F434945

General Info

Members Datasets Scaffolds Average Seq Length
401 248 802 93

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0439151|Ga0496126_0439151_314_598
Length 94
Sequence MINASLGPVGQEIAARLELALRPERLDVINDSAKHRGHMGDDGTGESHFTVDVVAAVFEGKSRVARQRLVNDALADLLREKVHALAIKARAPGE

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
197 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
198 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
199 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
200 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
201 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
202 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
205 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
243 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
246 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
247 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
248 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.22
Nodule 0.25
Rhizoplane 1.5
Rhizosphere 83.29
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0439151 3300048929 Bacteria 1052
2 JGI25406J46586_10038629 3300003203 Bacteria 1709
3 Ga0070658_10001363 3300005327 Bacteria 20879
4 Ga0070658_10610518 3300005327 Unclassified 945
5 Ga0070676_10276909 3300005328 Bacteria 1129
6 Ga0070683_100238232 3300005329 Bacteria 1730
7 Ga0070690_100363311 3300005330 Bacteria 1054
8 Ga0070677_10109270 3300005333 Bacteria 1232
9 Ga0070677_10251647 3300005333 Bacteria 877
10 Ga0070680_100002726 3300005336 Bacteria 13100
11 Ga0068868_101843293 3300005338 Bacteria 572
12 Ga0070660_100638223 3300005339 Unclassified 891
13 Ga0070689_100134116 3300005340 Bacteria 1987
14 Ga0070691_10321948 3300005341 Bacteria 851
15 Ga0070661_100991457 3300005344 Unclassified 697
16 Ga0070661_101080662 3300005344 Bacteria 668
17 Ga0070668_100778060 3300005347 Bacteria 849
18 Ga0070669_100085390 3300005353 Bacteria 2356
19 Ga0070669_101657614 3300005353 Bacteria 557
20 Ga0070675_100155722 3300005354 Bacteria 1962
21 Ga0070675_100573266 3300005354 Bacteria 1022
22 Ga0070675_101315172 3300005354 Bacteria 666
23 Ga0070674_100700194 3300005356 Bacteria 866
24 Ga0070673_100534187 3300005364 Bacteria 1064
25 Ga0070673_101246176 3300005364 Bacteria 698
26 Ga0070673_101533806 3300005364 Bacteria 629
27 Ga0070688_100099563 3300005365 Bacteria 1914
28 Ga0070659_100267415 3300005366 Bacteria 1420
29 Ga0070659_100282550 3300005366 Bacteria 1381
30 Ga0070713_100058109 3300005436 Bacteria 3224
31 Ga0070710_10444930 3300005437 Bacteria 877
32 Ga0070701_10163266 3300005438 Bacteria 1292
33 Ga0070700_100279110 3300005441 Bacteria 1210
34 Ga0070708_100192741 3300005445 Bacteria 1906
35 Ga0070708_101730869 3300005445 Bacteria 581
36 Ga0070663_100631021 3300005455 Bacteria 904
37 Ga0070678_100164265 3300005456 Bacteria 1802
38 Ga0070678_100722215 3300005456 Bacteria 899
39 Ga0070681_10001125 3300005458 Bacteria 22954
40 Ga0070681_10216354 3300005458 Bacteria 1832
41 Ga0068867_100852828 3300005459 Bacteria 816
42 Ga0068867_101167633 3300005459 Bacteria 706
43 Ga0068867_101722113 3300005459 Unclassified 588
44 Ga0070685_10872461 3300005466 Bacteria 668
45 Ga0070706_100087724 3300005467 Bacteria 2884
46 Ga0070706_102108384 3300005467 Unclassified 510
47 Ga0070707_100268846 3300005468 Bacteria 1658
48 Ga0070707_100746426 3300005468 Bacteria 942
49 Ga0070698_100091344 3300005471 Bacteria 3027
50 Ga0070698_100741816 3300005471 Bacteria 925
51 Ga0070699_100127043 3300005518 Bacteria 2245
52 Ga0070699_100271298 3300005518 Bacteria 1518
53 Ga0070679_100002434 3300005530 Bacteria 16873
54 Ga0070679_100809287 3300005530 Bacteria 880
55 Ga0070679_100859259 3300005530 Bacteria 851
56 Ga0070684_100279381 3300005535 Bacteria 1530
57 Ga0070672_100322118 3300005543 Bacteria 1314
58 Ga0070672_100706794 3300005543 Bacteria 883
59 Ga0070693_100314018 3300005547 Bacteria 1061
