F435017
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 402 | 238 | 402 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100072664|Ga0070680_1000726642 |
| Length | 147 |
| Sequence | MAQKAVETKQPNFNLFRQSAAFSSFSVNDLNKAQEFYGSTLGLETTKTPEGLMLRIAGGSPIFIYPKSNHTPASFTILNFPVDDIDEAVDELTKRGIHFESYNEPMKTDEKGIHRGESTGQGPNIAWFKDPAGNFLSVLENTGSADQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 5 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 13 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 14 | 3300003379 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM | Metagenome | Rhizosphere |
| 15 | 3300003383 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM | Metagenome | Rhizosphere |
| 16 | 3300003392 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM | Metagenome | Rhizosphere |
| 17 | 3300003399 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM | Metagenome | Rhizosphere |
| 18 | 3300003400 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM | Metagenome | Rhizosphere |
| 19 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 20 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 104 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 105 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 108 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 109 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 110 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 181 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 204 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 205 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 206 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 224 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 225 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 230 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 234 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 235 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 236 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 237 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 238 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0 |
| Isolates | 0.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.23 |
| Nodule | 0 |
| Rhizoplane | 1.74 |
| Rhizosphere | 93.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2609502 | 2162886006 | Archaea | 1512 |
| 2 | SwRhRL3b_contig_378765 | 2162886006 | Archaea | 1790 |
| 3 | MRS1b_contig_6031450 | 2162886011 | Archaea | 1637 |
| 4 | 2214828557 | 2209111006 | Archaea | 1806 |
| 5 | ARcpr5oldR_c000714 | 3300000041 | Archaea | 3827 |
| 6 | ARSoilYngRDRAFT_c00715 | 3300000042 | Archaea | 3080 |
| 7 | ARCol0yngRDRAFT_1000102 | 3300000652 | Archaea | 15846 |
| 8 | JGI24737J22298_10028520 | 3300001990 | Unclassified | 1754 |
| 9 | JGI24033J26618_1006462 | 3300002155 | Archaea | 1316 |
| 10 | rootH1_10004557 | 3300003316 | Bacteria | 1533 |
| 11 | rootH1_10004557 | 3300003323 | Bacteria | 5638 |
| 12 | rootH1_10077413 | 3300003316 | Bacteria | 1826 |
| 13 | rootL2_10220025 | 3300003322 | Unclassified | 3332 |
| 14 | rootL2_10279067 | 3300003322 | Bacteria | 1392 |
| 15 | JGI26129J50193_1000420 | 3300003349 | Archaea | 2632 |
| 16 | JGI26145J50221_1000028 | 3300003371 | Archaea | 10329 |
| 17 | JGI26142J50222_100784 | 3300003379 | Archaea | 1009 |
| 18 | JGI26140J50224_101077 | 3300003383 | Archaea | 990 |
| 19 | JGI26134J50242_100224 | 3300003392 | Archaea | 2657 |
| 20 | JGI26136J50244_100409 | 3300003399 | Archaea | 1513 |
| 21 | JGI26131J50246_100106 | 3300003400 | Archaea | 4060 |
| 22 | JGI26138J51218_100218 | 3300003504 | Archaea | 2537 |
| 23 | Ga0065716_1000223 | 3300005277 | Archaea | 2543 |
| 24 | Ga0065704_10631375 | 3300005289 | Bacteria | 538 |
| 25 | Ga0065712_10001104 | 3300005290 | Archaea | 20445 |
| 26 | Ga0065715_10126374 | 3300005293 | Archaea | 2108 |
| 27 | Ga0065715_10256125 | 3300005293 | Archaea | 1116 |
| 28 | Ga0065715_10768800 | 3300005293 | Bacteria | 618 |
| 29 | Ga0065707_10000638 | 3300005295 | Archaea | 27995 |
| 30 | Ga0070658_10031923 | 3300005327 | Bacteria | 4232 |
| 31 | Ga0070676_10266664 | 3300005328 | Archaea | 1148 |
| 32 | Ga0070676_10680272 | 3300005328 | Archaea | 750 |
| 33 | Ga0070670_100024010 | 3300005331 | Archaea | 5245 |
| 34 | Ga0070670_100215903 | 3300005331 | Archaea | 1668 |
| 35 | Ga0070670_101030808 | 3300005331 | Bacteria | 749 |
| 36 | Ga0070670_101409041 | 3300005331 | Unclassified | 639 |
| 37 | Ga0070677_10030635 | 3300005333 | Archaea | 2049 |
| 38 | Ga0068869_100015806 | 3300005334 | Archaea | 5073 |
| 39 | Ga0070680_100072664 | 3300005336 | Bacteria | 2827 |
| 40 | Ga0070680_100089619 | 3300005336 | Archaea | 2545 |
| 41 | Ga0070680_100153106 | 3300005336 | Unclassified | 1936 |
| 42 | Ga0070680_100305252 | 3300005336 | Archaea | 1350 |
| 43 | Ga0070680_101522317 | 3300005336 | Bacteria | 579 |
| 44 | Ga0070682_100590255 | 3300005337 | Bacteria | 875 |
| 45 | Ga0070682_100805845 | 3300005337 | Bacteria | 763 |
| 46 | Ga0070660_100684287 | 3300005339 | Bacteria | 860 |
| 47 | Ga0070687_100952626 | 3300005343 | Archaea | 619 |
| 48 | Ga0070687_100965406 | 3300005343 | Archaea | 615 |
| 49 | Ga0070661_100244712 | 3300005344 | Bacteria | 1382 |
| 50 | Ga0070661_100279848 | 3300005344 | Archaea | 1294 |
| 51 | Ga0070692_10120184 | 3300005345 | Archaea | 1464 |
| 52 | Ga0070668_100036975 | 3300005347 | Archaea | 3727 |
| 53 | Ga0070669_100262555 | 3300005353 | Archaea | 1378 |
| 54 | Ga0070669_100711579 | 3300005353 | Archaea | 849 |
| 55 | Ga0070671_100982258 | 3300005355 | Archaea | 739 |
| 56 | Ga0070674_100147685 | 3300005356 | Unclassified | 1771 |
| 57 | Ga0070674_101617205 | 3300005356 | Bacteria | 584 |
| 58 | Ga0070673_100246124 | 3300005364 | Archaea | 1556 |
| 59 | Ga0070659_100075053 | 3300005366 | Archaea | 2694 |
| 60 | Ga0070659_101486574 | 3300005366 | Unclassified | 603 |
| 61 | Ga0070667_101040279 | 3300005367 | Archaea | 764 |
| 62 | Ga0070701_10300538 | 3300005438 | Archaea | 986 |
| 63 | Ga0070711_101381521 | 3300005439 | Unclassified | 612 |
| 64 | Ga0070705_100369414 | 3300005440 | Bacteria | 1052 |
| 65 | Ga0070705_100506300 | 3300005440 | Archaea | 918 |
| 66 | Ga0070705_101119675 | 3300005440 | Bacteria | 645 |
| 67 | Ga0070705_101392502 | 3300005440 | Unclassified | 584 |
| 68 | Ga0070705_101909531 | 3300005440 | Archaea | 505 |
| 69 | Ga0070700_100257274 | 3300005441 | Archaea | 1255 |
| 70 | Ga0070694_100048022 | 3300005444 | Archaea | 2870 |
| 71 | Ga0070694_100545810 | 3300005444 | Archaea | 927 |
| 72 | Ga0070694_100868691 | 3300005444 | Archaea | 743 |
| 73 | Ga0070708_100158432 | 3300005445 | Bacteria | 2109 |
| 74 | Ga0070708_100272853 | 3300005445 | Archaea | 1591 |
| 75 | Ga0070708_100445889 | 3300005445 | Bacteria | 1221 |
| 76 | Ga0070708_100722539 | 3300005445 | Bacteria | 937 |
| 77 | Ga0070708_101645219 | 3300005445 | Unclassified | 597 |
| 78 | Ga0070708_102225838 | 3300005445 | Archaea | 506 |
| 79 | Ga0070663_100396803 | 3300005455 | Archaea | 1127 |
| 80 | Ga0070662_100026840 | 3300005457 | Bacteria | 3992 |
| 81 | Ga0070662_100734424 | 3300005457 | Archaea | 837 |
