F435017

General Info

Members Datasets Scaffolds Average Seq Length
402 238 402 128

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100072664|Ga0070680_1000726642
Length 147
Sequence MAQKAVETKQPNFNLFRQSAAFSSFSVNDLNKAQEFYGSTLGLETTKTPEGLMLRIAGGSPIFIYPKSNHTPASFTILNFPVDDIDEAVDELTKRGIHFESYNEPMKTDEKGIHRGESTGQGPNIAWFKDPAGNFLSVLENTGSADQ

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
5 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
6 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
13 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
14 3300003379 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM Metagenome Rhizosphere
15 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
16 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
17 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
18 3300003400 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM Metagenome Rhizosphere
19 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
20 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
104 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
105 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
106 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
107 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
108 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
109 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
110 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
181 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
234 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
237 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
238 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 1.74
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2609502 2162886006 Archaea 1512
2 SwRhRL3b_contig_378765 2162886006 Archaea 1790
3 MRS1b_contig_6031450 2162886011 Archaea 1637
4 2214828557 2209111006 Archaea 1806
5 ARcpr5oldR_c000714 3300000041 Archaea 3827
6 ARSoilYngRDRAFT_c00715 3300000042 Archaea 3080
7 ARCol0yngRDRAFT_1000102 3300000652 Archaea 15846
8 JGI24737J22298_10028520 3300001990 Unclassified 1754
9 JGI24033J26618_1006462 3300002155 Archaea 1316
10 rootH1_10004557 3300003316 Bacteria 1533
11 rootH1_10004557 3300003323 Bacteria 5638
12 rootH1_10077413 3300003316 Bacteria 1826
13 rootL2_10220025 3300003322 Unclassified 3332
14 rootL2_10279067 3300003322 Bacteria 1392
15 JGI26129J50193_1000420 3300003349 Archaea 2632
16 JGI26145J50221_1000028 3300003371 Archaea 10329
17 JGI26142J50222_100784 3300003379 Archaea 1009
18 JGI26140J50224_101077 3300003383 Archaea 990
19 JGI26134J50242_100224 3300003392 Archaea 2657
20 JGI26136J50244_100409 3300003399 Archaea 1513
21 JGI26131J50246_100106 3300003400 Archaea 4060
22 JGI26138J51218_100218 3300003504 Archaea 2537
23 Ga0065716_1000223 3300005277 Archaea 2543
24 Ga0065704_10631375 3300005289 Bacteria 538
25 Ga0065712_10001104 3300005290 Archaea 20445
26 Ga0065715_10126374 3300005293 Archaea 2108
27 Ga0065715_10256125 3300005293 Archaea 1116
28 Ga0065715_10768800 3300005293 Bacteria 618
29 Ga0065707_10000638 3300005295 Archaea 27995
30 Ga0070658_10031923 3300005327 Bacteria 4232
31 Ga0070676_10266664 3300005328 Archaea 1148
32 Ga0070676_10680272 3300005328 Archaea 750
33 Ga0070670_100024010 3300005331 Archaea 5245
34 Ga0070670_100215903 3300005331 Archaea 1668
35 Ga0070670_101030808 3300005331 Bacteria 749
36 Ga0070670_101409041 3300005331 Unclassified 639
37 Ga0070677_10030635 3300005333 Archaea 2049
38 Ga0068869_100015806 3300005334 Archaea 5073
39 Ga0070680_100072664 3300005336 Bacteria 2827
40 Ga0070680_100089619 3300005336 Archaea 2545
41 Ga0070680_100153106 3300005336 Unclassified 1936
42 Ga0070680_100305252 3300005336 Archaea 1350
43 Ga0070680_101522317 3300005336 Bacteria 579
44 Ga0070682_100590255 3300005337 Bacteria 875
45 Ga0070682_100805845 3300005337 Bacteria 763
46 Ga0070660_100684287 3300005339 Bacteria 860
47 Ga0070687_100952626 3300005343 Archaea 619
48 Ga0070687_100965406 3300005343 Archaea 615
49 Ga0070661_100244712 3300005344 Bacteria 1382
50 Ga0070661_100279848 3300005344 Archaea 1294
51 Ga0070692_10120184 3300005345 Archaea 1464
52 Ga0070668_100036975 3300005347 Archaea 3727
53 Ga0070669_100262555 3300005353 Archaea 1378
54 Ga0070669_100711579 3300005353 Archaea 849
55 Ga0070671_100982258 3300005355 Archaea 739
56 Ga0070674_100147685 3300005356 Unclassified 1771
57 Ga0070674_101617205 3300005356 Bacteria 584
58 Ga0070673_100246124 3300005364 Archaea 1556
59 Ga0070659_100075053 3300005366 Archaea 2694
60 Ga0070659_101486574 3300005366 Unclassified 603
61 Ga0070667_101040279 3300005367 Archaea 764
62 Ga0070701_10300538 3300005438 Archaea 986
63 Ga0070711_101381521 3300005439 Unclassified 612
64 Ga0070705_100369414 3300005440 Bacteria 1052
65 Ga0070705_100506300 3300005440 Archaea 918
66 Ga0070705_101119675 3300005440 Bacteria 645
67 Ga0070705_101392502 3300005440 Unclassified 584
68 Ga0070705_101909531 3300005440 Archaea 505
69 Ga0070700_100257274 3300005441 Archaea 1255
70 Ga0070694_100048022 3300005444 Archaea 2870
71 Ga0070694_100545810 3300005444 Archaea 927
72 Ga0070694_100868691 3300005444 Archaea 743
73 Ga0070708_100158432 3300005445 Bacteria 2109
74 Ga0070708_100272853 3300005445 Archaea 1591
75 Ga0070708_100445889 3300005445 Bacteria 1221
76 Ga0070708_100722539 3300005445 Bacteria 937
77 Ga0070708_101645219 3300005445 Unclassified 597
78 Ga0070708_102225838 3300005445 Archaea 506
79 Ga0070663_100396803 3300005455 Archaea 1127
80 Ga0070662_100026840 3300005457 Bacteria 3992
81 Ga0070662_100734424 3300005457 Archaea 837
82 Ga0070662_100889937 3300005457 Archaea 759
83 Ga0070681_10030325 3300005458 Bacteria 5426
84 Ga0070681_11578031 3300005458 Bacteria 581
85 Ga0068867_100019669 3300005459 Archaea 4810
86 Ga0068867_100050804 3300005459 Archaea 3057
