Ga0496120_0007439_1244_2311 354
378 3300048925 Ga0496122_0002332 Ga0496122_0002332_6227_7291 354
379 3300048925 Ga0496122_0009974 Ga0496122_0009974_3926_4993 354
380 3300048926 Ga0496123_0003414 Ga0496123_0003414_6227_7291 354
381 3300048926 Ga0496123_0147090 Ga0496123_0147090_187_1254 354
382 3300048927 Ga0496124_0002542 Ga0496124_0002542_2516_3580 354
383 3300048927 Ga0496124_0009961 Ga0496124_0009961_5908_6975 354
384 3300048927 Ga0496124_0064328 Ga0496124_0064328_558_1625 354
385 3300048928 Ga0496125_0002049 Ga0496125_0002049_6082_7146 354
386 3300048928 Ga0496125_0050993 Ga0496125_0050993_1444_2511 354
387 3300048929 Ga0496126_0002654 Ga0496126_0002654_2556_3620 354
388 3300048929 Ga0496126_0064697 Ga0496126_0064697_279_1346 354
389 3300049570 Ga0501033_0001414 Ga0501033_0001414_7664_8737 354
390 3300049572 Ga0501036_0007237 Ga0501036_0007237_4433_5506 354
391 3300049573 Ga0501037_0006148 Ga0501037_0006148_1608_2681 354
392 3300049574 Ga0501038_0000645 Ga0501038_0000645_13101_14174 354
393 3300049575 Ga0501039_0000959 Ga0501039_0000959_10187_11260 354
394 3300049579 Ga0501043_0007367 Ga0501043_0007367_6089_7162 354
395 3300049580 Ga0501046_0006636 Ga0501046_0006636_5408_6481 354
396 3300049583 Ga0501067_0029677 Ga0501067_0029677_837_1910 354
397 3300049586 Ga0501070_0095366 Ga0501070_0095366_331_1404 354
398 3300049587 Ga0501071_0061805 Ga0501071_0061805_1478_2551 354
399 3300049590 Ga0501074_0016701 Ga0501074_0016701_1256_2329 354
400 3300049742 Ga0501080_0008075 Ga0501080_0008075_1142_2215 354
401 3300049744 Ga0501083_0160239 Ga0501083_0160239_157_1230 354
402 3300053099 Ga0500654_109100 Ga0500654_109100_48_1115 354
403 3300053138 Ga0500564_018038 Ga0500564_018038_1610_2674 354
404 3300060353 Ga0501082_0078733 Ga0501082_0078733_1146_2219 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

4

180

0.98

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

177

323

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.9893 3 354
4wsh-assembly1.cif.gz_B crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa 0.9869 4 354
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.9866 3 354
4wsh-assembly1.cif.gz_A crystal structure of probable uroporphyrinogen decarboxylase (upd) (uro-d) from pseudomonas aeruginosa 0.9863 1 354
4zr8-assembly1.cif.gz_B structure of uroporphyrinogen decarboxylase from acinetobacter baumannii 0.9836 4 352
ID Description Score Start End Superfamily
4wshB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9869 4 354 3.20.20.210
4wshB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9813 4 354 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9664 9 347 3.20.20.210
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9531 5 345 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9514 3 354 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A447N066-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 1.004 186 278 GO:0004853
GO:0005829
GO:0019353
AF-A0A2X3FQ44-F1-model_v4 Uroporphyrinogen III decarboxylase (EC 4.1.1.37) 1.003 170 283 GO:0004853
GO:0005829
GO:0019353
AF-A0A377XGI2-F1-model_v4 Uroporphyrinogen III decarboxylase (EC 4.1.1.37) 1.002 126 244 GO:0004853
GO:0005829
GO:0019353
AF-A0A354XGL7-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 1.001 79 230 GO:0004853
GO:0005829
GO:0019353
AF-A0A6D0F9G1-F1-model_v4 deleted 1 112 316

Feature Viewer

pLDDT pTM Quality
93.9 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map