| 82 | Ga0070662_100889937 | 3300005457 | Archaea | 759 |
| 83 | Ga0070681_10030325 | 3300005458 | Bacteria | 5426 |
| 84 | Ga0070681_11578031 | 3300005458 | Bacteria | 581 |
| 85 | Ga0068867_100019669 | 3300005459 | Archaea | 4810 |
| 86 | Ga0068867_100050804 | 3300005459 | Archaea | 3057 |
| 87 | Ga0068867_100198173 | 3300005459 | Bacteria | 1606 |
| 88 | Ga0070706_100002656 | 3300005467 | Bacteria | 17913 |
| 89 | Ga0070706_100101879 | 3300005467 | Archaea | 2668 |
| 90 | Ga0070706_100172280 | 3300005467 | Bacteria | 2021 |
| 91 | Ga0070706_100213710 | 3300005467 | Bacteria | 1800 |
| 92 | Ga0070706_100310199 | 3300005467 | Bacteria | 1472 |
| 93 | Ga0070707_100012946 | 3300005468 | Bacteria | 7794 |
| 94 | Ga0070707_100018613 | 3300005468 | Bacteria | 6535 |
| 95 | Ga0070707_100276020 | 3300005468 | Archaea | 1634 |
| 96 | Ga0070707_100395777 | 3300005468 | Bacteria | 1341 |
| 97 | Ga0070707_100533250 | 3300005468 | Bacteria | 1136 |
| 98 | Ga0070698_100001367 | 3300005471 | Bacteria | 27160 |
| 99 | Ga0070698_100004631 | 3300005471 | Bacteria | 15114 |
| 100 | Ga0070698_100478019 | 3300005471 | Archaea | 1183 |
| 101 | Ga0070698_100487888 | 3300005471 | Bacteria | 1169 |
| 102 | Ga0070698_100559690 | 3300005471 | Bacteria | 1083 |
| 103 | Ga0070698_100635473 | 3300005471 | Bacteria | 1008 |
| 104 | Ga0070698_101278988 | 3300005471 | Unclassified | 683 |
| 105 | Ga0070699_100003444 | 3300005518 | Bacteria | 13990 |
| 106 | Ga0070699_100517446 | 3300005518 | Unclassified | 1085 |
| 107 | Ga0070699_100775551 | 3300005518 | Unclassified | 877 |
| 108 | Ga0070699_100868524 | 3300005518 | Archaea | 826 |
| 109 | Ga0070679_100086901 | 3300005530 | Bacteria | 3114 |
| 110 | Ga0070679_100283603 | 3300005530 | Archaea | 1608 |
| 111 | Ga0070684_100603827 | 3300005535 | Archaea | 1020 |
| 112 | Ga0070697_100000001 | 3300005536 | Bacteria | 662298 |
| 113 | Ga0070697_100632309 | 3300005536 | Archaea | 942 |
| 114 | Ga0070697_101845955 | 3300005536 | Unclassified | 541 |
| 115 | Ga0068853_100067878 | 3300005539 | Bacteria | 3099 |
| 116 | Ga0070672_100006602 | 3300005543 | Archaea | 7811 |
| 117 | Ga0070672_100202423 | 3300005543 | Archaea | 1661 |
| 118 | Ga0070686_101451426 | 3300005544 | Archaea | 577 |
| 119 | Ga0070695_100223984 | 3300005545 | Bacteria | 1356 |
| 120 | Ga0070695_100296557 | 3300005545 | Archaea | 1193 |
| 121 | Ga0070695_101066446 | 3300005545 | Unclassified | 660 |
| 122 | Ga0070696_100552743 | 3300005546 | Archaea | 923 |
| 123 | Ga0070696_100647967 | 3300005546 | Unclassified | 856 |
| 124 | Ga0070696_100732307 | 3300005546 | Archaea | 809 |
| 125 | Ga0070693_100315971 | 3300005547 | Archaea | 1058 |
| 126 | Ga0070704_100459917 | 3300005549 | Archaea | 1097 |
| 127 | Ga0068855_100014049 | 3300005563 | Bacteria | 9652 |
| 128 | Ga0068855_100069509 | 3300005563 | Bacteria | 4098 |
| 129 | Ga0068855_100888351 | 3300005563 | Bacteria | 942 |
| 130 | Ga0068857_100065097 | 3300005577 | Bacteria | 3241 |
| 131 | Ga0068857_100209984 | 3300005577 | Archaea | 1776 |
| 132 | Ga0068857_100631206 | 3300005577 | Bacteria | 1014 |
| 133 | Ga0068857_100639198 | 3300005577 | Unclassified | 1008 |
| 134 | Ga0068857_101109438 | 3300005577 | Archaea | 764 |
| 135 | Ga0068854_101258258 | 3300005578 | Archaea | 665 |
| 136 | Ga0068856_100129581 | 3300005614 | Bacteria | 2527 |
| 137 | Ga0068856_102297578 | 3300005614 | Bacteria | 547 |
| 138 | Ga0068852_100077947 | 3300005616 | Archaea | 2930 |
| 139 | Ga0068852_101837998 | 3300005616 | Unclassified | 628 |
| 140 | Ga0068859_100234716 | 3300005617 | Archaea | 1923 |
| 141 | Ga0068859_100489792 | 3300005617 | Archaea | 1325 |
| 142 | Ga0068859_102865510 | 3300005617 | Unclassified | 529 |
| 143 | Ga0068864_100013556 | 3300005618 | Archaea | 6759 |
| 144 | Ga0068861_101305040 | 3300005719 | Archaea | 706 |
| 145 | Ga0068851_10296677 | 3300005834 | Bacteria | 928 |
| 146 | Ga0068870_10065216 | 3300005840 | Archaea | 1969 |
| 147 | Ga0068870_10153255 | 3300005840 | Archaea | 1359 |
| 148 | Ga0068860_100603659 | 3300005843 | Archaea | 1103 |
| 149 | Ga0068860_100653181 | 3300005843 | Archaea | 1060 |
| 150 | Ga0068862_100069743 | 3300005844 | Archaea | 3034 |
| 151 | Ga0068862_100145353 | 3300005844 | Archaea | 2107 |
| 152 | Ga0081538_10069935 | 3300005981 | Archaea | 1941 |
| 153 | Ga0081539_10254442 | 3300005985 | Bacteria | 778 |
| 154 | Ga0070717_10158670 | 3300006028 | Bacteria | 1961 |
| 155 | Ga0070717_11083123 | 3300006028 | Bacteria | 730 |
| 156 | Ga0075365_10000397 | 3300006038 | Bacteria | 15949 |
| 157 | Ga0075364_10001592 | 3300006051 | Bacteria | 12402 |
| 158 | Ga0075364_10838917 | 3300006051 | Unclassified | 626 |
| 159 | Ga0075432_10340866 | 3300006058 | Archaea | 633 |
| 160 | Ga0070716_100173273 | 3300006173 | Bacteria | 1410 |
| 161 | Ga0097621_100325126 | 3300006237 | Archaea | 1363 |
| 162 | Ga0075428_100174761 | 3300006844 | Archaea | 2327 |
| 163 | Ga0075428_100293865 | 3300006844 | Bacteria | 1747 |
| 164 | Ga0075428_101665393 | 3300006844 | Unclassified | 666 |
| 165 | Ga0075433_10259021 | 3300006852 | Archaea | 1542 |
| 166 | Ga0075433_11005205 | 3300006852 | Unclassified | 726 |
| 167 | Ga0075434_100048138 | 3300006871 | Archaea | 4231 |
| 168 | Ga0075429_100744569 | 3300006880 | Archaea | 858 |
| 169 | Ga0075429_100754159 | 3300006880 | Archaea | 853 |
| 170 | Ga0068865_100417301 | 3300006881 | Archaea | 1103 |
| 171 | Ga0075436_100058308 | 3300006914 | Archaea | 2666 |
| 172 | Ga0097620_100234724 | 3300006931 | Archaea | 1923 |
| 173 | Ga0097620_100489823 | 3300006931 | Archaea | 1325 |
| 174 | Ga0105245_10166103 | 3300009098 | Bacteria | 2098 |
| 175 | Ga0114129_10005807 | 3300009147 | Archaea | 17472 |
| 176 | Ga0114129_10064747 | 3300009147 | Archaea | 5102 |
| 177 | Ga0114129_10153541 | 3300009147 | Bacteria | 3150 |
| 178 | Ga0114129_10242081 | 3300009147 | Archaea | 2425 |
| 179 | Ga0114129_10271759 | 3300009147 | Bacteria | 2267 |
| 180 | Ga0114129_10888519 | 3300009147 | Archaea | 1130 |
| 181 | Ga0114129_10989770 | 3300009147 | Unclassified | 1060 |
| 182 | Ga0114129_12470517 | 3300009147 | Bacteria | 621 |
| 183 | Ga0105243_10011180 | 3300009148 | Bacteria | 6789 |
| 184 | Ga0105241_10548818 | 3300009174 | Bacteria | 1037 |
| 185 | Ga0105241_11041628 | 3300009174 | Bacteria | 767 |
| 186 | Ga0105242_10021814 | 3300009176 | Archaea | 5033 |
| 187 | Ga0105237_10649502 | 3300009545 | Unclassified | 1062 |
| 188 | Ga0105249_10517857 | 3300009553 | Archaea | 1240 |
| 189 | Ga0105249_12427593 | 3300009553 | Archaea | 597 |
| 190 | Ga0105239_10594223 | 3300010375 | Archaea | 1262 |
| 191 | Ga0105239_10681036 | 3300010375 | Unclassified | 1175 |
| 192 | Ga0105239_11842797 | 3300010375 | Unclassified | 701 |
| 193 | Ga0105239_13116256 | 3300010375 | Bacteria | 540 |
| 194 | Ga0105246_10026473 | 3300011119 | Archaea | 3789 |
| 195 | Ga0105246_10338772 | 3300011119 | Archaea | 1228 |
| 196 | Ga0105246_10360005 | 3300011119 | Archaea | 1195 |
| 197 | Ga0157340_1000524 | 3300012473 | Archaea | 1501 |
| 198 | Ga0157336_1001260 | 3300012477 | Archaea | 1286 |