87 Ga0068867_100198173 3300005459 Bacteria 1606
88 Ga0070706_100002656 3300005467 Bacteria 17913
89 Ga0070706_100101879 3300005467 Archaea 2668
90 Ga0070706_100172280 3300005467 Bacteria 2021
91 Ga0070706_100213710 3300005467 Bacteria 1800
92 Ga0070706_100310199 3300005467 Bacteria 1472
93 Ga0070707_100012946 3300005468 Bacteria 7794
94 Ga0070707_100018613 3300005468 Bacteria 6535
95 Ga0070707_100276020 3300005468 Archaea 1634
96 Ga0070707_100395777 3300005468 Bacteria 1341
97 Ga0070707_100533250 3300005468 Bacteria 1136
98 Ga0070698_100001367 3300005471 Bacteria 27160
99 Ga0070698_100004631 3300005471 Bacteria 15114
100 Ga0070698_100478019 3300005471 Archaea 1183
101 Ga0070698_100487888 3300005471 Bacteria 1169
102 Ga0070698_100559690 3300005471 Bacteria 1083
103 Ga0070698_100635473 3300005471 Bacteria 1008
104 Ga0070698_101278988 3300005471 Unclassified 683
105 Ga0070699_100003444 3300005518 Bacteria 13990
106 Ga0070699_100517446 3300005518 Unclassified 1085
107 Ga0070699_100775551 3300005518 Unclassified 877
108 Ga0070699_100868524 3300005518 Archaea 826
109 Ga0070679_100086901 3300005530 Bacteria 3114
110 Ga0070679_100283603 3300005530 Archaea 1608
111 Ga0070684_100603827 3300005535 Archaea 1020
112 Ga0070697_100000001 3300005536 Bacteria 662298
113 Ga0070697_100632309 3300005536 Archaea 942
114 Ga0070697_101845955 3300005536 Unclassified 541
115 Ga0068853_100067878 3300005539 Bacteria 3099
116 Ga0070672_100006602 3300005543 Archaea 7811
117 Ga0070672_100202423 3300005543 Archaea 1661
118 Ga0070686_101451426 3300005544 Archaea 577
119 Ga0070695_100223984 3300005545 Bacteria 1356
120 Ga0070695_100296557 3300005545 Archaea 1193
121 Ga0070695_101066446 3300005545 Unclassified 660
122 Ga0070696_100552743 3300005546 Archaea 923
123 Ga0070696_100647967 3300005546 Unclassified 856
124 Ga0070696_100732307 3300005546 Archaea 809
125 Ga0070693_100315971 3300005547 Archaea 1058
126 Ga0070704_100459917 3300005549 Archaea 1097
127 Ga0068855_100014049 3300005563 Bacteria 9652
128 Ga0068855_100069509 3300005563 Bacteria 4098
129 Ga0068855_100888351 3300005563 Bacteria 942
130 Ga0068857_100065097 3300005577 Bacteria 3241
131 Ga0068857_100209984 3300005577 Archaea 1776
132 Ga0068857_100631206 3300005577 Bacteria 1014
133 Ga0068857_100639198 3300005577 Unclassified 1008
134 Ga0068857_101109438 3300005577 Archaea 764
135 Ga0068854_101258258 3300005578 Archaea 665
136 Ga0068856_100129581 3300005614 Bacteria 2527
137 Ga0068856_102297578 3300005614 Bacteria 547
138 Ga0068852_100077947 3300005616 Archaea 2930
139 Ga0068852_101837998 3300005616 Unclassified 628
140 Ga0068859_100234716 3300005617 Archaea 1923
141 Ga0068859_100489792 3300005617 Archaea 1325
142 Ga0068859_102865510 3300005617 Unclassified 529
143 Ga0068864_100013556 3300005618 Archaea 6759
144 Ga0068861_101305040 3300005719 Archaea 706
145 Ga0068851_10296677 3300005834 Bacteria 928
146 Ga0068870_10065216 3300005840 Archaea 1969
147 Ga0068870_10153255 3300005840 Archaea 1359
148 Ga0068860_100603659 3300005843 Archaea 1103
149 Ga0068860_100653181 3300005843 Archaea 1060
150 Ga0068862_100069743 3300005844 Archaea 3034
151 Ga0068862_100145353 3300005844 Archaea 2107
152 Ga0081538_10069935 3300005981 Archaea 1941
153 Ga0081539_10254442 3300005985 Bacteria 778
154 Ga0070717_10158670 3300006028 Bacteria 1961
155 Ga0070717_11083123 3300006028 Bacteria 730
156 Ga0075365_10000397 3300006038 Bacteria 15949
157 Ga0075364_10001592 3300006051 Bacteria 12402
158 Ga0075364_10838917 3300006051 Unclassified 626
159 Ga0075432_10340866 3300006058 Archaea 633
160 Ga0070716_100173273 3300006173 Bacteria 1410
161 Ga0097621_100325126 3300006237 Archaea 1363
162 Ga0075428_100174761 3300006844 Archaea 2327
163 Ga0075428_100293865 3300006844 Bacteria 1747
164 Ga0075428_101665393 3300006844 Unclassified 666
165 Ga0075433_10259021 3300006852 Archaea 1542
166 Ga0075433_11005205 3300006852 Unclassified 726
167 Ga0075434_100048138 3300006871 Archaea 4231
168 Ga0075429_100744569 3300006880 Archaea 858
169 Ga0075429_100754159 3300006880 Archaea 853
170 Ga0068865_100417301 3300006881 Archaea 1103
171 Ga0075436_100058308 3300006914 Archaea 2666
172 Ga0097620_100234724 3300006931 Archaea 1923
173 Ga0097620_100489823 3300006931 Archaea 1325
174 Ga0105245_10166103 3300009098 Bacteria 2098
175 Ga0114129_10005807 3300009147 Archaea 17472
176 Ga0114129_10064747 3300009147 Archaea 5102
177 Ga0114129_10153541 3300009147 Bacteria 3150
178 Ga0114129_10242081 3300009147 Archaea 2425
179 Ga0114129_10271759 3300009147 Bacteria 2267
180 Ga0114129_10888519 3300009147 Archaea 1130
181 Ga0114129_10989770 3300009147 Unclassified 1060
182 Ga0114129_12470517 3300009147 Bacteria 621
183 Ga0105243_10011180 3300009148 Bacteria 6789
184 Ga0105241_10548818 3300009174 Bacteria 1037
185 Ga0105241_11041628 3300009174 Bacteria 767
186 Ga0105242_10021814 3300009176 Archaea 5033
187 Ga0105237_10649502 3300009545 Unclassified 1062
188 Ga0105249_10517857 3300009553 Archaea 1240
189 Ga0105249_12427593 3300009553 Archaea 597
190 Ga0105239_10594223 3300010375 Archaea 1262
191 Ga0105239_10681036 3300010375 Unclassified 1175
192 Ga0105239_11842797 3300010375 Unclassified 701
193 Ga0105239_13116256 3300010375 Bacteria 540
194 Ga0105246_10026473 3300011119 Archaea 3789
195 Ga0105246_10338772 3300011119 Archaea 1228
196 Ga0105246_10360005 3300011119 Archaea 1195
197 Ga0157340_1000524 3300012473 Archaea 1501
198 Ga0157336_1001260 3300012477 Archaea 1286
199 Ga0157337_1000262 3300012483 Archaea 2428
200 Ga0157341_1007661 3300012494 Archaea 865
201 Ga0157345_1001292 3300012498 Archaea 1765
202 Ga0157313_1000116 3300012503 Unclassified 3535
203 Ga0157316_1001849 3300012510 Archaea 1373
204 Ga0157338_1010696 3300012515 Archaea 931
205 Ga0157373_10040781 3300013100 Unclassified 3321
206 Ga0157373_10054985 3300013100 Unclassified 2828