60 Ga0070665_100008433 3300005548 Bacteria 10424
61 Ga0070665_100083687 3300005548 Bacteria 3195
62 Ga0070665_100089575 3300005548 Bacteria 3082
63 Ga0070704_102003218 3300005549 Unclassified 537
64 Ga0068855_100002702 3300005563 Bacteria 21860
65 Ga0068855_100594818 3300005563 Bacteria 1193
66 Ga0068855_100686926 3300005563 Bacteria 1096
67 Ga0068855_101127052 3300005563 Bacteria 819
68 Ga0068855_101902944 3300005563 Bacteria 602
69 Ga0068855_102165079 3300005563 Bacteria 559
70 Ga0070664_100102809 3300005564 Bacteria 2486
71 Ga0068856_100009580 3300005614 Bacteria 9407
72 Ga0068856_100018663 3300005614 Bacteria 6723
73 Ga0068856_101929547 3300005614 Bacteria 601
74 Ga0068852_100700934 3300005616 Bacteria 1022
75 Ga0068859_100132196 3300005617 Bacteria 2567
76 Ga0068859_100438297 3300005617 Bacteria 1403
77 Ga0068859_101564164 3300005617 Unclassified 728
78 Ga0068864_100624897 3300005618 Bacteria 1047
79 Ga0068866_11100900 3300005718 Unclassified 569
80 Ga0068870_11100910 3300005840 Bacteria 571
81 Ga0068858_100710460 3300005842 Bacteria 978
82 Ga0068858_100908436 3300005842 Bacteria 861
83 Ga0068858_100982219 3300005842 Bacteria 827
84 Ga0068858_101193159 3300005842 Bacteria 748
85 Ga0068858_102338083 3300005842 Unclassified 528
86 Ga0068860_100860256 3300005843 Bacteria 922
87 Ga0068860_101859774 3300005843 Unclassified 624
88 Ga0068862_100778668 3300005844 Bacteria 933
89 Ga0068862_101695227 3300005844 Unclassified 640
90 Ga0081455_10000211 3300005937 Bacteria 74488
91 Ga0081455_10002000 3300005937 Bacteria 24347
92 Ga0081455_10185880 3300005937 Bacteria 1570
93 Ga0081540_1051837 3300005983 Bacteria 2026
94 Ga0081539_10016841 3300005985 Bacteria 5183
95 Ga0070717_11204786 3300006028 Bacteria 689
96 Ga0075365_10078041 3300006038 Bacteria 2238
97 Ga0075365_10211828 3300006038 Bacteria 1358
98 Ga0075365_10316278 3300006038 Bacteria 1099
99 Ga0075368_10312604 3300006042 Bacteria 679
100 Ga0075368_10321016 3300006042 Bacteria 671
101 Ga0075363_100062186 3300006048 Bacteria 2013
102 Ga0075363_100098000 3300006048 Bacteria 1620
103 Ga0075363_100318394 3300006048 Bacteria 905
104 Ga0075364_10167906 3300006051 Bacteria 1483
105 Ga0075364_11199681 3300006051 Bacteria 514
106 Ga0075432_10195463 3300006058 Unclassified 798
107 Ga0075432_10243673 3300006058 Bacteria 727
108 Ga0070716_100823214 3300006173 Bacteria 721
109 Ga0075362_10085763 3300006177 Bacteria 1456
110 Ga0075362_10109567 3300006177 Bacteria 1298
111 Ga0075362_10156543 3300006177 Bacteria 1095
112 Ga0075367_10043602 3300006178 Bacteria 2627
113 Ga0075367_10048932 3300006178 Bacteria 2491
114 Ga0075367_10187411 3300006178 Bacteria 1290
115 Ga0075367_10265971 3300006178 Bacteria 1077
116 Ga0075369_10002406 3300006186 Bacteria 6673
117 Ga0075369_10239365 3300006186 Bacteria 842
118 Ga0075369_10359205 3300006186 Bacteria 684
119 Ga0075366_10090899 3300006195 Bacteria 1828
120 Ga0075366_10101026 3300006195 Bacteria 1731
121 Ga0075366_10304976 3300006195 Bacteria 974
122 Ga0075366_10839208 3300006195 Bacteria 572
123 Ga0097621_101073409 3300006237 Bacteria 755
124 Ga0097621_102003228 3300006237 Bacteria 553
125 Ga0075370_10226470 3300006353 Bacteria 1106
126 Ga0075370_10392048 3300006353 Bacteria 832
127 Ga0075428_101556601 3300006844 Bacteria 692
128 Ga0075428_102298003 3300006844 Bacteria 555
129 Ga0075430_100206888 3300006846 Bacteria 1629
130 Ga0075430_100253223 3300006846 Bacteria 1459
131 Ga0075433_11880335 3300006852 Bacteria 514
132 Ga0097620_100132195 3300006931 Bacteria 2567
133 Ga0097620_100438303 3300006931 Bacteria 1403
134 Ga0097620_101564173 3300006931 Unclassified 728
135 Ga0099795_10321012 3300007788 Bacteria 686
136 Ga0099795_10388726 3300007788 Bacteria 631
137 Ga0105240_10005243 3300009093 Bacteria 19366
138 Ga0105240_10091576 3300009093 Bacteria 3714
139 Ga0105240_12755603 3300009093 Bacteria 506