| 199 | Ga0157337_1000262 | 3300012483 | Archaea | 2428 |
| 200 | Ga0157341_1007661 | 3300012494 | Archaea | 865 |
| 201 | Ga0157345_1001292 | 3300012498 | Archaea | 1765 |
| 202 | Ga0157313_1000116 | 3300012503 | Unclassified | 3535 |
| 203 | Ga0157316_1001849 | 3300012510 | Archaea | 1373 |
| 204 | Ga0157338_1010696 | 3300012515 | Archaea | 931 |
| 205 | Ga0157373_10040781 | 3300013100 | Unclassified | 3321 |
| 206 | Ga0157373_10054985 | 3300013100 | Unclassified | 2828 |
| 207 | Ga0157373_10349337 | 3300013100 | Bacteria | 1055 |
| 208 | Ga0157371_10000561 | 3300013102 | Bacteria | 43999 |
| 209 | Ga0157371_10142868 | 3300013102 | Bacteria | 1705 |
| 210 | Ga0157371_10715996 | 3300013102 | Bacteria | 750 |
| 211 | Ga0157370_10164386 | 3300013104 | Bacteria | 2064 |
| 212 | Ga0157370_10356672 | 3300013104 | Bacteria | 1347 |
| 213 | Ga0157369_10021418 | 3300013105 | Bacteria | 7232 |
| 214 | Ga0157369_10412099 | 3300013105 | Unclassified | 1401 |
| 215 | Ga0157369_11707508 | 3300013105 | Bacteria | 640 |
| 216 | Ga0157378_10034192 | 3300013297 | Archaea | 4495 |
| 217 | Ga0157378_10046095 | 3300013297 | Archaea | 3875 |
| 218 | Ga0157372_10851186 | 3300013307 | Bacteria | 1059 |
| 219 | Ga0157372_11097845 | 3300013307 | Bacteria | 920 |
| 220 | Ga0157375_11421371 | 3300013308 | Archaea | 817 |
| 221 | Ga0157375_11479925 | 3300013308 | Archaea | 801 |
| 222 | Ga0157380_10095271 | 3300014326 | Archaea | 2466 |
| 223 | Ga0157380_10492354 | 3300014326 | Archaea | 1189 |
| 224 | Ga0209455_1001944 | 3300025272 | Bacteria | 8536 |
| 225 | Ga0207682_10031172 | 3300025893 | Archaea | 2139 |
| 226 | Ga0207642_10013096 | 3300025899 | Archaea | 3015 |
| 227 | Ga0207642_10502493 | 3300025899 | Archaea | 742 |
| 228 | Ga0207647_10017360 | 3300025904 | Archaea | 4892 |
| 229 | Ga0207645_10006750 | 3300025907 | Archaea | 8197 |
| 230 | Ga0207645_10012571 | 3300025907 | Archaea | 5741 |
| 231 | Ga0207643_10002365 | 3300025908 | Archaea | 10252 |
| 232 | Ga0207643_10017433 | 3300025908 | Archaea | 3927 |
| 233 | Ga0207684_10001474 | 3300025910 | Bacteria | 25315 |
| 234 | Ga0207684_10156955 | 3300025910 | Bacteria | 1958 |
| 235 | Ga0207684_10172492 | 3300025910 | Bacteria | 1864 |
| 236 | Ga0207684_10178415 | 3300025910 | Archaea | 1831 |
| 237 | Ga0207684_10691065 | 3300025910 | Unclassified | 867 |
| 238 | Ga0207707_10204196 | 3300025912 | Archaea | 1722 |
| 239 | Ga0207707_11359494 | 3300025912 | Unclassified | 568 |
| 240 | Ga0207660_10183704 | 3300025917 | Unclassified | 1625 |
| 241 | Ga0207660_10232991 | 3300025917 | Bacteria | 1448 |
| 242 | Ga0207660_10786452 | 3300025917 | Archaea | 776 |
| 243 | Ga0207660_11186690 | 3300025917 | Archaea | 621 |
| 244 | Ga0207662_10348527 | 3300025918 | Archaea | 994 |
| 245 | Ga0207657_10031076 | 3300025919 | Bacteria | 4841 |
| 246 | Ga0207657_11067201 | 3300025919 | Bacteria | 618 |
| 247 | Ga0207657_11375039 | 3300025919 | Archaea | 531 |
| 248 | Ga0207649_10253069 | 3300025920 | Bacteria | 1269 |
| 249 | Ga0207652_10025915 | 3300025921 | Bacteria | 4878 |
| 250 | Ga0207652_10223144 | 3300025921 | Bacteria | 1698 |
| 251 | Ga0207652_10524150 | 3300025921 | Archaea | 1066 |
| 252 | Ga0207646_10013844 | 3300025922 | Bacteria | 7693 |
| 253 | Ga0207646_10042615 | 3300025922 | Bacteria | 4077 |
| 254 | Ga0207646_10098531 | 3300025922 | Unclassified | 2619 |
| 255 | Ga0207646_11064117 | 3300025922 | Archaea | 713 |
| 256 | Ga0207681_10322683 | 3300025923 | Archaea | 1228 |
| 257 | Ga0207681_10871403 | 3300025923 | Archaea | 753 |
| 258 | Ga0207650_10013622 | 3300025925 | Archaea | 5635 |
| 259 | Ga0207650_10064384 | 3300025925 | Archaea | 2744 |
| 260 | Ga0207687_10854479 | 3300025927 | Unclassified | 778 |
| 261 | Ga0207664_10893449 | 3300025929 | Unclassified | 798 |
| 262 | Ga0207690_10220746 | 3300025932 | Bacteria | 1450 |
| 263 | Ga0207690_10312737 | 3300025932 | Archaea | 1232 |
| 264 | Ga0207690_11597232 | 3300025932 | Unclassified | 545 |
| 265 | Ga0207706_10032443 | 3300025933 | Archaea | 4651 |
| 266 | Ga0207709_10007272 | 3300025935 | Bacteria | 6175 |
| 267 | Ga0207669_10941902 | 3300025937 | Archaea | 723 |
| 268 | Ga0207704_10083022 | 3300025938 | Archaea | 2078 |
| 269 | Ga0207704_10825998 | 3300025938 | Archaea | 775 |
| 270 | Ga0207691_10028158 | 3300025940 | Archaea | 5263 |
| 271 | Ga0207689_10016242 | 3300025942 | Archaea | 6306 |
| 272 | Ga0207679_10054451 | 3300025945 | Archaea | 2945 |
| 273 | Ga0207679_10356971 | 3300025945 | Bacteria | 1275 |
| 274 | Ga0207667_10087767 | 3300025949 | Bacteria | 3217 |
| 275 | Ga0207651_10111367 | 3300025960 | Archaea | 2055 |
| 276 | Ga0207712_10261538 | 3300025961 | Archaea | 1404 |
| 277 | Ga0207640_10010034 | 3300025981 | Bacteria | 5321 |
| 278 | Ga0207640_10220196 | 3300025981 | Archaea | 1452 |
| 279 | Ga0207677_10808971 | 3300026023 | Archaea | 839 |
| 280 | Ga0207639_10878826 | 3300026041 | Unclassified | 837 |
| 281 | Ga0207678_10385647 | 3300026067 | Archaea | 1212 |
| 282 | Ga0207708_10022390 | 3300026075 | Archaea | 4772 |
| 283 | Ga0207708_10147409 | 3300026075 | Archaea | 1850 |
| 284 | Ga0207708_10646664 | 3300026075 | Archaea | 900 |
| 285 | Ga0207702_12154554 | 3300026078 | Bacteria | 547 |
| 286 | Ga0207648_10016887 | 3300026089 | Archaea | 6653 |
| 287 | Ga0207648_10042357 | 3300026089 | Archaea | 3996 |
| 288 | Ga0207676_10113290 | 3300026095 | Archaea | 2273 |
| 289 | Ga0207674_10020812 | 3300026116 | Bacteria | 7080 |
| 290 | Ga0207674_10028979 | 3300026116 | Bacteria | 5836 |
| 291 | Ga0207674_10135805 | 3300026116 | Archaea | 2422 |
| 292 | Ga0207675_100632627 | 3300026118 | Archaea | 1075 |
| 293 | Ga0207683_10296026 | 3300026121 | Archaea | 1480 |
| 294 | Ga0207683_10484002 | 3300026121 | Archaea | 1142 |
| 295 | Ga0207698_10017033 | 3300026142 | Archaea | 4919 |
| 296 | Ga0207698_11337972 | 3300026142 | Unclassified | 731 |
| 297 | Ga0209973_1000801 | 3300027252 | Archaea | 2528 |
| 298 | Ga0209967_1020207 | 3300027364 | Archaea | 970 |
| 299 | Ga0209981_1026234 | 3300027378 | Archaea | 845 |
| 300 | Ga0210000_1003097 | 3300027462 | Archaea | 2385 |
| 301 | Ga0209995_1000182 | 3300027471 | Archaea | 10072 |
| 302 | Ga0209995_1033242 | 3300027471 | Archaea | 866 |
| 303 | Ga0209968_1000164 | 3300027526 | Archaea | 11612 |
| 304 | Ga0209999_1002675 | 3300027543 | Archaea | 3150 |
| 305 | Ga0209999_1019675 | 3300027543 | Archaea | 1238 |
| 306 | Ga0209999_1073204 | 3300027543 | Archaea | 658 |
| 307 | Ga0209982_1000463 | 3300027552 | Archaea | 4997 |
| 308 | Ga0209970_1009869 | 3300027614 | Archaea | 1560 |
| 309 | Ga0209983_1001356 | 3300027665 | Archaea | 5450 |
| 310 | Ga0209971_1002213 | 3300027682 | Archaea | 4714 |
| 311 | Ga0209966_1000520 | 3300027695 | Archaea | 9940 |
| 312 | Ga0209974_10002674 | 3300027876 | Archaea | 6455 |
| 313 | Ga0207428_10031641 | 3300027907 | Archaea | 4363 |
| 314 | Ga0268265_10203701 | 3300028380 | Archaea | 1718 |
| 315 | Ga0268265_10337788 | 3300028380 | Archaea | 1370 |
| 316 | Ga0268264_10476546 | 3300028381 | Archaea | 1213 |
| 317 | Ga0265319_1201378 | 3300028563 | Bacteria | 611 |
| 318 | Ga0265318_10144146 | 3300028577 | Bacteria | 874 |