207 Ga0157373_10349337 3300013100 Bacteria 1055
208 Ga0157371_10000561 3300013102 Bacteria 43999
209 Ga0157371_10142868 3300013102 Bacteria 1705
210 Ga0157371_10715996 3300013102 Bacteria 750
211 Ga0157370_10164386 3300013104 Bacteria 2064
212 Ga0157370_10356672 3300013104 Bacteria 1347
213 Ga0157369_10021418 3300013105 Bacteria 7232
214 Ga0157369_10412099 3300013105 Unclassified 1401
215 Ga0157369_11707508 3300013105 Bacteria 640
216 Ga0157378_10034192 3300013297 Archaea 4495
217 Ga0157378_10046095 3300013297 Archaea 3875
218 Ga0157372_10851186 3300013307 Bacteria 1059
219 Ga0157372_11097845 3300013307 Bacteria 920
220 Ga0157375_11421371 3300013308 Archaea 817
221 Ga0157375_11479925 3300013308 Archaea 801
222 Ga0157380_10095271 3300014326 Archaea 2466
223 Ga0157380_10492354 3300014326 Archaea 1189
224 Ga0209455_1001944 3300025272 Bacteria 8536
225 Ga0207682_10031172 3300025893 Archaea 2139
226 Ga0207642_10013096 3300025899 Archaea 3015
227 Ga0207642_10502493 3300025899 Archaea 742
228 Ga0207647_10017360 3300025904 Archaea 4892
229 Ga0207645_10006750 3300025907 Archaea 8197
230 Ga0207645_10012571 3300025907 Archaea 5741
231 Ga0207643_10002365 3300025908 Archaea 10252
232 Ga0207643_10017433 3300025908 Archaea 3927
233 Ga0207684_10001474 3300025910 Bacteria 25315
234 Ga0207684_10156955 3300025910 Bacteria 1958
235 Ga0207684_10172492 3300025910 Bacteria 1864
236 Ga0207684_10178415 3300025910 Archaea 1831
237 Ga0207684_10691065 3300025910 Unclassified 867
238 Ga0207707_10204196 3300025912 Archaea 1722
239 Ga0207707_11359494 3300025912 Unclassified 568
240 Ga0207660_10183704 3300025917 Unclassified 1625
241 Ga0207660_10232991 3300025917 Bacteria 1448
242 Ga0207660_10786452 3300025917 Archaea 776
243 Ga0207660_11186690 3300025917 Archaea 621
244 Ga0207662_10348527 3300025918 Archaea 994
245 Ga0207657_10031076 3300025919 Bacteria 4841
246 Ga0207657_11067201 3300025919 Bacteria 618
247 Ga0207657_11375039 3300025919 Archaea 531
248 Ga0207649_10253069 3300025920 Bacteria 1269
249 Ga0207652_10025915 3300025921 Bacteria 4878
250 Ga0207652_10223144 3300025921 Bacteria 1698
251 Ga0207652_10524150 3300025921 Archaea 1066
252 Ga0207646_10013844 3300025922 Bacteria 7693
253 Ga0207646_10042615 3300025922 Bacteria 4077
254 Ga0207646_10098531 3300025922 Unclassified 2619
255 Ga0207646_11064117 3300025922 Archaea 713
256 Ga0207681_10322683 3300025923 Archaea 1228
257 Ga0207681_10871403 3300025923 Archaea 753
258 Ga0207650_10013622 3300025925 Archaea 5635
259 Ga0207650_10064384 3300025925 Archaea 2744
260 Ga0207687_10854479 3300025927 Unclassified 778
261 Ga0207664_10893449 3300025929 Unclassified 798
262 Ga0207690_10220746 3300025932 Bacteria 1450
263 Ga0207690_10312737 3300025932 Archaea 1232
264 Ga0207690_11597232 3300025932 Unclassified 545
265 Ga0207706_10032443 3300025933 Archaea 4651
266 Ga0207709_10007272 3300025935 Bacteria 6175
267 Ga0207669_10941902 3300025937 Archaea 723
268 Ga0207704_10083022 3300025938 Archaea 2078
269 Ga0207704_10825998 3300025938 Archaea 775
270 Ga0207691_10028158 3300025940 Archaea 5263
271 Ga0207689_10016242 3300025942 Archaea 6306
272 Ga0207679_10054451 3300025945 Archaea 2945
273 Ga0207679_10356971 3300025945 Bacteria 1275
274 Ga0207667_10087767 3300025949 Bacteria 3217
275 Ga0207651_10111367 3300025960 Archaea 2055
276 Ga0207712_10261538 3300025961 Archaea 1404
277 Ga0207640_10010034 3300025981 Bacteria 5321
278 Ga0207640_10220196 3300025981 Archaea 1452
279 Ga0207677_10808971 3300026023 Archaea 839
280 Ga0207639_10878826 3300026041 Unclassified 837
281 Ga0207678_10385647 3300026067 Archaea 1212
282 Ga0207708_10022390 3300026075 Archaea 4772
283 Ga0207708_10147409 3300026075 Archaea 1850
284 Ga0207708_10646664 3300026075 Archaea 900
285 Ga0207702_12154554 3300026078 Bacteria 547
286 Ga0207648_10016887 3300026089 Archaea 6653
287 Ga0207648_10042357 3300026089 Archaea 3996
288 Ga0207676_10113290 3300026095 Archaea 2273
289 Ga0207674_10020812 3300026116 Bacteria 7080
290 Ga0207674_10028979 3300026116 Bacteria 5836
291 Ga0207674_10135805 3300026116 Archaea 2422
292 Ga0207675_100632627 3300026118 Archaea 1075
293 Ga0207683_10296026 3300026121 Archaea 1480
294 Ga0207683_10484002 3300026121 Archaea 1142
295 Ga0207698_10017033 3300026142 Archaea 4919
296 Ga0207698_11337972 3300026142 Unclassified 731
297 Ga0209973_1000801 3300027252 Archaea 2528
298 Ga0209967_1020207 3300027364 Archaea 970
299 Ga0209981_1026234 3300027378 Archaea 845
300 Ga0210000_1003097 3300027462 Archaea 2385
301 Ga0209995_1000182 3300027471 Archaea 10072
302 Ga0209995_1033242 3300027471 Archaea 866
303 Ga0209968_1000164 3300027526 Archaea 11612
304 Ga0209999_1002675 3300027543 Archaea 3150
305 Ga0209999_1019675 3300027543 Archaea 1238
306 Ga0209999_1073204 3300027543 Archaea 658
307 Ga0209982_1000463 3300027552 Archaea 4997
308 Ga0209970_1009869 3300027614 Archaea 1560
309 Ga0209983_1001356 3300027665 Archaea 5450
310 Ga0209971_1002213 3300027682 Archaea 4714
311 Ga0209966_1000520 3300027695 Archaea 9940
312 Ga0209974_10002674 3300027876 Archaea 6455
313 Ga0207428_10031641 3300027907 Archaea 4363
314 Ga0268265_10203701 3300028380 Archaea 1718
315 Ga0268265_10337788 3300028380 Archaea 1370
316 Ga0268264_10476546 3300028381 Archaea 1213
317 Ga0265319_1201378 3300028563 Bacteria 611
318 Ga0265318_10144146 3300028577 Bacteria 874
319 Ga0265322_10058072 3300028654 Bacteria 1097
320 Ga0265338_10433601 3300028800 Bacteria 932
321 Ga0314311_1180264 3300030733 Unclassified 558
322 Ga0316179_1003690 3300030734 Bacteria 927
323 Ga0265332_10148533 3300031238 Bacteria 981
324 Ga0265320_10102805 3300031240 Bacteria 1315
325 Ga0265339_10068463 3300031249 Bacteria 1897
326 Ga0265316_10010993 3300031344 Bacteria 8213
327 Ga0307408_100463707 3300031548 Bacteria 1102
328 Ga0265342_10156904 3300031712 Bacteria 1260