140 Ga0111539_10900807 3300009094 Unclassified 1029
141 Ga0105245_12057535 3300009098 Bacteria 625
142 Ga0105245_12229069 3300009098 Unclassified 601
143 Ga0105247_10611132 3300009101 Bacteria 810
144 Ga0105243_10723777 3300009148 Bacteria 973
145 Ga0105241_10410281 3300009174 Unclassified 1190
146 Ga0105242_12728229 3300009176 Bacteria 544
147 Ga0105248_10983454 3300009177 Bacteria 953
148 Ga0105248_11207059 3300009177 Bacteria 855
149 Ga0105248_11580314 3300009177 Bacteria 743
150 Ga0105248_11696820 3300009177 Unclassified 716
151 Ga0105237_11170452 3300009545 Bacteria 775
152 Ga0105238_10035130 3300009551 Bacteria 5098
153 Ga0105238_10402942 3300009551 Bacteria 1361
154 Ga0105238_10577919 3300009551 Bacteria 1130
155 Ga0105238_11347804 3300009551 Bacteria 740
156 Ga0105249_11367373 3300009553 Bacteria 780
157 Ga0105035_116949 3300009988 Unclassified 676
158 Ga0099796_10041201 3300010159 Bacteria 1563
159 Ga0105239_10218731 3300010375 Bacteria 2136
160 Ga0105239_12302101 3300010375 Bacteria 627
161 Ga0105239_12314112 3300010375 Bacteria 625
162 Ga0105246_10230997 3300011119 Bacteria 1457
163 Ga0157373_10664868 3300013100 Unclassified 761
164 Ga0157370_10138449 3300013104 Bacteria 2268
165 Ga0157369_10090776 3300013105 Bacteria 3262
166 Ga0157374_11536585 3300013296 Unclassified 689
167 Ga0157378_10503416 3300013297 Bacteria 1210
168 Ga0157378_11259878 3300013297 Bacteria 780
169 Ga0157378_11933027 3300013297 Bacteria 639
170 Ga0157378_13287591 3300013297 Bacteria 502
171 Ga0163162_12494402 3300013306 Bacteria 595
172 Ga0157372_10150818 3300013307 Bacteria 2683
173 Ga0157372_11009552 3300013307 Bacteria 964
174 Ga0163163_11791654 3300014325 Bacteria 674
175 Ga0157380_10507291 3300014326 Bacteria 1173
176 Ga0182008_10377590 3300014497 Bacteria 757
177 Ga0157377_10852586 3300014745 Bacteria 677
178 Ga0157379_10235122 3300014968 Bacteria 1662
179 Ga0157376_11106598 3300014969 Bacteria 818
180 Ga0157376_11135578 3300014969 Bacteria 808
181 Ga0182007_10208132 3300015262 Bacteria 686
182 Ga0206353_10760786 3300020082 Bacteria 517
183 Ga0213871_10294051 3300021441 Bacteria 523
184 Ga0209025_1015993 3300025294 Bacteria 4469
185 Ga0207426_1039272 3300025302 Bacteria 1484
186 Ga0207682_10288227 3300025893 Bacteria 768
187 Ga0207692_10362157 3300025898 Bacteria 896
188 Ga0207688_10533400 3300025901 Bacteria 737
189 Ga0207647_10338931 3300025904 Bacteria 852
190 Ga0207645_10485023 3300025907 Bacteria 836
191 Ga0207643_10790251 3300025908 Bacteria 615
192 Ga0207705_10032707 3300025909 Bacteria 3717
193 Ga0207705_10439226 3300025909 Bacteria 1011
194 Ga0207684_10086154 3300025910 Bacteria 2675
195 Ga0207707_10004051 3300025912 Bacteria 12990
196 Ga0207695_10050369 3300025913 Bacteria 4382
197 Ga0207695_10208322 3300025913 Bacteria 1867
198 Ga0207660_10002500 3300025917 Bacteria 12085
199 Ga0207662_10047945 3300025918 Bacteria 2531
200 Ga0207662_10064047 3300025918 Bacteria 2211
201 Ga0207657_10104225 3300025919 Bacteria 2350
202 Ga0207649_10095010 3300025920 Bacteria 1960
203 Ga0207649_10429255 3300025920 Bacteria 994
204 Ga0207652_10002170 3300025921 Bacteria 16778
205 Ga0207652_11362471 3300025921 Bacteria 612
206 Ga0207646_10638229 3300025922 Bacteria 955
207 Ga0207681_10084603 3300025923 Bacteria 2249
208 Ga0207694_10139159 3300025924 Bacteria 1951
209 Ga0207694_10462798 3300025924 Bacteria 1060
210 Ga0207694_10654851 3300025924 Bacteria 885
211 Ga0207659_10528951 3300025926 Bacteria 1000
212 Ga0207700_10272880 3300025928 Bacteria 1452
213 Ga0207644_10015149 3300025931 Bacteria 5173
214 Ga0207644_11763150 3300025931 Bacteria 518
215 Ga0207690_10143243 3300025932 Bacteria 1764
216 Ga0207690_10164823 3300025932 Bacteria 1655
217 Ga0207670_10089698 3300025936 Bacteria 2170
218 Ga0207669_10321164 3300025937 Bacteria 1185
219 Ga0207665_10239594 3300025939 Bacteria 1336
220 Ga0207691_10171877 3300025940 Bacteria 1897