| 319 | Ga0265322_10058072 | 3300028654 | Bacteria | 1097 |
| 320 | Ga0265338_10433601 | 3300028800 | Bacteria | 932 |
| 321 | Ga0314311_1180264 | 3300030733 | Unclassified | 558 |
| 322 | Ga0316179_1003690 | 3300030734 | Bacteria | 927 |
| 323 | Ga0265332_10148533 | 3300031238 | Bacteria | 981 |
| 324 | Ga0265320_10102805 | 3300031240 | Bacteria | 1315 |
| 325 | Ga0265339_10068463 | 3300031249 | Bacteria | 1897 |
| 326 | Ga0265316_10010993 | 3300031344 | Bacteria | 8213 |
| 327 | Ga0307408_100463707 | 3300031548 | Bacteria | 1102 |
| 328 | Ga0265342_10156904 | 3300031712 | Bacteria | 1260 |
| 329 | Ga0307405_10563663 | 3300031731 | Bacteria | 924 |
| 330 | Ga0307413_11107950 | 3300031824 | Bacteria | 684 |
| 331 | Ga0307413_11862547 | 3300031824 | Bacteria | 540 |
| 332 | Ga0307410_10364153 | 3300031852 | Bacteria | 1159 |
| 333 | Ga0307407_10351542 | 3300031903 | Bacteria | 1044 |
| 334 | Ga0307409_100273991 | 3300031995 | Bacteria | 1556 |
| 335 | Ga0307409_101204580 | 3300031995 | Bacteria | 781 |
| 336 | Ga0307416_100458982 | 3300032002 | Bacteria | 1328 |
| 337 | Ga0307414_11429522 | 3300032004 | Bacteria | 643 |
| 338 | Ga0307411_10608253 | 3300032005 | Bacteria | 941 |
| 339 | Ga0307415_100684685 | 3300032126 | Bacteria | 923 |
| 340 | Ga0307415_101377680 | 3300032126 | Bacteria | 671 |
| 341 | Ga0373947_0803261 | 3300035725 | Unclassified | 642 |
| 342 | Ga0395899_0002439 | 3300037312 | Bacteria | 15118 |
| 343 | Ga0395899_0048931 | 3300037312 | Bacteria | 3143 |
| 344 | Ga0395899_0297830 | 3300037312 | Bacteria | 1092 |
| 345 | Ga0395900_0015549 | 3300037418 | Bacteria | 7756 |
| 346 | Ga0395900_0078098 | 3300037418 | Bacteria | 3401 |
| 347 | Ga0395900_0134804 | 3300037418 | Bacteria | 2529 |
| 348 | Ga0395898_0001404 | 3300037466 | Bacteria | 34348 |
| 349 | Ga0395905_0039364 | 3300037471 | Bacteria | 4435 |
| 350 | Ga0395905_0081911 | 3300037471 | Bacteria | 3024 |
| 351 | Ga0395905_0131663 | 3300037471 | Bacteria | 2352 |
| 352 | Ga0395901_0003763 | 3300038443 | Bacteria | 15291 |
| 353 | Ga0395901_0021179 | 3300038443 | Bacteria | 6659 |
| 354 | Ga0395901_0265330 | 3300038443 | Unclassified | 1786 |
| 355 | Ga0395901_0578583 | 3300038443 | Unclassified | 1135 |
| 356 | Ga0395901_1348362 | 3300038443 | Bacteria | 673 |
| 357 | Ga0242420_000704 | 3300038996 | Archaea | 3994 |
| 358 | Ga0451793_1131357 | 3300041452 | Bacteria | 1100 |
| 359 | Ga0439443_008932 | 3300042003 | Archaea | 1426 |
| 360 | Ga0439440_0009859 | 3300042993 | Archaea | 1985 |
| 361 | Ga0451576_2666389 | 3300045051 | Archaea | 509 |
| 362 | Ga0495613_0531288 | 3300046689 | Bacteria | 789 |
| 363 | Ga0495675_0572735 | 3300047444 | Bacteria | 642 |
| 364 | Ga0496102_0193893 | 3300048905 | Bacteria | 1915 |
| 365 | Ga0496102_1781628 | 3300048905 | Bacteria | 533 |
| 366 | Ga0496106_1138611 | 3300048909 | Unclassified | 610 |
| 367 | Ga0496107_0146039 | 3300048910 | Archaea | 1749 |
| 368 | Ga0496112_1306100 | 3300048915 | Archaea | 641 |
| 369 | Ga0496115_0730645 | 3300048918 | Unclassified | 776 |
| 370 | Ga0496121_0129682 | 3300048924 | Bacteria | 1890 |
| 371 | Ga0496124_0252369 | 3300048927 | Bacteria | 1304 |
| 372 | Ga0501033_0274920 | 3300049570 | Bacteria | 1190 |
| 373 | Ga0501043_0052650 | 3300049579 | Bacteria | 3197 |
| 374 | Ga0501047_0442695 | 3300049581 | Bacteria | 1129 |
| 375 | Ga0501069_0089519 | 3300049585 | Archaea | 1740 |
| 376 | Ga0501083_0127151 | 3300049744 | Bacteria | 1670 |
| 377 | Ga0501044_0140625 | 3300049823 | Bacteria | 2403 |
| 378 | nmdc:mga00v17_543968_c1 | 3300050491 | Unclassified | 751 |
| 379 | nmdc:mga00v17_723_c1 | 3300050491 | Bacteria | 18023 |
| 380 | nmdc:mga0yw44_127_c1 | 3300050492 | Bacteria | 26145 |
| 381 | nmdc:mga05p37_14906_c1 | 3300050507 | Archaea | 9334 |
| 382 | nmdc:mga05p37_344571_c1 | 3300050507 | Bacteria | 1756 |
| 383 | nmdc:mga05p37_54717_c1 | 3300050507 | Archaea | 4909 |
| 384 | nmdc:mga05p37_563393_c1 | 3300050507 | Unclassified | 1294 |
| 385 | nmdc:mga05p37_670557_c1 | 3300050507 | Archaea | 1158 |
| 386 | nmdc:mga09592_157948_c1 | 3300050508 | Archaea | 1958 |
| 387 | nmdc:mga09592_525131_c1 | 3300050508 | Unclassified | 1018 |
| 388 | nmdc:mga06r32_435152_c1 | 3300050510 | Unclassified | 1292 |
| 389 | nmdc:mga06r32_610666_c1 | 3300050510 | Archaea | 1061 |
| 390 | nmdc:mga08y16_163094_c1 | 3300050511 | Archaea | 2316 |
| 391 | nmdc:mga08y16_245930_c1 | 3300050511 | Archaea | 1849 |
| 392 | nmdc:mga0n895_100325_c1 | 3300050512 | Archaea | 2904 |
| 393 | nmdc:mga08x19_24625_c1 | 3300050514 | Archaea | 3743 |
| 394 | nmdc:mga0a205_1084529_c1 | 3300050515 | Unclassified | 648 |
| 395 | nmdc:mga0a205_279868_c1 | 3300050515 | Archaea | 1544 |
| 396 | Ga0495619_1012746 | 3300053085 | Unclassified | 555 |
| 397 | Ga0500651_0258252 | 3300053093 | Bacteria | 1011 |
| 398 | Ga0500562_000198 | 3300053108 | Bacteria | 16330 |
| 399 | Ga0500559_0000192 | 3300053136 | Bacteria | 49223 |
| 400 | Ga0500561_0000002 | 3300053137 | Bacteria | 394147 |
| 401 | Ga0500645_019070 | 3300053730 | Bacteria | 2136 |
| 402 | Ga0500661_014997 | 3300055283 | Bacteria | 1392 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030734 | Ga0316179_1003690 | Ga0316179_10036902 | 102 |
| 2 | 3300050508 | nmdc:mga09592_525131_c1 | nmdc:mga09592_525131_c1_663_1001 | 109 |
| 3 | 3300005536 | Ga0070697_101845955 | Ga0070697_1018459551 | 110 |
| 4 | 3300005545 | Ga0070695_101066446 | Ga0070695_1010664461 | 110 |
| 5 | 3300025981 | Ga0207640_10010034 | Ga0207640_100100344 | 118 |
| 6 | 3300053093 | Ga0500651_0258252 | Ga0500651_0258252_327_704 | 118 |
| 7 | 3300053136 | Ga0500559_0000192 | Ga0500559_0000192_31989_32366 | 118 |
| 8 | iso_pu_bacteria | 2643221635 | 2644198216 | 118 |
| 9 | 3300005471 | Ga0070698_100001367 | Ga0070698_10000136725 | 119 |
| 10 | 3300005337 | Ga0070682_100590255 | Ga0070682_1005902552 | 120 |
| 11 | 3300005440 | Ga0070705_101119675 | Ga0070705_1011196752 | 120 |
| 12 | 3300005459 | Ga0068867_100198173 | Ga0068867_1001981732 | 120 |
| 13 | 3300009098 | Ga0105245_10166103 | Ga0105245_101661032 | 120 |
| 14 | 3300009148 | Ga0105243_10011180 | Ga0105243_100111804 | 120 |
| 15 | 3300009174 | Ga0105241_11041628 | Ga0105241_110416282 | 120 |
| 16 | 3300013102 | Ga0157371_10000561 | Ga0157371_1000056128 | 120 |
| 17 | 3300025927 | Ga0207687_10854479 | Ga0207687_108544792 | 120 |
| 18 | 3300025935 | Ga0207709_10007272 | Ga0207709_100072726 | 120 |
| 19 | 3300048918 | Ga0496115_0730645 | Ga0496115_0730645_106_486 | 120 |
| 20 | 3300053137 | Ga0500561_0000002 | Ga0500561_0000002_89437_89820 | 120 |
| 21 | 3300005293 | Ga0065715_10768800 | Ga0065715_107688001 | 121 |
| 22 | 3300005439 | Ga0070711_101381521 | Ga0070711_1013815211 | 121 |
| 23 | 3300005440 | Ga0070705_100369414 | Ga0070705_1003694143 | 121 |
| 24 | 3300005445 | Ga0070708_100158432 | Ga0070708_1001584322 | 121 |
| 25 | 3300005445 | Ga0070708_100445889 | Ga0070708_1004458892 | 121 |
| 26 | 3300005445 | Ga0070708_100722539 | Ga0070708_1007225392 | 121 |
| 27 | 3300005467 | Ga0070706_100002656 | Ga0070706_1000026569 | 121 |