329 Ga0307405_10563663 3300031731 Bacteria 924
330 Ga0307413_11107950 3300031824 Bacteria 684
331 Ga0307413_11862547 3300031824 Bacteria 540
332 Ga0307410_10364153 3300031852 Bacteria 1159
333 Ga0307407_10351542 3300031903 Bacteria 1044
334 Ga0307409_100273991 3300031995 Bacteria 1556
335 Ga0307409_101204580 3300031995 Bacteria 781
336 Ga0307416_100458982 3300032002 Bacteria 1328
337 Ga0307414_11429522 3300032004 Bacteria 643
338 Ga0307411_10608253 3300032005 Bacteria 941
339 Ga0307415_100684685 3300032126 Bacteria 923
340 Ga0307415_101377680 3300032126 Bacteria 671
341 Ga0373947_0803261 3300035725 Unclassified 642
342 Ga0395899_0002439 3300037312 Bacteria 15118
343 Ga0395899_0048931 3300037312 Bacteria 3143
344 Ga0395899_0297830 3300037312 Bacteria 1092
345 Ga0395900_0015549 3300037418 Bacteria 7756
346 Ga0395900_0078098 3300037418 Bacteria 3401
347 Ga0395900_0134804 3300037418 Bacteria 2529
348 Ga0395898_0001404 3300037466 Bacteria 34348
349 Ga0395905_0039364 3300037471 Bacteria 4435
350 Ga0395905_0081911 3300037471 Bacteria 3024
351 Ga0395905_0131663 3300037471 Bacteria 2352
352 Ga0395901_0003763 3300038443 Bacteria 15291
353 Ga0395901_0021179 3300038443 Bacteria 6659
354 Ga0395901_0265330 3300038443 Unclassified 1786
355 Ga0395901_0578583 3300038443 Unclassified 1135
356 Ga0395901_1348362 3300038443 Bacteria 673
357 Ga0242420_000704 3300038996 Archaea 3994
358 Ga0451793_1131357 3300041452 Bacteria 1100
359 Ga0439443_008932 3300042003 Archaea 1426
360 Ga0439440_0009859 3300042993 Archaea 1985
361 Ga0451576_2666389 3300045051 Archaea 509
362 Ga0495613_0531288 3300046689 Bacteria 789
363 Ga0495675_0572735 3300047444 Bacteria 642
364 Ga0496102_0193893 3300048905 Bacteria 1915
365 Ga0496102_1781628 3300048905 Bacteria 533
366 Ga0496106_1138611 3300048909 Unclassified 610
367 Ga0496107_0146039 3300048910 Archaea 1749
368 Ga0496112_1306100 3300048915 Archaea 641
369 Ga0496115_0730645 3300048918 Unclassified 776
370 Ga0496121_0129682 3300048924 Bacteria 1890
371 Ga0496124_0252369 3300048927 Bacteria 1304
372 Ga0501033_0274920 3300049570 Bacteria 1190
373 Ga0501043_0052650 3300049579 Bacteria 3197
374 Ga0501047_0442695 3300049581 Bacteria 1129
375 Ga0501069_0089519 3300049585 Archaea 1740
376 Ga0501083_0127151 3300049744 Bacteria 1670
377 Ga0501044_0140625 3300049823 Bacteria 2403
378 nmdc:mga00v17_543968_c1 3300050491 Unclassified 751
379 nmdc:mga00v17_723_c1 3300050491 Bacteria 18023
380 nmdc:mga0yw44_127_c1 3300050492 Bacteria 26145
381 nmdc:mga05p37_14906_c1 3300050507 Archaea 9334
382 nmdc:mga05p37_344571_c1 3300050507 Bacteria 1756
383 nmdc:mga05p37_54717_c1 3300050507 Archaea 4909
384 nmdc:mga05p37_563393_c1 3300050507 Unclassified 1294
385 nmdc:mga05p37_670557_c1 3300050507 Archaea 1158
386 nmdc:mga09592_157948_c1 3300050508 Archaea 1958
387 nmdc:mga09592_525131_c1 3300050508 Unclassified 1018
388 nmdc:mga06r32_435152_c1 3300050510 Unclassified 1292
389 nmdc:mga06r32_610666_c1 3300050510 Archaea 1061
390 nmdc:mga08y16_163094_c1 3300050511 Archaea 2316
391 nmdc:mga08y16_245930_c1 3300050511 Archaea 1849
392 nmdc:mga0n895_100325_c1 3300050512 Archaea 2904
393 nmdc:mga08x19_24625_c1 3300050514 Archaea 3743
394 nmdc:mga0a205_1084529_c1 3300050515 Unclassified 648
395 nmdc:mga0a205_279868_c1 3300050515 Archaea 1544
396 Ga0495619_1012746 3300053085 Unclassified 555
397 Ga0500651_0258252 3300053093 Bacteria 1011
398 Ga0500562_000198 3300053108 Bacteria 16330
399 Ga0500559_0000192 3300053136 Bacteria 49223
400 Ga0500561_0000002 3300053137 Bacteria 394147
401 Ga0500645_019070 3300053730 Bacteria 2136
402 Ga0500661_014997 3300055283 Bacteria 1392

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030734 Ga0316179_1003690 Ga0316179_10036902 102
2 3300050508 nmdc:mga09592_525131_c1 nmdc:mga09592_525131_c1_663_1001 109
3 3300005536 Ga0070697_101845955 Ga0070697_1018459551 110
4 3300005545 Ga0070695_101066446 Ga0070695_1010664461 110
5 3300025981 Ga0207640_10010034 Ga0207640_100100344 118
6 3300053093 Ga0500651_0258252 Ga0500651_0258252_327_704 118
7 3300053136 Ga0500559_0000192 Ga0500559_0000192_31989_32366 118
8 iso_pu_bacteria 2643221635 2644198216 118
9 3300005471 Ga0070698_100001367 Ga0070698_10000136725 119
10 3300005337 Ga0070682_100590255 Ga0070682_1005902552 120
11 3300005440 Ga0070705_101119675 Ga0070705_1011196752 120
12 3300005459 Ga0068867_100198173 Ga0068867_1001981732 120
13 3300009098 Ga0105245_10166103 Ga0105245_101661032 120
14 3300009148 Ga0105243_10011180 Ga0105243_100111804 120
15 3300009174 Ga0105241_11041628 Ga0105241_110416282 120
16 3300013102 Ga0157371_10000561 Ga0157371_1000056128 120
17 3300025927 Ga0207687_10854479 Ga0207687_108544792 120
18 3300025935 Ga0207709_10007272 Ga0207709_100072726 120
19 3300048918 Ga0496115_0730645 Ga0496115_0730645_106_486 120
20 3300053137 Ga0500561_0000002 Ga0500561_0000002_89437_89820 120
21 3300005293 Ga0065715_10768800 Ga0065715_107688001 121
22 3300005439 Ga0070711_101381521 Ga0070711_1013815211 121
23 3300005440 Ga0070705_100369414 Ga0070705_1003694143 121
24 3300005445 Ga0070708_100158432 Ga0070708_1001584322 121
25 3300005445 Ga0070708_100445889 Ga0070708_1004458892 121
26 3300005445 Ga0070708_100722539 Ga0070708_1007225392 121
27 3300005467 Ga0070706_100002656 Ga0070706_1000026569 121
28 3300005467 Ga0070706_100213710 Ga0070706_1002137102 121
29 3300005467 Ga0070706_100310199 Ga0070706_1003101993 121
30 3300005468 Ga0070707_100012946 Ga0070707_1000129465 121
31 3300005468 Ga0070707_100018613 Ga0070707_1000186134 121
32 3300005468 Ga0070707_100395777 Ga0070707_1003957772 121
33 3300005471 Ga0070698_100004631 Ga0070698_10000463111 121
34 3300005471 Ga0070698_100487888 Ga0070698_1004878882 121
35 3300005471 Ga0070698_100559690 Ga0070698_1005596902 121
36 3300005471 Ga0070698_100635473 Ga0070698_1006354731 121