221 Ga0207691_10317337 3300025940 Bacteria 1336
222 Ga0207691_10677617 3300025940 Bacteria 870
223 Ga0207711_11057917 3300025941 Unclassified 752
224 Ga0207711_11141108 3300025941 Bacteria 720
225 Ga0207711_11904259 3300025941 Bacteria 537
226 Ga0207689_11434532 3300025942 Bacteria 578
227 Ga0207679_10756344 3300025945 Bacteria 884
228 Ga0207667_10604948 3300025949 Bacteria 1105
229 Ga0207667_12071331 3300025949 Unclassified 528
230 Ga0207651_10480966 3300025960 Bacteria 1070
231 Ga0207651_10484107 3300025960 Bacteria 1067
232 Ga0207651_11106950 3300025960 Bacteria 710
233 Ga0207640_10701313 3300025981 Bacteria 868
234 Ga0207658_10653909 3300025986 Unclassified 948
235 Ga0207677_11038257 3300026023 Bacteria 745
236 Ga0207703_10276082 3300026035 Bacteria 1524
237 Ga0207703_10648486 3300026035 Bacteria 1001
238 Ga0207703_10684130 3300026035 Bacteria 975
239 Ga0207703_11080551 3300026035 Bacteria 771
240 Ga0207639_11231941 3300026041 Bacteria 702
241 Ga0207639_11267914 3300026041 Bacteria 692
242 Ga0207639_11688498 3300026041 Bacteria 594
243 Ga0207708_10298798 3300026075 Bacteria 1309
244 Ga0207702_10699055 3300026078 Unclassified 999
245 Ga0207641_10620833 3300026088 Bacteria 1060
246 Ga0207648_10818099 3300026089 Bacteria 868
247 Ga0207674_10015068 3300026116 Bacteria 8511
248 Ga0207674_10306355 3300026116 Bacteria 1537
249 Ga0207675_100396782 3300026118 Bacteria 1359
250 Ga0207675_100740114 3300026118 Bacteria 994
251 Ga0207683_10115548 3300026121 Bacteria 2406
252 Ga0207683_10432970 3300026121 Bacteria 1212
253 Ga0207698_10380718 3300026142 Bacteria 1342
254 Ga0209813_10057946 3300027866 Bacteria 1230
255 Ga0209974_10452887 3300027876 Bacteria 509
256 Ga0207428_10181874 3300027907 Bacteria 1588
257 Ga0207428_10887484 3300027907 Bacteria 630
258 Ga0268266_10099616 3300028379 Bacteria 2558
259 Ga0268266_10111399 3300028379 Bacteria 2425
260 Ga0268266_10389159 3300028379 Bacteria 1316
261 Ga0268266_11720322 3300028379 Bacteria 602
262 Ga0268265_10632072 3300028380 Bacteria 1027
263 Ga0268264_10311460 3300028381 Bacteria 1485
264 Ga0268264_10354189 3300028381 Bacteria 1398
265 Ga0265334_10038511 3300028573 Bacteria 1880
266 Ga0265332_10270448 3300031238 Bacteria 702
267 Ga0265340_10052952 3300031247 Bacteria 1961
268 Ga0265331_10512114 3300031250 Unclassified 540
269 Ga0265316_10536091 3300031344 Bacteria 834
270 Ga0307408_100218702 3300031548 Bacteria 1553
271 Ga0265314_10400952 3300031711 Unclassified 742
272 Ga0265314_10650251 3300031711 Unclassified 538
273 Ga0265342_10226247 3300031712 Bacteria 1006
274 Ga0307405_11420860 3300031731 Bacteria 607
275 Ga0307413_10235122 3300031824 Bacteria 1349
276 Ga0307406_10407144 3300031901 Bacteria 1080
277 Ga0307407_10439169 3300031903 Bacteria 945
278 Ga0307407_10716964 3300031903 Bacteria 755
279 Ga0307412_10392783 3300031911 Bacteria 1127
280 Ga0307409_102450032 3300031995 Bacteria 551
281 Ga0307416_100633715 3300032002 Bacteria 1152
282 Ga0307416_102440362 3300032002 Bacteria 622
283 Ga0307416_103834372 3300032002 Unclassified 503
284 Ga0307414_10744591 3300032004 Unclassified 890
285 Ga0307411_11026573 3300032005 Unclassified 740
286 Ga0373930_0063204 3300034816 Bacteria 829
287 Ga0373938_0202233 3300034957 Bacteria 551
288 Ga0373928_0012183 3300035084 Bacteria 1712
289 Ga0373929_0049380 3300035085 Bacteria 958
290 Ga0373934_0172182 3300035086 Bacteria 889
291 Ga0373932_0218363 3300035112 Bacteria 684
292 Ga0373936_0083635 3300035113 Bacteria 1331
293 Ga0373945_0395740 3300035116 Unclassified 605
294 Ga0373960_0121814 3300035121 Unclassified 866
295 Ga0373955_0605898 3300035172 Bacteria 671
296 Ga0373931_0241318 3300035691 Bacteria 1095
297 Ga0373931_0612704 3300035691 Bacteria 712
298 Ga0373935_0165313 3300035692 Bacteria 1511
299 Ga0373935_0629018 3300035692 Bacteria 786
300 Ga0373927_0029844 3300035695 Bacteria 3557
301 Ga0373927_0763239 3300035695 Unclassified 639