| 28 | 3300005467 | Ga0070706_100213710 | Ga0070706_1002137102 | 121 |
| 29 | 3300005467 | Ga0070706_100310199 | Ga0070706_1003101993 | 121 |
| 30 | 3300005468 | Ga0070707_100012946 | Ga0070707_1000129465 | 121 |
| 31 | 3300005468 | Ga0070707_100018613 | Ga0070707_1000186134 | 121 |
| 32 | 3300005468 | Ga0070707_100395777 | Ga0070707_1003957772 | 121 |
| 33 | 3300005471 | Ga0070698_100004631 | Ga0070698_10000463111 | 121 |
| 34 | 3300005471 | Ga0070698_100487888 | Ga0070698_1004878882 | 121 |
| 35 | 3300005471 | Ga0070698_100559690 | Ga0070698_1005596902 | 121 |
| 36 | 3300005471 | Ga0070698_100635473 | Ga0070698_1006354731 | 121 |
| 37 | 3300005471 | Ga0070698_101278988 | Ga0070698_1012789882 | 121 |
| 38 | 3300005518 | Ga0070699_100003444 | Ga0070699_1000034442 | 121 |
| 39 | 3300005518 | Ga0070699_100517446 | Ga0070699_1005174462 | 121 |
| 40 | 3300005536 | Ga0070697_100000001 | Ga0070697_10000000129 | 121 |
| 41 | 3300005577 | Ga0068857_100631206 | Ga0068857_1006312061 | 121 |
| 42 | 3300005617 | Ga0068859_102865510 | Ga0068859_1028655101 | 121 |
| 43 | 3300006028 | Ga0070717_10158670 | Ga0070717_101586704 | 121 |
| 44 | 3300006028 | Ga0070717_11083123 | Ga0070717_110831232 | 121 |
| 45 | 3300006844 | Ga0075428_100293865 | Ga0075428_1002938651 | 121 |
| 46 | 3300009147 | Ga0114129_10153541 | Ga0114129_101535415 | 121 |
| 47 | 3300009147 | Ga0114129_12470517 | Ga0114129_124705171 | 121 |
| 48 | 3300025910 | Ga0207684_10001474 | Ga0207684_1000147419 | 121 |
| 49 | 3300025910 | Ga0207684_10156955 | Ga0207684_101569552 | 121 |
| 50 | 3300025910 | Ga0207684_10172492 | Ga0207684_101724922 | 121 |
| 51 | 3300025922 | Ga0207646_10013844 | Ga0207646_100138446 | 121 |
| 52 | 3300025922 | Ga0207646_10042615 | Ga0207646_100426152 | 121 |
| 53 | 3300025922 | Ga0207646_10098531 | Ga0207646_100985313 | 121 |
| 54 | 3300041452 | Ga0451793_1131357 | Ga0451793_1131357_459_842 | 121 |
| 55 | 3300046689 | Ga0495613_0531288 | Ga0495613_0531288_54_422 | 121 |
| 56 | 3300047444 | Ga0495675_0572735 | Ga0495675_0572735_20_388 | 121 |
| 57 | 3300048924 | Ga0496121_0129682 | Ga0496121_0129682_494_877 | 121 |
| 58 | 3300049570 | Ga0501033_0274920 | Ga0501033_0274920_404_784 | 121 |
| 59 | 3300049579 | Ga0501043_0052650 | Ga0501043_0052650_255_635 | 121 |
| 60 | 3300049581 | Ga0501047_0442695 | Ga0501047_0442695_26_406 | 121 |
| 61 | 3300049744 | Ga0501083_0127151 | Ga0501083_0127151_427_807 | 121 |
| 62 | 3300049823 | Ga0501044_0140625 | Ga0501044_0140625_219_599 | 121 |
| 63 | 3300050491 | nmdc:mga00v17_723_c1 | nmdc:mga00v17_723_c1_10068_10448 | 121 |
| 64 | 3300050492 | nmdc:mga0yw44_127_c1 | nmdc:mga0yw44_127_c1_4388_4768 | 121 |
| 65 | 3300053085 | Ga0495619_1012746 | Ga0495619_1012746_24_404 | 121 |
| 66 | 3300005331 | Ga0070670_101030808 | Ga0070670_1010308081 | 122 |
| 67 | 3300006173 | Ga0070716_100173273 | Ga0070716_1001732733 | 122 |
| 68 | 3300030733 | Ga0314311_1180264 | Ga0314311_11802641 | 122 |
| 69 | 3300031731 | Ga0307405_10563663 | Ga0307405_105636632 | 122 |
| 70 | 3300031824 | Ga0307413_11107950 | Ga0307413_111079502 | 122 |
| 71 | 3300031852 | Ga0307410_10364153 | Ga0307410_103641532 | 122 |
| 72 | 3300031903 | Ga0307407_10351542 | Ga0307407_103515423 | 122 |
| 73 | 3300032002 | Ga0307416_100458982 | Ga0307416_1004589822 | 122 |
| 74 | 3300032005 | Ga0307411_10608253 | Ga0307411_106082532 | 122 |
| 75 | 3300032126 | Ga0307415_100684685 | Ga0307415_1006846852 | 122 |
| 76 | 3300037312 | Ga0395899_0002439 | Ga0395899_0002439_5188_5580 | 122 |
| 77 | 3300037312 | Ga0395899_0048931 | Ga0395899_0048931_1655_2032 | 122 |
| 78 | 3300037312 | Ga0395899_0297830 | Ga0395899_0297830_262_639 | 122 |
| 79 | 3300037418 | Ga0395900_0015549 | Ga0395900_0015549_4753_5145 | 122 |
| 80 | 3300037418 | Ga0395900_0078098 | Ga0395900_0078098_1474_1851 | 122 |
| 81 | 3300037418 | Ga0395900_0134804 | Ga0395900_0134804_470_847 | 122 |
| 82 | 3300037466 | Ga0395898_0001404 | Ga0395898_0001404_8135_8527 | 122 |
| 83 | 3300037471 | Ga0395905_0039364 | Ga0395905_0039364_1432_1824 | 122 |
| 84 | 3300037471 | Ga0395905_0131663 | Ga0395905_0131663_1683_2060 | 122 |
| 85 | 3300038443 | Ga0395901_0003763 | Ga0395901_0003763_4818_5210 | 122 |
| 86 | 3300038443 | Ga0395901_0021179 | Ga0395901_0021179_448_834 | 122 |
| 87 | 3300038443 | Ga0395901_0265330 | Ga0395901_0265330_984_1361 | 122 |
| 88 | 3300038443 | Ga0395901_1348362 | Ga0395901_1348362_134_511 | 122 |
| 89 | 3300048905 | Ga0496102_0193893 | Ga0496102_0193893_139_522 | 122 |
| 90 | 3300048927 | Ga0496124_0252369 | Ga0496124_0252369_674_1060 | 122 |
| 91 | 3300003316 | rootH1_10004557 | rootH1_100045573 | 123 |
| 92 | 3300003316 | rootH1_10077413 | rootH1_100774133 | 123 |
| 93 | 3300003322 | rootL2_10220025 | rootL2_102200254 | 123 |
| 94 | 3300003322 | rootL2_10279067 | rootL2_102790672 | 123 |
| 95 | 3300005327 | Ga0070658_10031923 | Ga0070658_100319233 | 123 |
| 96 | 3300005336 | Ga0070680_100153106 | Ga0070680_1001531062 | 123 |
| 97 | 3300005337 | Ga0070682_100805845 | Ga0070682_1008058452 | 123 |
| 98 | 3300005339 | Ga0070660_100684287 | Ga0070660_1006842872 | 123 |
| 99 | 3300005458 | Ga0070681_11578031 | Ga0070681_115780311 | 123 |
| 100 | 3300005467 | Ga0070706_100172280 | Ga0070706_1001722803 | 123 |
| 101 | 3300005518 | Ga0070699_100775551 | Ga0070699_1007755511 | 123 |
| 102 | 3300005545 | Ga0070695_100223984 | Ga0070695_1002239842 | 123 |
| 103 | 3300005563 | Ga0068855_100014049 | Ga0068855_1000140499 | 123 |
| 104 | 3300005563 | Ga0068855_100888351 | Ga0068855_1008883511 | 123 |
| 105 | 3300005614 | Ga0068856_102297578 | Ga0068856_1022975781 | 123 |
| 106 | 3300005985 | Ga0081539_10254442 | Ga0081539_102544421 | 123 |
| 107 | 3300006038 | Ga0075365_10000397 | Ga0075365_100003976 | 123 |
| 108 | 3300006051 | Ga0075364_10001592 | Ga0075364_1000159211 | 123 |
| 109 | 3300006051 | Ga0075364_10838917 | Ga0075364_108389172 | 123 |
| 110 | 3300006852 | Ga0075433_11005205 | Ga0075433_110052051 | 123 |
| 111 | 3300009147 | Ga0114129_10271759 | Ga0114129_102717592 | 123 |
| 112 | 3300009147 | Ga0114129_10989770 | Ga0114129_109897702 | 123 |
| 113 | 3300009174 | Ga0105241_10548818 | Ga0105241_105488181 | 123 |
| 114 | 3300013100 | Ga0157373_10054985 | Ga0157373_100549853 | 123 |
| 115 | 3300013100 | Ga0157373_10349337 | Ga0157373_103493372 | 123 |
| 116 | 3300013102 | Ga0157371_10142868 | Ga0157371_101428682 | 123 |
| 117 | 3300013102 | Ga0157371_10715996 | Ga0157371_107159961 | 123 |
| 118 | 3300013104 | Ga0157370_10164386 | Ga0157370_101643864 | 123 |
| 119 | 3300013105 | Ga0157369_10021418 | Ga0157369_100214182 | 123 |
| 120 | 3300013105 | Ga0157369_11707508 | Ga0157369_117075081 | 123 |
| 121 | 3300013307 | Ga0157372_10851186 | Ga0157372_108511862 | 123 |
| 122 | 3300013307 | Ga0157372_11097845 | Ga0157372_110978451 | 123 |
| 123 | 3300025272 | Ga0209455_1001944 | Ga0209455_100194411 | 123 |
| 124 | 3300025910 | Ga0207684_10691065 | Ga0207684_106910651 | 123 |
| 125 | 3300025917 | Ga0207660_10183704 | Ga0207660_101837042 | 123 |
| 126 | 3300025919 | Ga0207657_11067201 | Ga0207657_110672011 | 123 |
| 127 | 3300025921 | Ga0207652_10025915 | Ga0207652_100259156 | 123 |