37 3300005471 Ga0070698_101278988 Ga0070698_1012789882 121
38 3300005518 Ga0070699_100003444 Ga0070699_1000034442 121
39 3300005518 Ga0070699_100517446 Ga0070699_1005174462 121
40 3300005536 Ga0070697_100000001 Ga0070697_10000000129 121
41 3300005577 Ga0068857_100631206 Ga0068857_1006312061 121
42 3300005617 Ga0068859_102865510 Ga0068859_1028655101 121
43 3300006028 Ga0070717_10158670 Ga0070717_101586704 121
44 3300006028 Ga0070717_11083123 Ga0070717_110831232 121
45 3300006844 Ga0075428_100293865 Ga0075428_1002938651 121
46 3300009147 Ga0114129_10153541 Ga0114129_101535415 121
47 3300009147 Ga0114129_12470517 Ga0114129_124705171 121
48 3300025910 Ga0207684_10001474 Ga0207684_1000147419 121
49 3300025910 Ga0207684_10156955 Ga0207684_101569552 121
50 3300025910 Ga0207684_10172492 Ga0207684_101724922 121
51 3300025922 Ga0207646_10013844 Ga0207646_100138446 121
52 3300025922 Ga0207646_10042615 Ga0207646_100426152 121
53 3300025922 Ga0207646_10098531 Ga0207646_100985313 121
54 3300041452 Ga0451793_1131357 Ga0451793_1131357_459_842 121
55 3300046689 Ga0495613_0531288 Ga0495613_0531288_54_422 121
56 3300047444 Ga0495675_0572735 Ga0495675_0572735_20_388 121
57 3300048924 Ga0496121_0129682 Ga0496121_0129682_494_877 121
58 3300049570 Ga0501033_0274920 Ga0501033_0274920_404_784 121
59 3300049579 Ga0501043_0052650 Ga0501043_0052650_255_635 121
60 3300049581 Ga0501047_0442695 Ga0501047_0442695_26_406 121
61 3300049744 Ga0501083_0127151 Ga0501083_0127151_427_807 121
62 3300049823 Ga0501044_0140625 Ga0501044_0140625_219_599 121
63 3300050491 nmdc:mga00v17_723_c1 nmdc:mga00v17_723_c1_10068_10448 121
64 3300050492 nmdc:mga0yw44_127_c1 nmdc:mga0yw44_127_c1_4388_4768 121
65 3300053085 Ga0495619_1012746 Ga0495619_1012746_24_404 121
66 3300005331 Ga0070670_101030808 Ga0070670_1010308081 122
67 3300006173 Ga0070716_100173273 Ga0070716_1001732733 122
68 3300030733 Ga0314311_1180264 Ga0314311_11802641 122
69 3300031731 Ga0307405_10563663 Ga0307405_105636632 122
70 3300031824 Ga0307413_11107950 Ga0307413_111079502 122
71 3300031852 Ga0307410_10364153 Ga0307410_103641532 122
72 3300031903 Ga0307407_10351542 Ga0307407_103515423 122
73 3300032002 Ga0307416_100458982 Ga0307416_1004589822 122
74 3300032005 Ga0307411_10608253 Ga0307411_106082532 122
75 3300032126 Ga0307415_100684685 Ga0307415_1006846852 122
76 3300037312 Ga0395899_0002439 Ga0395899_0002439_5188_5580 122
77 3300037312 Ga0395899_0048931 Ga0395899_0048931_1655_2032 122
78 3300037312 Ga0395899_0297830 Ga0395899_0297830_262_639 122
79 3300037418 Ga0395900_0015549 Ga0395900_0015549_4753_5145 122
80 3300037418 Ga0395900_0078098 Ga0395900_0078098_1474_1851 122
81 3300037418 Ga0395900_0134804 Ga0395900_0134804_470_847 122
82 3300037466 Ga0395898_0001404 Ga0395898_0001404_8135_8527 122
83 3300037471 Ga0395905_0039364 Ga0395905_0039364_1432_1824 122
84 3300037471 Ga0395905_0131663 Ga0395905_0131663_1683_2060 122
85 3300038443 Ga0395901_0003763 Ga0395901_0003763_4818_5210 122
86 3300038443 Ga0395901_0021179 Ga0395901_0021179_448_834 122
87 3300038443 Ga0395901_0265330 Ga0395901_0265330_984_1361 122
88 3300038443 Ga0395901_1348362 Ga0395901_1348362_134_511 122
89 3300048905 Ga0496102_0193893 Ga0496102_0193893_139_522 122
90 3300048927 Ga0496124_0252369 Ga0496124_0252369_674_1060 122
91 3300003316 rootH1_10004557 rootH1_100045573 123
92 3300003316 rootH1_10077413 rootH1_100774133 123
93 3300003322 rootL2_10220025 rootL2_102200254 123
94 3300003322 rootL2_10279067 rootL2_102790672 123
95 3300005327 Ga0070658_10031923 Ga0070658_100319233 123
96 3300005336 Ga0070680_100153106 Ga0070680_1001531062 123
97 3300005337 Ga0070682_100805845 Ga0070682_1008058452 123
98 3300005339 Ga0070660_100684287 Ga0070660_1006842872 123
99 3300005458 Ga0070681_11578031 Ga0070681_115780311 123
100 3300005467 Ga0070706_100172280 Ga0070706_1001722803 123
101 3300005518 Ga0070699_100775551 Ga0070699_1007755511 123
102 3300005545 Ga0070695_100223984 Ga0070695_1002239842 123
103 3300005563 Ga0068855_100014049 Ga0068855_1000140499 123
104 3300005563 Ga0068855_100888351 Ga0068855_1008883511 123
105 3300005614 Ga0068856_102297578 Ga0068856_1022975781 123
106 3300005985 Ga0081539_10254442 Ga0081539_102544421 123
107 3300006038 Ga0075365_10000397 Ga0075365_100003976 123
108 3300006051 Ga0075364_10001592 Ga0075364_1000159211 123
109 3300006051 Ga0075364_10838917 Ga0075364_108389172 123
110 3300006852 Ga0075433_11005205 Ga0075433_110052051 123
111 3300009147 Ga0114129_10271759 Ga0114129_102717592 123
112 3300009147 Ga0114129_10989770 Ga0114129_109897702 123
113 3300009174 Ga0105241_10548818 Ga0105241_105488181 123
114 3300013100 Ga0157373_10054985 Ga0157373_100549853 123
115 3300013100 Ga0157373_10349337 Ga0157373_103493372 123
116 3300013102 Ga0157371_10142868 Ga0157371_101428682 123
117 3300013102 Ga0157371_10715996 Ga0157371_107159961 123
118 3300013104 Ga0157370_10164386 Ga0157370_101643864 123
119 3300013105 Ga0157369_10021418 Ga0157369_100214182 123
120 3300013105 Ga0157369_11707508 Ga0157369_117075081 123
121 3300013307 Ga0157372_10851186 Ga0157372_108511862 123
122 3300013307 Ga0157372_11097845 Ga0157372_110978451 123
123 3300025272 Ga0209455_1001944 Ga0209455_100194411 123
124 3300025910 Ga0207684_10691065 Ga0207684_106910651 123
125 3300025917 Ga0207660_10183704 Ga0207660_101837042 123
126 3300025919 Ga0207657_11067201 Ga0207657_110672011 123
127 3300025921 Ga0207652_10025915 Ga0207652_100259156 123
128 3300025929 Ga0207664_10893449 Ga0207664_108934491 123
129 3300026078 Ga0207702_12154554 Ga0207702_121545542 123
130 3300026116 Ga0207674_10028979 Ga0207674_100289794 123
131 3300028563 Ga0265319_1201378 Ga0265319_12013781 123
132 3300028577 Ga0265318_10144146 Ga0265318_101441462 123
133 3300028654 Ga0265322_10058072 Ga0265322_100580722 123
134 3300028800 Ga0265338_10433601 Ga0265338_104336011 123