302 Ga0373927_1029888 3300035695 Unclassified 543
303 Ga0373947_0125346 3300035725 Bacteria 1635
304 Ga0373937_0107172 3300036401 Bacteria 2598
305 Ga0373925_0096227 3300037068 Bacteria 2269
306 Ga0373925_0215240 3300037068 Bacteria 1532
307 Ga0373925_1312050 3300037068 Unclassified 594
308 Ga0395899_0014851 3300037312 Bacteria 5944
309 Ga0395899_0015155 3300037312 Bacteria 5877
310 Ga0395899_0035258 3300037312 Bacteria 3756
311 Ga0395899_0315523 3300037312 Bacteria 1054
312 Ga0395900_0004704 3300037418 Bacteria 14390
313 Ga0395900_0010188 3300037418 Bacteria 9615
314 Ga0395900_0041681 3300037418 Bacteria 4732
315 Ga0395898_0105573 3300037466 Bacteria 2701
316 Ga0395901_0009704 3300038443 Bacteria 9762
317 Ga0395901_0032183 3300038443 Bacteria 5412
318 Ga0395901_0074762 3300038443 Bacteria 3534
319 Ga0395901_1371589 3300038443 Bacteria 666
320 Ga0436365_1203241 3300039437 Unclassified 598
321 Ga0436365_1432446 3300039437 Bacteria 719
322 Ga0436360_0282685 3300039438 Bacteria 1570
323 Ga0436360_0866136 3300039438 Bacteria 1505
324 Ga0436363_0713451 3300039450 Bacteria 947
325 Ga0439461_0064722 3300041410 Bacteria 837
326 Ga0451793_0694481 3300041452 Bacteria 590
327 Ga0451797_0198329 3300041453 Bacteria 836
328 Ga0439441_130165 3300042001 Bacteria 582
329 Ga0439432_108201 3300042006 Bacteria 829
330 Ga0439452_095316 3300042010 Unclassified 641
331 Ga0439458_0150689 3300042157 Bacteria 623
332 Ga0439459_0042185 3300042438 Bacteria 974
333 Ga0439464_0138882 3300042439 Unclassified 756
334 Ga0450918_103959 3300042531 Bacteria 558
335 Ga0466957_0134171 3300044842 Bacteria 1589
336 Ga0466958_0666481 3300045836 Bacteria 677
337 Ga0466967_0032692 3300045976 Bacteria 4396
338 Ga0495658_0613608 3300046683 Bacteria 697
339 Ga0496104_1448339 3300048907 Bacteria 590
340 Ga0496112_1932536 3300048915 Bacteria 501
341 Ga0496113_1487777 3300048916 Unclassified 523
342 Ga0496114_0686240 3300048917 Bacteria 899
343 Ga0496122_0022185 3300048925 Bacteria 5654
344 Ga0496126_0016657 3300048929 Bacteria 7345
345 Ga0496126_1202353 3300048929 Bacteria 557
346 Ga0501033_0235822 3300049570 Bacteria 1299
347 Ga0501034_0001717 3300049571 Bacteria 28196
348 Ga0501034_0157877 3300049571 Bacteria 2241
349 Ga0501034_0267051 3300049571 Bacteria 1653
350 Ga0501034_0291563 3300049571 Bacteria 1569
351 Ga0501034_1276684 3300049571 Bacteria 611
352 Ga0501034_1571941 3300049571 Bacteria 531
353 Ga0501036_0348002 3300049572 Bacteria 1238
354 Ga0501037_0933119 3300049573 Bacteria 568
355 Ga0501039_0969327 3300049575 Unclassified 661
356 Ga0501039_1538514 3300049575 Bacteria 511
357 Ga0501042_0711675 3300049578 Bacteria 730
358 Ga0501043_0085987 3300049579 Bacteria 2471
359 Ga0501046_0268252 3300049580 Bacteria 1252
360 Ga0501047_0095696 3300049581 Bacteria 2848
361 Ga0501047_1227266 3300049581 Bacteria 563
362 Ga0501068_0015014 3300049584 Bacteria 4440
363 Ga0501068_1189610 3300049584 Bacteria 505
364 Ga0501070_0597710 3300049586 Bacteria 880
365 Ga0501072_0122482 3300049588 Bacteria 2072
366 Ga0501072_1440887 3300049588 Bacteria 532
367 Ga0501075_0451095 3300049591 Bacteria 981
368 Ga0501233_000271 3300049668 Bacteria 7927
369 Ga0501044_0062328 3300049823 Bacteria 3812
370 Ga0501044_0673382 3300049823 Bacteria 922
371 Ga0501045_1176288 3300049824 Bacteria 560
372 nmdc:mga03683_16520_c1 3300050489 Bacteria 2774
373 nmdc:mga03683_174141_c1 3300050489 Bacteria 979
374 nmdc:mga03n38_334043_c1 3300050490 Bacteria 821
375 nmdc:mga03n38_367421_c1 3300050490 Bacteria 786
376 nmdc:mga00v17_405245_c1 3300050491 Bacteria 886
377 nmdc:mga0yw44_104880_c1 3300050492 Bacteria 1805
378 nmdc:mga0yw44_170183_c2 3300050492 Bacteria 927
379 nmdc:mga0yw44_222177_c1 3300050492 Bacteria 1252
380 nmdc:mga0yw44_768440_c1 3300050492 Bacteria 654
381 nmdc:mga0k408_485195_c1 3300050493 Bacteria 733
382 nmdc:mga0k408_5975_c1 3300050493 Bacteria 6498