| 128 | 3300025929 | Ga0207664_10893449 | Ga0207664_108934491 | 123 |
| 129 | 3300026078 | Ga0207702_12154554 | Ga0207702_121545542 | 123 |
| 130 | 3300026116 | Ga0207674_10028979 | Ga0207674_100289794 | 123 |
| 131 | 3300028563 | Ga0265319_1201378 | Ga0265319_12013781 | 123 |
| 132 | 3300028577 | Ga0265318_10144146 | Ga0265318_101441462 | 123 |
| 133 | 3300028654 | Ga0265322_10058072 | Ga0265322_100580722 | 123 |
| 134 | 3300028800 | Ga0265338_10433601 | Ga0265338_104336011 | 123 |
| 135 | 3300031238 | Ga0265332_10148533 | Ga0265332_101485332 | 123 |
| 136 | 3300031240 | Ga0265320_10102805 | Ga0265320_101028052 | 123 |
| 137 | 3300031249 | Ga0265339_10068463 | Ga0265339_100684632 | 123 |
| 138 | 3300031344 | Ga0265316_10010993 | Ga0265316_100109932 | 123 |
| 139 | 3300031548 | Ga0307408_100463707 | Ga0307408_1004637072 | 123 |
| 140 | 3300031712 | Ga0265342_10156904 | Ga0265342_101569041 | 123 |
| 141 | 3300031824 | Ga0307413_11862547 | Ga0307413_118625471 | 123 |
| 142 | 3300031995 | Ga0307409_100273991 | Ga0307409_1002739912 | 123 |
| 143 | 3300032004 | Ga0307414_11429522 | Ga0307414_114295222 | 123 |
| 144 | 3300035725 | Ga0373947_0803261 | Ga0373947_0803261_17_424 | 123 |
| 145 | 3300050491 | nmdc:mga00v17_543968_c1 | nmdc:mga00v17_543968_c1_212_601 | 123 |
| 146 | 3300050507 | nmdc:mga05p37_563393_c1 | nmdc:mga05p37_563393_c1_381_788 | 123 |
| 147 | 3300050515 | nmdc:mga0a205_1084529_c1 | nmdc:mga0a205_1084529_c1_118_498 | 123 |
| 148 | 3300005440 | Ga0070705_101392502 | Ga0070705_1013925021 | 124 |
| 149 | 3300005445 | Ga0070708_100272853 | Ga0070708_1002728532 | 124 |
| 150 | 3300005467 | Ga0070706_100101879 | Ga0070706_1001018793 | 124 |
| 151 | 3300005468 | Ga0070707_100276020 | Ga0070707_1002760204 | 124 |
| 152 | 3300005981 | Ga0081538_10069935 | Ga0081538_100699352 | 124 |
| 153 | 3300009147 | Ga0114129_10005807 | Ga0114129_100058072 | 124 |
| 154 | 3300010375 | Ga0105239_11842797 | Ga0105239_118427971 | 124 |
| 155 | 3300010375 | Ga0105239_13116256 | Ga0105239_131162561 | 124 |
| 156 | 3300011119 | Ga0105246_10338772 | Ga0105246_103387722 | 124 |
| 157 | 3300013297 | Ga0157378_10034192 | Ga0157378_100341925 | 124 |
| 158 | 3300025922 | Ga0207646_11064117 | Ga0207646_110641172 | 124 |
| 159 | 3300025932 | Ga0207690_11597232 | Ga0207690_115972321 | 124 |
| 160 | 3300026142 | Ga0207698_11337972 | Ga0207698_113379721 | 124 |
| 161 | 3300031995 | Ga0307409_101204580 | Ga0307409_1012045801 | 124 |
| 162 | 3300032126 | Ga0307415_101377680 | Ga0307415_1013776801 | 124 |
| 163 | 3300037471 | Ga0395905_0081911 | Ga0395905_0081911_1965_2387 | 124 |
| 164 | 3300038443 | Ga0395901_0578583 | Ga0395901_0578583_530_952 | 124 |
| 165 | 3300038996 | Ga0242420_000704 | Ga0242420_000704_265_639 | 124 |
| 166 | 3300048905 | Ga0496102_1781628 | Ga0496102_1781628_45_419 | 124 |
| 167 | 3300048909 | Ga0496106_1138611 | Ga0496106_1138611_22_396 | 124 |
| 168 | 3300048910 | Ga0496107_0146039 | Ga0496107_0146039_41_415 | 124 |
| 169 | 3300048915 | Ga0496112_1306100 | Ga0496112_1306100_73_447 | 124 |
| 170 | 3300049585 | Ga0501069_0089519 | Ga0501069_0089519_1286_1660 | 124 |
| 171 | 3300050507 | nmdc:mga05p37_14906_c1 | nmdc:mga05p37_14906_c1_359_733 | 124 |
| 172 | 3300050510 | nmdc:mga06r32_435152_c1 | nmdc:mga06r32_435152_c1_161_541 | 124 |
| 173 | 3300050512 | nmdc:mga0n895_100325_c1 | nmdc:mga0n895_100325_c1_217_591 | 124 |
| 174 | 3300050514 | nmdc:mga08x19_24625_c1 | nmdc:mga08x19_24625_c1_1731_2105 | 124 |
| 175 | 3300050515 | nmdc:mga0a205_279868_c1 | nmdc:mga0a205_279868_c1_808_1182 | 124 |
| 176 | 3300053108 | Ga0500562_000198 | Ga0500562_000198_8532_8921 | 124 |
| 177 | 3300053730 | Ga0500645_019070 | Ga0500645_019070_1244_1633 | 124 |
| 178 | 3300055283 | Ga0500661_014997 | Ga0500661_014997_387_776 | 124 |
| 179 | 3300005336 | Ga0070680_100072664 | Ga0070680_1000726642 | 125 |
| 180 | 3300005344 | Ga0070661_100244712 | Ga0070661_1002447122 | 125 |
| 181 | 3300005457 | Ga0070662_100026840 | Ga0070662_1000268404 | 125 |
| 182 | 3300005458 | Ga0070681_10030325 | Ga0070681_100303254 | 125 |
| 183 | 3300005530 | Ga0070679_100086901 | Ga0070679_1000869014 | 125 |
| 184 | 3300005539 | Ga0068853_100067878 | Ga0068853_1000678782 | 125 |
| 185 | 3300005563 | Ga0068855_100069509 | Ga0068855_1000695096 | 125 |
| 186 | 3300005577 | Ga0068857_100065097 | Ga0068857_1000650971 | 125 |
| 187 | 3300005577 | Ga0068857_100639198 | Ga0068857_1006391981 | 125 |
| 188 | 3300005614 | Ga0068856_100129581 | Ga0068856_1001295812 | 125 |
| 189 | 3300005834 | Ga0068851_10296677 | Ga0068851_102966771 | 125 |
| 190 | 3300009545 | Ga0105237_10649502 | Ga0105237_106495022 | 125 |
| 191 | 3300010375 | Ga0105239_10681036 | Ga0105239_106810362 | 125 |
| 192 | 3300013100 | Ga0157373_10040781 | Ga0157373_100407815 | 125 |
| 193 | 3300013104 | Ga0157370_10356672 | Ga0157370_103566722 | 125 |
| 194 | 3300013105 | Ga0157369_10412099 | Ga0157369_104120992 | 125 |
| 195 | 3300025910 | Ga0207684_10178415 | Ga0207684_101784153 | 125 |
| 196 | 3300025912 | Ga0207707_11359494 | Ga0207707_113594941 | 125 |
| 197 | 3300025917 | Ga0207660_10232991 | Ga0207660_102329912 | 125 |
| 198 | 3300025919 | Ga0207657_10031076 | Ga0207657_100310766 | 125 |
| 199 | 3300025920 | Ga0207649_10253069 | Ga0207649_102530692 | 125 |
| 200 | 3300025921 | Ga0207652_10223144 | Ga0207652_102231442 | 125 |
| 201 | 3300025932 | Ga0207690_10220746 | Ga0207690_102207462 | 125 |
| 202 | 3300025945 | Ga0207679_10356971 | Ga0207679_103569712 | 125 |
| 203 | 3300025949 | Ga0207667_10087767 | Ga0207667_100877672 | 125 |
| 204 | 3300026041 | Ga0207639_10878826 | Ga0207639_108788261 | 125 |
| 205 | 3300026116 | Ga0207674_10020812 | Ga0207674_100208121 | 125 |
| 206 | 2162886006 | SwRhRL3b_contig_2609502 | SwRhRL3b_0932.00001710 | 126 |
| 207 | 2162886006 | SwRhRL3b_contig_378765 | SwRhRL3b_0290.00001130 | 126 |
| 208 | 2162886011 | MRS1b_contig_6031450 | MRS1b_0547.00000760 | 126 |
| 209 | 2209111006 | 2214828557 | 2213866953 | 126 |
| 210 | 3300000041 | ARcpr5oldR_c000714 | ARcpr5oldR_0007146 | 126 |
| 211 | 3300000042 | ARSoilYngRDRAFT_c00715 | ARSoilYngRDRAFT_007155 | 126 |
| 212 | 3300000652 | ARCol0yngRDRAFT_1000102 | ARCol0yngRDRAFT_10001025 | 126 |
| 213 | 3300001990 | JGI24737J22298_10028520 | JGI24737J22298_100285204 | 126 |
| 214 | 3300002155 | JGI24033J26618_1006462 | JGI24033J26618_10064621 | 126 |
| 215 | 3300003349 | JGI26129J50193_1000420 | JGI26129J50193_10004203 | 126 |
| 216 | 3300003371 | JGI26145J50221_1000028 | JGI26145J50221_10000287 | 126 |
| 217 | 3300003379 | JGI26142J50222_100784 | JGI26142J50222_1007841 | 126 |
| 218 | 3300003383 | JGI26140J50224_101077 | JGI26140J50224_1010772 | 126 |
| 219 | 3300003392 | JGI26134J50242_100224 | JGI26134J50242_1002244 | 126 |
| 220 | 3300003399 | JGI26136J50244_100409 | JGI26136J50244_1004092 | 126 |
| 221 | 3300003400 | JGI26131J50246_100106 | JGI26131J50246_1001066 | 126 |
| 222 | 3300003504 | JGI26138J51218_100218 | JGI26138J51218_1002184 | 126 |
| 223 | 3300005277 | Ga0065716_1000223 | Ga0065716_10002232 | 126 |
| 224 | 3300005289 | Ga0065704_10631375 | Ga0065704_106313751 | 126 |