135 3300031238 Ga0265332_10148533 Ga0265332_101485332 123
136 3300031240 Ga0265320_10102805 Ga0265320_101028052 123
137 3300031249 Ga0265339_10068463 Ga0265339_100684632 123
138 3300031344 Ga0265316_10010993 Ga0265316_100109932 123
139 3300031548 Ga0307408_100463707 Ga0307408_1004637072 123
140 3300031712 Ga0265342_10156904 Ga0265342_101569041 123
141 3300031824 Ga0307413_11862547 Ga0307413_118625471 123
142 3300031995 Ga0307409_100273991 Ga0307409_1002739912 123
143 3300032004 Ga0307414_11429522 Ga0307414_114295222 123
144 3300035725 Ga0373947_0803261 Ga0373947_0803261_17_424 123
145 3300050491 nmdc:mga00v17_543968_c1 nmdc:mga00v17_543968_c1_212_601 123
146 3300050507 nmdc:mga05p37_563393_c1 nmdc:mga05p37_563393_c1_381_788 123
147 3300050515 nmdc:mga0a205_1084529_c1 nmdc:mga0a205_1084529_c1_118_498 123
148 3300005440 Ga0070705_101392502 Ga0070705_1013925021 124
149 3300005445 Ga0070708_100272853 Ga0070708_1002728532 124
150 3300005467 Ga0070706_100101879 Ga0070706_1001018793 124
151 3300005468 Ga0070707_100276020 Ga0070707_1002760204 124
152 3300005981 Ga0081538_10069935 Ga0081538_100699352 124
153 3300009147 Ga0114129_10005807 Ga0114129_100058072 124
154 3300010375 Ga0105239_11842797 Ga0105239_118427971 124
155 3300010375 Ga0105239_13116256 Ga0105239_131162561 124
156 3300011119 Ga0105246_10338772 Ga0105246_103387722 124
157 3300013297 Ga0157378_10034192 Ga0157378_100341925 124
158 3300025922 Ga0207646_11064117 Ga0207646_110641172 124
159 3300025932 Ga0207690_11597232 Ga0207690_115972321 124
160 3300026142 Ga0207698_11337972 Ga0207698_113379721 124
161 3300031995 Ga0307409_101204580 Ga0307409_1012045801 124
162 3300032126 Ga0307415_101377680 Ga0307415_1013776801 124
163 3300037471 Ga0395905_0081911 Ga0395905_0081911_1965_2387 124
164 3300038443 Ga0395901_0578583 Ga0395901_0578583_530_952 124
165 3300038996 Ga0242420_000704 Ga0242420_000704_265_639 124
166 3300048905 Ga0496102_1781628 Ga0496102_1781628_45_419 124
167 3300048909 Ga0496106_1138611 Ga0496106_1138611_22_396 124
168 3300048910 Ga0496107_0146039 Ga0496107_0146039_41_415 124
169 3300048915 Ga0496112_1306100 Ga0496112_1306100_73_447 124
170 3300049585 Ga0501069_0089519 Ga0501069_0089519_1286_1660 124
171 3300050507 nmdc:mga05p37_14906_c1 nmdc:mga05p37_14906_c1_359_733 124
172 3300050510 nmdc:mga06r32_435152_c1 nmdc:mga06r32_435152_c1_161_541 124
173 3300050512 nmdc:mga0n895_100325_c1 nmdc:mga0n895_100325_c1_217_591 124
174 3300050514 nmdc:mga08x19_24625_c1 nmdc:mga08x19_24625_c1_1731_2105 124
175 3300050515 nmdc:mga0a205_279868_c1 nmdc:mga0a205_279868_c1_808_1182 124
176 3300053108 Ga0500562_000198 Ga0500562_000198_8532_8921 124
177 3300053730 Ga0500645_019070 Ga0500645_019070_1244_1633 124
178 3300055283 Ga0500661_014997 Ga0500661_014997_387_776 124
179 3300005336 Ga0070680_100072664 Ga0070680_1000726642 125
180 3300005344 Ga0070661_100244712 Ga0070661_1002447122 125
181 3300005457 Ga0070662_100026840 Ga0070662_1000268404 125
182 3300005458 Ga0070681_10030325 Ga0070681_100303254 125
183 3300005530 Ga0070679_100086901 Ga0070679_1000869014 125
184 3300005539 Ga0068853_100067878 Ga0068853_1000678782 125
185 3300005563 Ga0068855_100069509 Ga0068855_1000695096 125
186 3300005577 Ga0068857_100065097 Ga0068857_1000650971 125
187 3300005577 Ga0068857_100639198 Ga0068857_1006391981 125
188 3300005614 Ga0068856_100129581 Ga0068856_1001295812 125
189 3300005834 Ga0068851_10296677 Ga0068851_102966771 125
190 3300009545 Ga0105237_10649502 Ga0105237_106495022 125
191 3300010375 Ga0105239_10681036 Ga0105239_106810362 125
192 3300013100 Ga0157373_10040781 Ga0157373_100407815 125
193 3300013104 Ga0157370_10356672 Ga0157370_103566722 125
194 3300013105 Ga0157369_10412099 Ga0157369_104120992 125
195 3300025910 Ga0207684_10178415 Ga0207684_101784153 125
196 3300025912 Ga0207707_11359494 Ga0207707_113594941 125
197 3300025917 Ga0207660_10232991 Ga0207660_102329912 125
198 3300025919 Ga0207657_10031076 Ga0207657_100310766 125
199 3300025920 Ga0207649_10253069 Ga0207649_102530692 125
200 3300025921 Ga0207652_10223144 Ga0207652_102231442 125
201 3300025932 Ga0207690_10220746 Ga0207690_102207462 125
202 3300025945 Ga0207679_10356971 Ga0207679_103569712 125
203 3300025949 Ga0207667_10087767 Ga0207667_100877672 125
204 3300026041 Ga0207639_10878826 Ga0207639_108788261 125
205 3300026116 Ga0207674_10020812 Ga0207674_100208121 125
206 2162886006 SwRhRL3b_contig_2609502 SwRhRL3b_0932.00001710 126
207 2162886006 SwRhRL3b_contig_378765 SwRhRL3b_0290.00001130 126
208 2162886011 MRS1b_contig_6031450 MRS1b_0547.00000760 126
209 2209111006 2214828557 2213866953 126
210 3300000041 ARcpr5oldR_c000714 ARcpr5oldR_0007146 126
211 3300000042 ARSoilYngRDRAFT_c00715 ARSoilYngRDRAFT_007155 126
212 3300000652 ARCol0yngRDRAFT_1000102 ARCol0yngRDRAFT_10001025 126
213 3300001990 JGI24737J22298_10028520 JGI24737J22298_100285204 126
214 3300002155 JGI24033J26618_1006462 JGI24033J26618_10064621 126
215 3300003349 JGI26129J50193_1000420 JGI26129J50193_10004203 126
216 3300003371 JGI26145J50221_1000028 JGI26145J50221_10000287 126
217 3300003379 JGI26142J50222_100784 JGI26142J50222_1007841 126
218 3300003383 JGI26140J50224_101077 JGI26140J50224_1010772 126
219 3300003392 JGI26134J50242_100224 JGI26134J50242_1002244 126
220 3300003399 JGI26136J50244_100409 JGI26136J50244_1004092 126
221 3300003400 JGI26131J50246_100106 JGI26131J50246_1001066 126
222 3300003504 JGI26138J51218_100218 JGI26138J51218_1002184 126
223 3300005277 Ga0065716_1000223 Ga0065716_10002232 126
224 3300005289 Ga0065704_10631375 Ga0065704_106313751 126
225 3300005290 Ga0065712_10001104 Ga0065712_1000110425 126
226 3300005293 Ga0065715_10126374 Ga0065715_101263743 126
227 3300005293 Ga0065715_10256125 Ga0065715_102561251 126
228 3300005295 Ga0065707_10000638 Ga0065707_100006388 126