383 nmdc:mga0k408_71925_c1 3300050493 Bacteria 2019
384 nmdc:mga06z11_25821_c1 3300050494 Bacteria 2789
385 nmdc:mga06z11_806925_c1 3300050494 Bacteria 572
386 nmdc:mga06z11_84867_c1 3300050494 Bacteria 1707
387 nmdc:mga06z11_97544_c1 3300050494 Bacteria 1607
388 nmdc:mga07m45_69143_c1 3300050496 Bacteria 2007
389 nmdc:mga0qj67_331526_c1 3300050509 Bacteria 1231
390 nmdc:mga0qj67_609809_c1 3300050509 Bacteria 873
391 nmdc:mga08y16_1300457_c1 3300050511 Bacteria 694
392 nmdc:mga08y16_149359_c1 3300050511 Bacteria 2429
393 nmdc:mga0sz30_175_c1 3300050516 Bacteria 23966
394 Ga0500644_0211111 3300053088 Bacteria 806
395 Ga0500641_0009927 3300053096 Bacteria 3431
396 Ga0500595_088900 3300053119 Unclassified 896
397 Ga0500559_0017283 3300053136 Bacteria 3046
398 Ga0500568_0375024 3300053139 Unclassified 515
399 Ga0500604_0068789 3300053151 Bacteria 1125
400 Ga0466962_0698780 3300061719 Bacteria 520
401 2842335603 2842333319 Bacteria 8899485
402 Ga0496126_0439151
403 JGI25406J46586_10038629
404 Ga0070658_10001363
405 Ga0070658_10610518
406 Ga0070676_10276909
407 Ga0070683_100238232
408 Ga0070690_100363311
409 Ga0070677_10109270
410 Ga0070677_10251647
411 Ga0070680_100002726
412 Ga0068868_101843293
413 Ga0070660_100638223
414 Ga0070689_100134116
415 Ga0070691_10321948
416 Ga0070661_100991457
417 Ga0070661_101080662
418 Ga0070668_100778060
419 Ga0070669_100085390
420 Ga0070669_101657614
421 Ga0070675_100155722
422 Ga0070675_100573266
423 Ga0070675_101315172
424 Ga0070674_100700194
425 Ga0070673_100534187
426 Ga0070673_101246176
427 Ga0070673_101533806
428 Ga0070688_100099563
429 Ga0070659_100267415
430 Ga0070659_100282550
431 Ga0070713_100058109
432 Ga0070710_10444930
433 Ga0070701_10163266
434 Ga0070700_100279110
435 Ga0070708_100192741
436 Ga0070708_101730869
437 Ga0070663_100631021
438 Ga0070678_100164265
439 Ga0070678_100722215
440 Ga0070681_10001125
441 Ga0070681_10216354
442 Ga0068867_100852828
443 Ga0068867_101167633
444 Ga0068867_101722113
445 Ga0070685_10872461
446 Ga0070706_100087724
447 Ga0070706_102108384
448 Ga0070707_100268846
449 Ga0070707_100746426
450 Ga0070698_100091344
451 Ga0070698_100741816
452 Ga0070699_100127043
453 Ga0070699_100271298
454 Ga0070679_100002434
455 Ga0070679_100809287
456 Ga0070679_100859259
457 Ga0070684_100279381
458 Ga0070672_100322118
459 Ga0070672_100706794
460 Ga0070693_100314018
461 Ga0070665_100008433
462 Ga0070665_100083687
463 Ga0070665_100089575
464 Ga0070704_102003218
465 Ga0068855_100002702
466 Ga0068855_100594818
467 Ga0068855_100686926
468 Ga0068855_101127052
469 Ga0068855_101902944
470 Ga0068855_102165079
471 Ga0070664_100102809
472 Ga0068856_100009580
473 Ga0068856_100018663
474 Ga0068856_101929547
475 Ga0068852_100700934
476 Ga0068859_100132196
477 Ga0068859_100438297
478 Ga0068859_101564164
479 Ga0068864_100624897
480 Ga0068866_11100900
481 Ga0068870_11100910
482 Ga0068858_100710460
483 Ga0068858_100908436
484 Ga0068858_100982219
485 Ga0068858_101193159
486 Ga0068858_102338083
487 Ga0068860_100860256
488 Ga0068860_101859774
489 Ga0068862_100778668
490 Ga0068862_101695227
491 Ga0081455_10000211
492 Ga0081455_10002000
493 Ga0081455_10185880
494 Ga0081540_1051837
495 Ga0081539_10016841
496 Ga0070717_11204786
497 Ga0075365_10078041
498 Ga0075365_10211828
499 Ga0075365_10316278
500 Ga0075368_10312604
501 Ga0075368_10321016
502 Ga0075363_100062186
503 Ga0075363_100098000
504 Ga0075363_100318394
505 Ga0075364_10167906
506 Ga0075364_11199681
507 Ga0075432_10195463
508 Ga0075432_10243673
509 Ga0070716_100823214
510 Ga0075362_10085763
511 Ga0075362_10109567
512 Ga0075362_10156543
513 Ga0075367_10043602
514 Ga0075367_10048932
515 Ga0075367_10187411
516 Ga0075367_10265971
517 Ga0075369_10002406
518 Ga0075369_10239365
519 Ga0075369_10359205
520 Ga0075366_10090899
521 Ga0075366_10101026
522 Ga0075366_10304976
523 Ga0075366_10839208
524 Ga0097621_101073409
525 Ga0097621_102003228
526 Ga0075370_10226470
527 Ga0075370_10392048
528 Ga0075428_101556601
529 Ga0075428_102298003
530 Ga0075430_100206888
531 Ga0075430_100253223
532 Ga0075433_11880335
533 Ga0097620_100132195
534 Ga0097620_100438303
535 Ga0097620_101564173
536 Ga0099795_10321012
537 Ga0099795_10388726
538 Ga0105240_10005243
539 Ga0105240_10091576
540 Ga0105240_12755603
541 Ga0111539_10900807
542 Ga0105245_12057535
543 Ga0105245_12229069
544 Ga0105247_10611132
545 Ga0105243_10723777
546 Ga0105241_10410281
547 Ga0105242_12728229
548 Ga0105248_10983454
549 Ga0105248_11207059
550 Ga0105248_11580314
551 Ga0105248_11696820
552 Ga0105237_11170452
553 Ga0105238_10035130
554 Ga0105238_10402942
555 Ga0105238_10577919
556 Ga0105238_11347804
557 Ga0105249_11367373
558 Ga0105035_116949
559 Ga0099796_10041201
560 Ga0105239_10218731
561 Ga0105239_12302101
562 Ga0105239_12314112
563 Ga0105246_10230997
564 Ga0157373_10664868
565 Ga0157370_10138449
566 Ga0157369_10090776
567 Ga0157374_11536585
568 Ga0157378_10503416
569 Ga0157378_11259878
570 Ga0157378_11933027
571 Ga0157378_13287591
572 Ga0163162_12494402
573 Ga0157372_10150818
574 Ga0157372_11009552
575 Ga0163163_11791654
576 Ga0157380_10507291
577 Ga0182008_10377590
578 Ga0157377_10852586
579 Ga0157379_10235122
580 Ga0157376_11106598
581 Ga0157376_11135578
582 Ga0182007_10208132
583 Ga0206353_10760786
584 Ga0213871_10294051
585 Ga0209025_1015993
586 Ga0207426_1039272
587 Ga0207682_10288227
588 Ga0207692_10362157
589 Ga0207688_10533400
590 Ga0207647_10338931
591 Ga0207645_10485023
592 Ga0207643_10790251
593 Ga0207705_10032707
594 Ga0207705_10439226
595 Ga0207684_10086154
596 Ga0207707_10004051
597 Ga0207695_10050369
598 Ga0207695_10208322
599 Ga0207660_10002500
600 Ga0207662_10047945
601 Ga0207662_10064047
602 Ga0207657_10104225
603 Ga0207649_10095010
604 Ga0207649_10429255
605 Ga0207652_10002170
606 Ga0207652_11362471
607 Ga0207646_10638229
608 Ga0207681_10084603
609 Ga0207694_10139159
610 Ga0207694_10462798
611 Ga0207694_10654851
612 Ga0207659_10528951
613 Ga0207700_10272880
614 Ga0207644_10015149
615 Ga0207644_11763150
616 Ga0207690_10143243
617 Ga0207690_10164823
618 Ga0207670_10089698
619 Ga0207669_10321164
620 Ga0207665_10239594
621 Ga0207691_10171877
622 Ga0207691_10317337
623 Ga0207691_10677617
624 Ga0207711_11057917
625 Ga0207711_11141108
626 Ga0207711_11904259
627 Ga0207689_11434532
628 Ga0207679_10756344
629 Ga0207667_10604948
630 Ga0207667_12071331
631 Ga0207651_10480966
632 Ga0207651_10484107
633 Ga0207651_11106950
634 Ga0207640_10701313
635 Ga0207658_10653909
636 Ga0207677_11038257
637 Ga0207703_10276082
638 Ga0207703_10648486
639 Ga0207703_10684130
640 Ga0207703_11080551
641 Ga0207639_11231941
642 Ga0207639_11267914
643 Ga0207639_11688498
644 Ga0207708_10298798
645 Ga0207702_10699055
646 Ga0207641_10620833
647 Ga0207648_10818099
648 Ga0207674_10015068
649 Ga0207674_10306355
650 Ga0207675_100396782
651 Ga0207675_100740114
652 Ga0207683_10115548
653 Ga0207683_10432970
654 Ga0207698_10380718
655 Ga0209813_10057946
656 Ga0209974_10452887
657 Ga0207428_10181874
658 Ga0207428_10887484
659 Ga0268266_10099616
660 Ga0268266_10111399
661 Ga0268266_10389159
662 Ga0268266_11720322
663 Ga0268265_10632072
664 Ga0268264_10311460
665 Ga0268264_10354189
666 Ga0265334_10038511
667 Ga0265332_10270448
668 Ga0265340_10052952
669 Ga0265331_10512114
670 Ga0265316_10536091
671 Ga0307408_100218702
672 Ga0265314_10400952
673 Ga0265314_10650251
674 Ga0265342_10226247
675 Ga0307405_11420860
676 Ga0307413_10235122
677 Ga0307406_10407144
678 Ga0307407_10439169
679 Ga0307407_10716964
680 Ga0307412_10392783
681 Ga0307409_102450032
682 Ga0307416_100633715
683 Ga0307416_102440362
684 Ga0307416_103834372
685 Ga0307414_10744591
686 Ga0307411_11026573
687 Ga0373930_0063204
688 Ga0373938_0202233
689 Ga0373928_0012183
690 Ga0373929_0049380
691 Ga0373934_0172182
692 Ga0373932_0218363
693 Ga0373936_0083635
694 Ga0373945_0395740
695 Ga0373960_0121814
696 Ga0373955_0605898
697 Ga0373931_0241318
698 Ga0373931_0612704
699 Ga0373935_0165313
700 Ga0373935_0629018
701 Ga0373927_0029844
702 Ga0373927_0763239
703 Ga0373927_1029888
704 Ga0373947_0125346
705 Ga0373937_0107172
706 Ga0373925_0096227
707 Ga0373925_0215240
708 Ga0373925_1312050
709 Ga0395899_0014851
710 Ga0395899_0015155
711 Ga0395899_0035258
712 Ga0395899_0315523
713 Ga0395900_0004704
714 Ga0395900_0010188
715 Ga0395900_0041681
716 Ga0395898_0105573
717 Ga0395901_0009704
718 Ga0395901_0032183
719 Ga0395901_0074762
720 Ga0395901_1371589
721 Ga0436365_1203241
722 Ga0436365_1432446
723 Ga0436360_0282685
724 Ga0436360_0866136
725 Ga0436363_0713451
726 Ga0439461_0064722
727 Ga0451793_0694481
728 Ga0451797_0198329
729 Ga0439441_130165
730 Ga0439432_108201
731 Ga0439452_095316
732 Ga0439458_0150689
733 Ga0439459_0042185
734 Ga0439464_0138882
735 Ga0450918_103959
736 Ga0466957_0134171
737 Ga0466958_0666481
738 Ga0466967_0032692
739 Ga0495658_0613608
740 Ga0496104_1448339
741 Ga0496112_1932536
742 Ga0496113_1487777
743 Ga0496114_0686240
744 Ga0496122_0022185
745 Ga0496126_0016657
746 Ga0496126_1202353
747 Ga0501033_0235822
748 Ga0501034_0001717
749 Ga0501034_0157877
750 Ga0501034_0267051
751 Ga0501034_0291563
752 Ga0501034_1276684
753 Ga0501034_1571941
754 Ga0501036_0348002
755 Ga0501037_0933119
756 Ga0501039_0969327
757 Ga0501039_1538514
758 Ga0501042_0711675
759 Ga0501043_0085987
760 Ga0501046_0268252
761 Ga0501047_0095696
762 Ga0501047_1227266
763 Ga0501068_0015014
764 Ga0501068_1189610
765 Ga0501070_0597710
766 Ga0501072_0122482
767 Ga0501072_1440887
768 Ga0501075_0451095
769 Ga0501233_000271
770 Ga0501044_0062328
771 Ga0501044_0673382
772 Ga0501045_1176288
773 nmdc:mga03683_16520_c1
774 nmdc:mga03683_174141_c1
775 nmdc:mga03n38_334043_c1
776 nmdc:mga03n38_367421_c1
777 nmdc:mga00v17_405245_c1
778 nmdc:mga0yw44_104880_c1
779 nmdc:mga0yw44_170183_c2
780 nmdc:mga0yw44_222177_c1
781 nmdc:mga0yw44_768440_c1
782 nmdc:mga0k408_485195_c1
783 nmdc:mga0k408_5975_c1
784 nmdc:mga0k408_71925_c1
785 nmdc:mga06z11_25821_c1
786 nmdc:mga06z11_806925_c1
787 nmdc:mga06z11_84867_c1
788 nmdc:mga06z11_97544_c1
789 nmdc:mga07m45_69143_c1
790 nmdc:mga0qj67_331526_c1
791 nmdc:mga0qj67_609809_c1
792 nmdc:mga08y16_1300457_c1
793 nmdc:mga08y16_149359_c1
794 nmdc:mga0sz30_175_c1
795 Ga0500644_0211111
796 Ga0500641_0009927
797 Ga0500595_088900
798 Ga0500559_0017283
799 Ga0500568_0375024
800 Ga0500604_0068789
801 Ga0466962_0698780
802 2842335603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

17

94

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.9031 1 89
4pug-assembly2.cif.gz_B bola1 from arabidopsis thaliana 0.9014 1 89
4pui-assembly1.cif.gz_A bola domain of sufe1 from arabidopsis thaliana 0.894 1 89
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8811 6 93
4pui-assembly2.cif.gz_B bola domain of sufe1 from arabidopsis thaliana 0.8736 1 89
ID Description Score Start End Superfamily
af_Q8I3V0_1_83_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9288 4 93 3.10.20.90
af_Q9NEY7_29_106_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9103 1 86 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.9095 1 93 3.10.20.90
af_Q9USK1_28_105_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9083 1 86 3.30.300.90
af_Q5AGV3_21_122_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.906 1 86 3.10.20.90
ID Description Score Start End GO Terms
AF-Q13EG0-F1-model_v4 Transcriptional regulator BolA 0.9553 3 87 GO:0016226
AF-A0A2E3C2W7-F1-model_v4 BolA family transcriptional regulator 0.9548 6 93 GO:0016226
AF-A0A4Q6C8P3-F1-model_v4 BolA family transcriptional regulator 0.9529 2 89 GO:0016226
AF-A0A151A0H8-F1-model_v4 BolA family transcriptional regulator 0.9485 2 92 GO:0016226
AF-A0A2T6FCA5-F1-model_v4 BolA family transcriptional regulator 0.945 6 89 GO:0016226

Map