| 225 | 3300005290 | Ga0065712_10001104 | Ga0065712_1000110425 | 126 |
| 226 | 3300005293 | Ga0065715_10126374 | Ga0065715_101263743 | 126 |
| 227 | 3300005293 | Ga0065715_10256125 | Ga0065715_102561251 | 126 |
| 228 | 3300005295 | Ga0065707_10000638 | Ga0065707_100006388 | 126 |
| 229 | 3300005328 | Ga0070676_10266664 | Ga0070676_102666641 | 126 |
| 230 | 3300005328 | Ga0070676_10680272 | Ga0070676_106802722 | 126 |
| 231 | 3300005331 | Ga0070670_100024010 | Ga0070670_1000240102 | 126 |
| 232 | 3300005331 | Ga0070670_100215903 | Ga0070670_1002159031 | 126 |
| 233 | 3300005331 | Ga0070670_101409041 | Ga0070670_1014090411 | 126 |
| 234 | 3300005333 | Ga0070677_10030635 | Ga0070677_100306351 | 126 |
| 235 | 3300005334 | Ga0068869_100015806 | Ga0068869_1000158062 | 126 |
| 236 | 3300005336 | Ga0070680_100089619 | Ga0070680_1000896192 | 126 |
| 237 | 3300005336 | Ga0070680_100305252 | Ga0070680_1003052521 | 126 |
| 238 | 3300005336 | Ga0070680_101522317 | Ga0070680_1015223172 | 126 |
| 239 | 3300005343 | Ga0070687_100952626 | Ga0070687_1009526261 | 126 |
| 240 | 3300005343 | Ga0070687_100965406 | Ga0070687_1009654061 | 126 |
| 241 | 3300005344 | Ga0070661_100279848 | Ga0070661_1002798483 | 126 |
| 242 | 3300005345 | Ga0070692_10120184 | Ga0070692_101201842 | 126 |
| 243 | 3300005347 | Ga0070668_100036975 | Ga0070668_1000369753 | 126 |
| 244 | 3300005353 | Ga0070669_100262555 | Ga0070669_1002625551 | 126 |
| 245 | 3300005353 | Ga0070669_100711579 | Ga0070669_1007115791 | 126 |
| 246 | 3300005355 | Ga0070671_100982258 | Ga0070671_1009822581 | 126 |
| 247 | 3300005356 | Ga0070674_100147685 | Ga0070674_1001476854 | 126 |
| 248 | 3300005356 | Ga0070674_101617205 | Ga0070674_1016172051 | 126 |
| 249 | 3300005364 | Ga0070673_100246124 | Ga0070673_1002461241 | 126 |
| 250 | 3300005366 | Ga0070659_100075053 | Ga0070659_1000750535 | 126 |
| 251 | 3300005366 | Ga0070659_101486574 | Ga0070659_1014865741 | 126 |
| 252 | 3300005367 | Ga0070667_101040279 | Ga0070667_1010402791 | 126 |
| 253 | 3300005438 | Ga0070701_10300538 | Ga0070701_103005382 | 126 |
| 254 | 3300005440 | Ga0070705_100506300 | Ga0070705_1005063001 | 126 |
| 255 | 3300005440 | Ga0070705_101909531 | Ga0070705_1019095311 | 126 |
| 256 | 3300005441 | Ga0070700_100257274 | Ga0070700_1002572741 | 126 |
| 257 | 3300005444 | Ga0070694_100048022 | Ga0070694_1000480224 | 126 |
| 258 | 3300005444 | Ga0070694_100545810 | Ga0070694_1005458101 | 126 |
| 259 | 3300005444 | Ga0070694_100868691 | Ga0070694_1008686911 | 126 |
| 260 | 3300005445 | Ga0070708_101645219 | Ga0070708_1016452191 | 126 |
| 261 | 3300005445 | Ga0070708_102225838 | Ga0070708_1022258381 | 126 |
| 262 | 3300005455 | Ga0070663_100396803 | Ga0070663_1003968032 | 126 |
| 263 | 3300005457 | Ga0070662_100734424 | Ga0070662_1007344242 | 126 |
| 264 | 3300005457 | Ga0070662_100889937 | Ga0070662_1008899372 | 126 |
| 265 | 3300005459 | Ga0068867_100019669 | Ga0068867_1000196692 | 126 |
| 266 | 3300005459 | Ga0068867_100050804 | Ga0068867_1000508042 | 126 |
| 267 | 3300005468 | Ga0070707_100533250 | Ga0070707_1005332501 | 126 |
| 268 | 3300005471 | Ga0070698_100478019 | Ga0070698_1004780192 | 126 |
| 269 | 3300005518 | Ga0070699_100868524 | Ga0070699_1008685241 | 126 |
| 270 | 3300005530 | Ga0070679_100283603 | Ga0070679_1002836032 | 126 |
| 271 | 3300005535 | Ga0070684_100603827 | Ga0070684_1006038271 | 126 |
| 272 | 3300005536 | Ga0070697_100632309 | Ga0070697_1006323092 | 126 |
| 273 | 3300005543 | Ga0070672_100006602 | Ga0070672_1000066024 | 126 |
| 274 | 3300005543 | Ga0070672_100202423 | Ga0070672_1002024231 | 126 |
| 275 | 3300005544 | Ga0070686_101451426 | Ga0070686_1014514262 | 126 |
| 276 | 3300005545 | Ga0070695_100296557 | Ga0070695_1002965571 | 126 |
| 277 | 3300005546 | Ga0070696_100552743 | Ga0070696_1005527432 | 126 |
| 278 | 3300005546 | Ga0070696_100647967 | Ga0070696_1006479671 | 126 |
| 279 | 3300005546 | Ga0070696_100732307 | Ga0070696_1007323072 | 126 |
| 280 | 3300005547 | Ga0070693_100315971 | Ga0070693_1003159712 | 126 |
| 281 | 3300005549 | Ga0070704_100459917 | Ga0070704_1004599172 | 126 |
| 282 | 3300005577 | Ga0068857_100209984 | Ga0068857_1002099843 | 126 |
| 283 | 3300005577 | Ga0068857_101109438 | Ga0068857_1011094381 | 126 |
| 284 | 3300005578 | Ga0068854_101258258 | Ga0068854_1012582581 | 126 |
| 285 | 3300005616 | Ga0068852_100077947 | Ga0068852_1000779472 | 126 |
| 286 | 3300005616 | Ga0068852_101837998 | Ga0068852_1018379981 | 126 |
| 287 | 3300005617 | Ga0068859_100234716 | Ga0068859_1002347165 | 126 |
| 288 | 3300005617 | Ga0068859_100489792 | Ga0068859_1004897922 | 126 |
| 289 | 3300005618 | Ga0068864_100013556 | Ga0068864_1000135563 | 126 |
| 290 | 3300005719 | Ga0068861_101305040 | Ga0068861_1013050402 | 126 |
| 291 | 3300005840 | Ga0068870_10065216 | Ga0068870_100652162 | 126 |
| 292 | 3300005840 | Ga0068870_10153255 | Ga0068870_101532552 | 126 |
| 293 | 3300005843 | Ga0068860_100603659 | Ga0068860_1006036591 | 126 |
| 294 | 3300005843 | Ga0068860_100653181 | Ga0068860_1006531812 | 126 |
| 295 | 3300005844 | Ga0068862_100069743 | Ga0068862_1000697433 | 126 |
| 296 | 3300005844 | Ga0068862_100145353 | Ga0068862_1001453534 | 126 |
| 297 | 3300006058 | Ga0075432_10340866 | Ga0075432_103408661 | 126 |
| 298 | 3300006237 | Ga0097621_100325126 | Ga0097621_1003251263 | 126 |
| 299 | 3300006844 | Ga0075428_100174761 | Ga0075428_1001747612 | 126 |
| 300 | 3300006844 | Ga0075428_101665393 | Ga0075428_1016653931 | 126 |
| 301 | 3300006852 | Ga0075433_10259021 | Ga0075433_102590213 | 126 |
| 302 | 3300006871 | Ga0075434_100048138 | Ga0075434_1000481385 | 126 |
| 303 | 3300006880 | Ga0075429_100744569 | Ga0075429_1007445691 | 126 |
| 304 | 3300006880 | Ga0075429_100754159 | Ga0075429_1007541592 | 126 |
| 305 | 3300006881 | Ga0068865_100417301 | Ga0068865_1004173011 | 126 |
| 306 | 3300006914 | Ga0075436_100058308 | Ga0075436_1000583084 | 126 |
| 307 | 3300006931 | Ga0097620_100234724 | Ga0097620_1002347245 | 126 |
| 308 | 3300006931 | Ga0097620_100489823 | Ga0097620_1004898232 | 126 |
| 309 | 3300009147 | Ga0114129_10064747 | Ga0114129_100647474 | 126 |
| 310 | 3300009147 | Ga0114129_10242081 | Ga0114129_102420813 | 126 |
| 311 | 3300009147 | Ga0114129_10888519 | Ga0114129_108885191 | 126 |
| 312 | 3300009176 | Ga0105242_10021814 | Ga0105242_100218142 | 126 |
| 313 | 3300009553 | Ga0105249_10517857 | Ga0105249_105178571 | 126 |
| 314 | 3300009553 | Ga0105249_12427593 | Ga0105249_124275931 | 126 |
| 315 | 3300010375 | Ga0105239_10594223 | Ga0105239_105942232 | 126 |
| 316 | 3300011119 | Ga0105246_10026473 | Ga0105246_100264731 | 126 |
| 317 | 3300011119 | Ga0105246_10360005 | Ga0105246_103600051 | 126 |
| 318 | 3300012473 | Ga0157340_1000524 | Ga0157340_10005242 | 126 |
| 319 | 3300012477 | Ga0157336_1001260 | Ga0157336_10012601 | 126 |
| 320 | 3300012483 | Ga0157337_1000262 | Ga0157337_10002623 | 126 |
| 321 | 3300012494 | Ga0157341_1007661 | Ga0157341_10076611 | 126 |
| 322 | 3300012498 | Ga0157345_1001292 | Ga0157345_10012922 | 126 |
| 323 | 3300012503 | Ga0157313_1000116 | Ga0157313_10001161 | 126 |