229 3300005328 Ga0070676_10266664 Ga0070676_102666641 126
230 3300005328 Ga0070676_10680272 Ga0070676_106802722 126
231 3300005331 Ga0070670_100024010 Ga0070670_1000240102 126
232 3300005331 Ga0070670_100215903 Ga0070670_1002159031 126
233 3300005331 Ga0070670_101409041 Ga0070670_1014090411 126
234 3300005333 Ga0070677_10030635 Ga0070677_100306351 126
235 3300005334 Ga0068869_100015806 Ga0068869_1000158062 126
236 3300005336 Ga0070680_100089619 Ga0070680_1000896192 126
237 3300005336 Ga0070680_100305252 Ga0070680_1003052521 126
238 3300005336 Ga0070680_101522317 Ga0070680_1015223172 126
239 3300005343 Ga0070687_100952626 Ga0070687_1009526261 126
240 3300005343 Ga0070687_100965406 Ga0070687_1009654061 126
241 3300005344 Ga0070661_100279848 Ga0070661_1002798483 126
242 3300005345 Ga0070692_10120184 Ga0070692_101201842 126
243 3300005347 Ga0070668_100036975 Ga0070668_1000369753 126
244 3300005353 Ga0070669_100262555 Ga0070669_1002625551 126
245 3300005353 Ga0070669_100711579 Ga0070669_1007115791 126
246 3300005355 Ga0070671_100982258 Ga0070671_1009822581 126
247 3300005356 Ga0070674_100147685 Ga0070674_1001476854 126
248 3300005356 Ga0070674_101617205 Ga0070674_1016172051 126
249 3300005364 Ga0070673_100246124 Ga0070673_1002461241 126
250 3300005366 Ga0070659_100075053 Ga0070659_1000750535 126
251 3300005366 Ga0070659_101486574 Ga0070659_1014865741 126
252 3300005367 Ga0070667_101040279 Ga0070667_1010402791 126
253 3300005438 Ga0070701_10300538 Ga0070701_103005382 126
254 3300005440 Ga0070705_100506300 Ga0070705_1005063001 126
255 3300005440 Ga0070705_101909531 Ga0070705_1019095311 126
256 3300005441 Ga0070700_100257274 Ga0070700_1002572741 126
257 3300005444 Ga0070694_100048022 Ga0070694_1000480224 126
258 3300005444 Ga0070694_100545810 Ga0070694_1005458101 126
259 3300005444 Ga0070694_100868691 Ga0070694_1008686911 126
260 3300005445 Ga0070708_101645219 Ga0070708_1016452191 126
261 3300005445 Ga0070708_102225838 Ga0070708_1022258381 126
262 3300005455 Ga0070663_100396803 Ga0070663_1003968032 126
263 3300005457 Ga0070662_100734424 Ga0070662_1007344242 126
264 3300005457 Ga0070662_100889937 Ga0070662_1008899372 126
265 3300005459 Ga0068867_100019669 Ga0068867_1000196692 126
266 3300005459 Ga0068867_100050804 Ga0068867_1000508042 126
267 3300005468 Ga0070707_100533250 Ga0070707_1005332501 126
268 3300005471 Ga0070698_100478019 Ga0070698_1004780192 126
269 3300005518 Ga0070699_100868524 Ga0070699_1008685241 126
270 3300005530 Ga0070679_100283603 Ga0070679_1002836032 126
271 3300005535 Ga0070684_100603827 Ga0070684_1006038271 126
272 3300005536 Ga0070697_100632309 Ga0070697_1006323092 126
273 3300005543 Ga0070672_100006602 Ga0070672_1000066024 126
274 3300005543 Ga0070672_100202423 Ga0070672_1002024231 126
275 3300005544 Ga0070686_101451426 Ga0070686_1014514262 126
276 3300005545 Ga0070695_100296557 Ga0070695_1002965571 126
277 3300005546 Ga0070696_100552743 Ga0070696_1005527432 126
278 3300005546 Ga0070696_100647967 Ga0070696_1006479671 126
279 3300005546 Ga0070696_100732307 Ga0070696_1007323072 126
280 3300005547 Ga0070693_100315971 Ga0070693_1003159712 126
281 3300005549 Ga0070704_100459917 Ga0070704_1004599172 126
282 3300005577 Ga0068857_100209984 Ga0068857_1002099843 126
283 3300005577 Ga0068857_101109438 Ga0068857_1011094381 126
284 3300005578 Ga0068854_101258258 Ga0068854_1012582581 126
285 3300005616 Ga0068852_100077947 Ga0068852_1000779472 126
286 3300005616 Ga0068852_101837998 Ga0068852_1018379981 126
287 3300005617 Ga0068859_100234716 Ga0068859_1002347165 126
288 3300005617 Ga0068859_100489792 Ga0068859_1004897922 126
289 3300005618 Ga0068864_100013556 Ga0068864_1000135563 126
290 3300005719 Ga0068861_101305040 Ga0068861_1013050402 126
291 3300005840 Ga0068870_10065216 Ga0068870_100652162 126
292 3300005840 Ga0068870_10153255 Ga0068870_101532552 126
293 3300005843 Ga0068860_100603659 Ga0068860_1006036591 126
294 3300005843 Ga0068860_100653181 Ga0068860_1006531812 126
295 3300005844 Ga0068862_100069743 Ga0068862_1000697433 126
296 3300005844 Ga0068862_100145353 Ga0068862_1001453534 126
297 3300006058 Ga0075432_10340866 Ga0075432_103408661 126
298 3300006237 Ga0097621_100325126 Ga0097621_1003251263 126
299 3300006844 Ga0075428_100174761 Ga0075428_1001747612 126
300 3300006844 Ga0075428_101665393 Ga0075428_1016653931 126
301 3300006852 Ga0075433_10259021 Ga0075433_102590213 126
302 3300006871 Ga0075434_100048138 Ga0075434_1000481385 126
303 3300006880 Ga0075429_100744569 Ga0075429_1007445691 126
304 3300006880 Ga0075429_100754159 Ga0075429_1007541592 126
305 3300006881 Ga0068865_100417301 Ga0068865_1004173011 126
306 3300006914 Ga0075436_100058308 Ga0075436_1000583084 126
307 3300006931 Ga0097620_100234724 Ga0097620_1002347245 126
308 3300006931 Ga0097620_100489823 Ga0097620_1004898232 126
309 3300009147 Ga0114129_10064747 Ga0114129_100647474 126
310 3300009147 Ga0114129_10242081 Ga0114129_102420813 126
311 3300009147 Ga0114129_10888519 Ga0114129_108885191 126
312 3300009176 Ga0105242_10021814 Ga0105242_100218142 126
313 3300009553 Ga0105249_10517857 Ga0105249_105178571 126
314 3300009553 Ga0105249_12427593 Ga0105249_124275931 126
315 3300010375 Ga0105239_10594223 Ga0105239_105942232 126
316 3300011119 Ga0105246_10026473 Ga0105246_100264731 126
317 3300011119 Ga0105246_10360005 Ga0105246_103600051 126
318 3300012473 Ga0157340_1000524 Ga0157340_10005242 126
319 3300012477 Ga0157336_1001260 Ga0157336_10012601 126
320 3300012483 Ga0157337_1000262 Ga0157337_10002623 126
321 3300012494 Ga0157341_1007661 Ga0157341_10076611 126
322 3300012498 Ga0157345_1001292 Ga0157345_10012922 126
323 3300012503 Ga0157313_1000116 Ga0157313_10001161 126
324 3300012510 Ga0157316_1001849 Ga0157316_10018493 126
325 3300012515 Ga0157338_1010696 Ga0157338_10106962 126
326 3300013297 Ga0157378_10046095 Ga0157378_100460954 126
327 3300013308 Ga0157375_11421371 Ga0157375_114213711 126
328 3300013308 Ga0157375_11479925 Ga0157375_114799251 126
329 3300014326 Ga0157380_10095271 Ga0157380_100952714 126
330 3300014326 Ga0157380_10492354 Ga0157380_104923542 126
331 3300025893 Ga0207682_10031172 Ga0207682_100311724 126
332 3300025899 Ga0207642_10013096 Ga0207642_100130962 126
333 3300025899 Ga0207642_10502493 Ga0207642_105024932 126
334 3300025904 Ga0207647_10017360 Ga0207647_100173601 126
335 3300025907 Ga0207645_10006750 Ga0207645_1000675012 126
336 3300025907 Ga0207645_10012571 Ga0207645_100125718 126
337 3300025908 Ga0207643_10002365 Ga0207643_100023655 126
338 3300025908 Ga0207643_10017433 Ga0207643_100174333 126
339 3300025912 Ga0207707_10204196 Ga0207707_102041963 126
340 3300025917 Ga0207660_10786452 Ga0207660_107864521 126
341 3300025917 Ga0207660_11186690 Ga0207660_111866901 126
342 3300025918 Ga0207662_10348527 Ga0207662_103485272 126
343 3300025919 Ga0207657_11375039 Ga0207657_113750391 126
344 3300025921 Ga0207652_10524150 Ga0207652_105241502 126
345 3300025923 Ga0207681_10322683 Ga0207681_103226831 126
346 3300025923 Ga0207681_10871403 Ga0207681_108714031 126
347 3300025925 Ga0207650_10013622 Ga0207650_100136224 126
348 3300025925 Ga0207650_10064384 Ga0207650_100643842 126
349 3300025932 Ga0207690_10312737 Ga0207690_103127371 126
350 3300025933 Ga0207706_10032443 Ga0207706_100324431 126
351 3300025937 Ga0207669_10941902 Ga0207669_109419021 126
352 3300025938 Ga0207704_10083022 Ga0207704_100830221 126
353 3300025938 Ga0207704_10825998 Ga0207704_108259981 126
354 3300025940 Ga0207691_10028158 Ga0207691_100281583 126
355 3300025942 Ga0207689_10016242 Ga0207689_100162423 126
356 3300025945 Ga0207679_10054451 Ga0207679_100544513 126
357 3300025960 Ga0207651_10111367 Ga0207651_101113671 126
358 3300025961 Ga0207712_10261538 Ga0207712_102615382 126
359 3300025981 Ga0207640_10220196 Ga0207640_102201963 126
360 3300026023 Ga0207677_10808971 Ga0207677_108089711 126
361 3300026067 Ga0207678_10385647 Ga0207678_103856472 126
362 3300026075 Ga0207708_10022390 Ga0207708_100223901 126
363 3300026075 Ga0207708_10147409 Ga0207708_101474092 126
364 3300026075 Ga0207708_10646664 Ga0207708_106466641 126
365 3300026089 Ga0207648_10016887 Ga0207648_100168873 126
366 3300026089 Ga0207648_10042357 Ga0207648_100423575 126
367 3300026095 Ga0207676_10113290 Ga0207676_101132902 126
368 3300026116 Ga0207674_10135805 Ga0207674_101358054 126
369 3300026118 Ga0207675_100632627 Ga0207675_1006326271 126
370 3300026121 Ga0207683_10296026 Ga0207683_102960262 126
371 3300026121 Ga0207683_10484002 Ga0207683_104840022 126
372 3300026142 Ga0207698_10017033 Ga0207698_100170336 126
373 3300027252 Ga0209973_1000801 Ga0209973_10008011 126
374 3300027364 Ga0209967_1020207 Ga0209967_10202072 126
375 3300027378 Ga0209981_1026234 Ga0209981_10262341 126
376 3300027462 Ga0210000_1003097 Ga0210000_10030972 126
377 3300027471 Ga0209995_1000182 Ga0209995_10001826 126
378 3300027471 Ga0209995_1033242 Ga0209995_10332421 126
379 3300027526 Ga0209968_1000164 Ga0209968_10001649 126
380 3300027543 Ga0209999_1002675 Ga0209999_10026754 126
381 3300027543 Ga0209999_1019675 Ga0209999_10196752 126
382 3300027543 Ga0209999_1073204 Ga0209999_10732041 126
383 3300027552 Ga0209982_1000463 Ga0209982_10004638 126
384 3300027614 Ga0209970_1009869 Ga0209970_10098692 126
385 3300027665 Ga0209983_1001356 Ga0209983_10013563 126
386 3300027682 Ga0209971_1002213 Ga0209971_10022135 126
387 3300027695 Ga0209966_1000520 Ga0209966_10005207 126
388 3300027876 Ga0209974_10002674 Ga0209974_100026748 126
389 3300027907 Ga0207428_10031641 Ga0207428_100316414 126
390 3300028380 Ga0268265_10203701 Ga0268265_102037012 126
391 3300028380 Ga0268265_10337788 Ga0268265_103377883 126
392 3300028381 Ga0268264_10476546 Ga0268264_104765461 126
393 3300042003 Ga0439443_008932 Ga0439443_008932_858_1238 126
394 3300042993 Ga0439440_0009859 Ga0439440_0009859_1285_1665 126
395 3300045051 Ga0451576_2666389 Ga0451576_2666389_45_425 126
396 3300050507 nmdc:mga05p37_344571_c1 nmdc:mga05p37_344571_c1_265_645 126
397 3300050507 nmdc:mga05p37_54717_c1 nmdc:mga05p37_54717_c1_493_873 126
398 3300050507 nmdc:mga05p37_670557_c1 nmdc:mga05p37_670557_c1_66_446 126
399 3300050508 nmdc:mga09592_157948_c1 nmdc:mga09592_157948_c1_415_795 126
400 3300050510 nmdc:mga06r32_610666_c1 nmdc:mga06r32_610666_c1_554_934 126
401 3300050511 nmdc:mga08y16_163094_c1 nmdc:mga08y16_163094_c1_711_1091 126
402 3300050511 nmdc:mga08y16_245930_c1 nmdc:mga08y16_245930_c1_864_1244 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

138

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.7841 6 122
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.7649 6 122
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7637 6 126
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.7622 7 126
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.7594 7 126
ID Description Score Start End Superfamily
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7673 10 55 3.30.720.120
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7644 63 126 3.30.720.110
3sk1C01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7638 7 55 3.30.720.120
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7591 6 126 3.10.180.10
af_O06412_6_120_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7556 9 126 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4R7EJ75-F1-model_v4 deleted 0.9808 4 126
AF-A0A1N7R5G9-F1-model_v4 VOC domain-containing protein 0.9774 2 126
AF-A0A495WKB7-F1-model_v4 deleted 0.972 6 124
AF-A0A1N7R5G9-F1-model_v4 VOC domain-containing protein 0.9623 2 126
AF-A0A3D5SN61-F1-model_v4 Glyoxalase 0.962 4 112

Feature Viewer

pLDDT pTM Quality
95.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map