| 324 | 3300012510 | Ga0157316_1001849 | Ga0157316_10018493 | 126 |
| 325 | 3300012515 | Ga0157338_1010696 | Ga0157338_10106962 | 126 |
| 326 | 3300013297 | Ga0157378_10046095 | Ga0157378_100460954 | 126 |
| 327 | 3300013308 | Ga0157375_11421371 | Ga0157375_114213711 | 126 |
| 328 | 3300013308 | Ga0157375_11479925 | Ga0157375_114799251 | 126 |
| 329 | 3300014326 | Ga0157380_10095271 | Ga0157380_100952714 | 126 |
| 330 | 3300014326 | Ga0157380_10492354 | Ga0157380_104923542 | 126 |
| 331 | 3300025893 | Ga0207682_10031172 | Ga0207682_100311724 | 126 |
| 332 | 3300025899 | Ga0207642_10013096 | Ga0207642_100130962 | 126 |
| 333 | 3300025899 | Ga0207642_10502493 | Ga0207642_105024932 | 126 |
| 334 | 3300025904 | Ga0207647_10017360 | Ga0207647_100173601 | 126 |
| 335 | 3300025907 | Ga0207645_10006750 | Ga0207645_1000675012 | 126 |
| 336 | 3300025907 | Ga0207645_10012571 | Ga0207645_100125718 | 126 |
| 337 | 3300025908 | Ga0207643_10002365 | Ga0207643_100023655 | 126 |
| 338 | 3300025908 | Ga0207643_10017433 | Ga0207643_100174333 | 126 |
| 339 | 3300025912 | Ga0207707_10204196 | Ga0207707_102041963 | 126 |
| 340 | 3300025917 | Ga0207660_10786452 | Ga0207660_107864521 | 126 |
| 341 | 3300025917 | Ga0207660_11186690 | Ga0207660_111866901 | 126 |
| 342 | 3300025918 | Ga0207662_10348527 | Ga0207662_103485272 | 126 |
| 343 | 3300025919 | Ga0207657_11375039 | Ga0207657_113750391 | 126 |
| 344 | 3300025921 | Ga0207652_10524150 | Ga0207652_105241502 | 126 |
| 345 | 3300025923 | Ga0207681_10322683 | Ga0207681_103226831 | 126 |
| 346 | 3300025923 | Ga0207681_10871403 | Ga0207681_108714031 | 126 |
| 347 | 3300025925 | Ga0207650_10013622 | Ga0207650_100136224 | 126 |
| 348 | 3300025925 | Ga0207650_10064384 | Ga0207650_100643842 | 126 |
| 349 | 3300025932 | Ga0207690_10312737 | Ga0207690_103127371 | 126 |
| 350 | 3300025933 | Ga0207706_10032443 | Ga0207706_100324431 | 126 |
| 351 | 3300025937 | Ga0207669_10941902 | Ga0207669_109419021 | 126 |
| 352 | 3300025938 | Ga0207704_10083022 | Ga0207704_100830221 | 126 |
| 353 | 3300025938 | Ga0207704_10825998 | Ga0207704_108259981 | 126 |
| 354 | 3300025940 | Ga0207691_10028158 | Ga0207691_100281583 | 126 |
| 355 | 3300025942 | Ga0207689_10016242 | Ga0207689_100162423 | 126 |
| 356 | 3300025945 | Ga0207679_10054451 | Ga0207679_100544513 | 126 |
| 357 | 3300025960 | Ga0207651_10111367 | Ga0207651_101113671 | 126 |
| 358 | 3300025961 | Ga0207712_10261538 | Ga0207712_102615382 | 126 |
| 359 | 3300025981 | Ga0207640_10220196 | Ga0207640_102201963 | 126 |
| 360 | 3300026023 | Ga0207677_10808971 | Ga0207677_108089711 | 126 |
| 361 | 3300026067 | Ga0207678_10385647 | Ga0207678_103856472 | 126 |
| 362 | 3300026075 | Ga0207708_10022390 | Ga0207708_100223901 | 126 |
| 363 | 3300026075 | Ga0207708_10147409 | Ga0207708_101474092 | 126 |
| 364 | 3300026075 | Ga0207708_10646664 | Ga0207708_106466641 | 126 |
| 365 | 3300026089 | Ga0207648_10016887 | Ga0207648_100168873 | 126 |
| 366 | 3300026089 | Ga0207648_10042357 | Ga0207648_100423575 | 126 |
| 367 | 3300026095 | Ga0207676_10113290 | Ga0207676_101132902 | 126 |
| 368 | 3300026116 | Ga0207674_10135805 | Ga0207674_101358054 | 126 |
| 369 | 3300026118 | Ga0207675_100632627 | Ga0207675_1006326271 | 126 |
| 370 | 3300026121 | Ga0207683_10296026 | Ga0207683_102960262 | 126 |
| 371 | 3300026121 | Ga0207683_10484002 | Ga0207683_104840022 | 126 |
| 372 | 3300026142 | Ga0207698_10017033 | Ga0207698_100170336 | 126 |
| 373 | 3300027252 | Ga0209973_1000801 | Ga0209973_10008011 | 126 |
| 374 | 3300027364 | Ga0209967_1020207 | Ga0209967_10202072 | 126 |
| 375 | 3300027378 | Ga0209981_1026234 | Ga0209981_10262341 | 126 |
| 376 | 3300027462 | Ga0210000_1003097 | Ga0210000_10030972 | 126 |
| 377 | 3300027471 | Ga0209995_1000182 | Ga0209995_10001826 | 126 |
| 378 | 3300027471 | Ga0209995_1033242 | Ga0209995_10332421 | 126 |
| 379 | 3300027526 | Ga0209968_1000164 | Ga0209968_10001649 | 126 |
| 380 | 3300027543 | Ga0209999_1002675 | Ga0209999_10026754 | 126 |
| 381 | 3300027543 | Ga0209999_1019675 | Ga0209999_10196752 | 126 |
| 382 | 3300027543 | Ga0209999_1073204 | Ga0209999_10732041 | 126 |
| 383 | 3300027552 | Ga0209982_1000463 | Ga0209982_10004638 | 126 |
| 384 | 3300027614 | Ga0209970_1009869 | Ga0209970_10098692 | 126 |
| 385 | 3300027665 | Ga0209983_1001356 | Ga0209983_10013563 | 126 |
| 386 | 3300027682 | Ga0209971_1002213 | Ga0209971_10022135 | 126 |
| 387 | 3300027695 | Ga0209966_1000520 | Ga0209966_10005207 | 126 |
| 388 | 3300027876 | Ga0209974_10002674 | Ga0209974_100026748 | 126 |
| 389 | 3300027907 | Ga0207428_10031641 | Ga0207428_100316414 | 126 |
| 390 | 3300028380 | Ga0268265_10203701 | Ga0268265_102037012 | 126 |
| 391 | 3300028380 | Ga0268265_10337788 | Ga0268265_103377883 | 126 |
| 392 | 3300028381 | Ga0268264_10476546 | Ga0268264_104765461 | 126 |
| 393 | 3300042003 | Ga0439443_008932 | Ga0439443_008932_858_1238 | 126 |
| 394 | 3300042993 | Ga0439440_0009859 | Ga0439440_0009859_1285_1665 | 126 |
| 395 | 3300045051 | Ga0451576_2666389 | Ga0451576_2666389_45_425 | 126 |
| 396 | 3300050507 | nmdc:mga05p37_344571_c1 | nmdc:mga05p37_344571_c1_265_645 | 126 |
| 397 | 3300050507 | nmdc:mga05p37_54717_c1 | nmdc:mga05p37_54717_c1_493_873 | 126 |
| 398 | 3300050507 | nmdc:mga05p37_670557_c1 | nmdc:mga05p37_670557_c1_66_446 | 126 |
| 399 | 3300050508 | nmdc:mga09592_157948_c1 | nmdc:mga09592_157948_c1_415_795 | 126 |
| 400 | 3300050510 | nmdc:mga06r32_610666_c1 | nmdc:mga06r32_610666_c1_554_934 | 126 |
| 401 | 3300050511 | nmdc:mga08y16_163094_c1 | nmdc:mga08y16_163094_c1_711_1091 | 126 |
| 402 | 3300050511 | nmdc:mga08y16_245930_c1 | nmdc:mga08y16_245930_c1_864_1244 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nb0-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution | 0.7841 | 6 | 122 |
| 4nb1-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide | 0.7649 | 6 | 122 |
| 2p7k-assembly1.cif.gz_B | crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) | 0.7637 | 6 | 126 |
| 4nb2-assembly1.cif.gz_A | crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure | 0.7622 | 7 | 126 |
| 3vcx-assembly1.cif.gz_A | crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 | 0.7594 | 7 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kjzB01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7673 | 10 | 55 | 3.30.720.120 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7644 | 63 | 126 | 3.30.720.110 |
| 3sk1C01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7638 | 7 | 55 | 3.30.720.120 |
| 2p7kA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7591 | 6 | 126 | 3.10.180.10 |
| af_O06412_6_120_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7556 | 9 | 126 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R7EJ75-F1-model_v4 | deleted | 0.9808 | 4 | 126 |
|
| AF-A0A1N7R5G9-F1-model_v4 | VOC domain-containing protein | 0.9774 | 2 | 126 |
|
| AF-A0A495WKB7-F1-model_v4 | deleted | 0.972 | 6 | 124 |
|
| AF-A0A1N7R5G9-F1-model_v4 | VOC domain-containing protein | 0.9623 | 2 | 126 |
|
| AF-A0A3D5SN61-F1-model_v4 | Glyoxalase | 0.962 | 4 | 112 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar