F434235

General Info

Members Datasets Scaffolds Average Seq Length
399 291 798 129

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100795544|Ga0070673_1007955441
Length 129
Sequence MMSTFPADLRYTHDHEWLRASGTAWRVGITQFAVDALGDITLIDLPKEGDEVTKGQRFGTVESVKSVSDLYAPVSGRVIAVNAALKDAPESVNTEPYGKGWMIEIEPNDKTEIDELLDAGAYTTHVAAQ

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
7 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
8 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
9 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
10 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
120 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
209 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
212 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
222 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
229 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
244 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
245 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
248 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
251 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
252 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
269 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
272 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
273 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
274 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
275 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
276 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
277 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
278 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
281 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
282 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
283 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
284 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
285 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
286 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
287 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
288 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
289 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.27
Nodule 0
Rhizoplane 1.25
Rhizosphere 85.96
Stem 0
Stem Tuber 0
Unclassified 6.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100795544 3300005364 Bacteria 873
2 SwRhRL3b_contig_2969327 2162886006 Bacteria 849
3 SwRhRL2b_contig_3734303 2162886007 Bacteria 841
4 JGI24750J21931_1040117 3300002070 Bacteria 709
5 rootL2_10047622 3300003322 Bacteria 2497
6 JGI26128J50194_1005210 3300003347 Bacteria 855
7 JGI26144J50225_101474 3300003380 Bacteria 692
8 JGI26136J50244_101687 3300003399 Unclassified 687
9 JGI26132J50249_100811 3300003405 Bacteria 985
10 JGI26138J51218_103854 3300003504 Bacteria 652
11 Ga0058862_11761949 3300004803 Bacteria 568
12 Ga0065704_10084483 3300005289 Bacteria 3329
13 Ga0065712_10233202 3300005290 Bacteria 1005
14 Ga0065715_10154571 3300005293 Bacteria 1684
15 Ga0065707_10108366 3300005295 Bacteria 2513
16 Ga0070676_10001548 3300005328 Bacteria 11639
17 Ga0070683_100348671 3300005329 Bacteria 1410
18 Ga0070683_101695064 3300005329 Unclassified 608
19 Ga0070690_100008409 3300005330 Bacteria 5942
20 Ga0070670_100006177 3300005331 Bacteria 10125
21 Ga0070677_10040247 3300005333 Bacteria 1838
22 Ga0068869_100016042 3300005334 Bacteria 5041
23 Ga0068869_100198447 3300005334 Bacteria 1581
24 Ga0068869_101329625 3300005334 Bacteria 635
25 Ga0070680_100016076 3300005336 Bacteria 5879
26 Ga0068868_100006284 3300005338 Bacteria 8399
27 Ga0068868_100232740 3300005338 Bacteria 1546
28 Ga0070660_100016918 3300005339 Bacteria 5307
29 Ga0070689_100016796 3300005340 Bacteria 5364
30 Ga0070689_100223570 3300005340 Bacteria 1545
31 Ga0070691_10007205 3300005341 Bacteria 5092
32 Ga0070687_100005580 3300005343 Bacteria 5104
33 Ga0070661_100021472 3300005344 Bacteria 4612
34 Ga0070692_10009895 3300005345 Bacteria 4317
35 Ga0070692_10049160 3300005345 Bacteria 2187
36 Ga0070668_100005406 3300005347 Bacteria 9480
37 Ga0070669_100002515 3300005353 Bacteria 13266
38 Ga0070675_100009217 3300005354 Bacteria 7668
39 Ga0070674_100001051 3300005356 Bacteria 14442
40 Ga0070674_100654216 3300005356 Bacteria 893
41 Ga0070673_100017225 3300005364 Bacteria 5131
42 Ga0070688_101051787 3300005365 Bacteria 649
43 Ga0070659_100024758 3300005366 Bacteria 4603
44 Ga0070667_100031298 3300005367 Bacteria 4437
45 Ga0070701_10250867 3300005438 Bacteria 1068
46 Ga0070701_10923598 3300005438 Bacteria 604
47 Ga0070711_101639988 3300005439 Bacteria 563
48 Ga0070705_100023474 3300005440 Bacteria 3313
49 Ga0070705_101529401 3300005440 Bacteria 560
50 Ga0070700_100000551 3300005441 Bacteria 18820
51 Ga0070694_100015324 3300005444 Bacteria 4812
52 Ga0070694_100278742 3300005444 Bacteria 1274
53 Ga0070694_100972429 3300005444 Bacteria 704
54 Ga0070708_100128829 3300005445 Bacteria 2341
55 Ga0070663_100014292 3300005455 Bacteria 5093
56 Ga0070678_100001424 3300005456 Bacteria 12738
57 Ga0070678_101135633 3300005456 Bacteria 722
58 Ga0070662_100000376 3300005457 Bacteria 26649
59 Ga0070681_10721259 3300005458 Bacteria 913
60 Ga0068867_100006040 3300005459 Bacteria 8581
61 Ga0070685_10040332 3300005466 Bacteria 2656
62 Ga0070685_10371401 3300005466 Unclassified 983
63 Ga0070706_100112745 3300005467 Bacteria 2532
64 Ga0070707_101766757 3300005468 Bacteria 586
65 Ga0070698_100001935 3300005471 Bacteria 23014
66 Ga0070679_100045621 3300005530 Bacteria 4367
67 Ga0070679_100126387 3300005530 Bacteria 2539
68 Ga0070679_101165324 3300005530 Bacteria 716
69 Ga0070679_101365262 3300005530 Unclassified 655
70 Ga0070684_100024468 3300005535 Bacteria 5066
71 Ga0070684_101363218 3300005535 Bacteria 668
72 Ga0070697_100954137 3300005536 Bacteria 762
73 Ga0070672_100002311 3300005543 Bacteria 12034
74 Ga0070686_101138715 3300005544 Bacteria 646
75 Ga0070695_100126349 3300005545 Bacteria 1757
76 Ga0070695_101328530 3300005545 Unclassified 595
77 Ga0070696_100004305 3300005546 Bacteria 9489
78 Ga0070665_102109034 3300005548 Bacteria 568
79 Ga0070704_100903067 3300005549 Bacteria 794
80 Ga0068855_100447938 3300005563 Bacteria 1409
81 Ga0068857_100102776 3300005577 Bacteria 2566
82 Ga0068854_100020366 3300005578 Bacteria 4487
83 Ga0068856_100183565 3300005614 Bacteria 2106
84 Ga0070702_100006211 3300005615 Bacteria 5637
85 Ga0068852_100397447 3300005616 Bacteria 1355
86 Ga0068859_100338498 3300005617 Bacteria 1599
87 Ga0068859_100402483 3300005617 Bacteria 1465
88 Ga0068859_100654842 3300005617 Bacteria 1142
89 Ga0068864_100573631 3300005618 Bacteria 1093
90 Ga0068866_10325750 3300005718 Bacteria 968
91 Ga0068861_100117451 3300005719 Bacteria 2141
92 Ga0068870_10007024 3300005840 Bacteria 4997
93 Ga0068863_100040729 3300005841 Bacteria 4417
94 Ga0068860_100043911 3300005843 Bacteria 4261
95 Ga0068860_100650554 3300005843 Unclassified 1062
96 Ga0068862_100040384 3300005844 Bacteria 3966
97 Ga0081455_10493609 3300005937 Bacteria 824
98 Ga0070717_10014205 3300006028 Bacteria 6123
99 Ga0070717_10076561 3300006028 Bacteria 2800
100 Ga0075432_10000967 3300006058 Bacteria 9083
101 Ga0070712_101218470 3300006175 Bacteria 655
102 Ga0097621_100008896 3300006237 Bacteria 7258
103 Ga0097621_100606676 3300006237 Bacteria 1001
104 Ga0097621_101016136 3300006237 Bacteria 776
105 Ga0068871_100137053 3300006358 Unclassified 2079
106 Ga0068871_100574497 3300006358 Bacteria 1023
107 Ga0075428_100973168 3300006844 Unclassified 899
108 Ga0075428_102524756 3300006844 Unclassified 526
109 Ga0075430_100015190 3300006846 Bacteria 6555
110 Ga0075431_100019083 3300006847 Bacteria 6986
111 Ga0075433_11087300 3300006852 Bacteria 695
112 Ga0075433_11959356 3300006852 Bacteria 502
113 Ga0075434_100212946 3300006871 Bacteria 1952
114 Ga0075434_100984868 3300006871 Bacteria 857
115 Ga0075429_100066978 3300006880 Bacteria 3125
116 Ga0075429_100326575 3300006880 Bacteria 1343
117 Ga0068865_100000796 3300006881 Bacteria 17760
118 Ga0075436_100066755 3300006914 Bacteria 2487
119 Ga0075436_100815039 3300006914 Bacteria 695
120 Ga0097620_100338524 3300006931 Bacteria 1599
121 Ga0097620_100402520 3300006931 Bacteria 1465
122 Ga0097620_100654846 3300006931 Bacteria 1142
123 Ga0075435_100323106 3300007076 Bacteria 1321
124 Ga0075435_100659433 3300007076 Bacteria 908
125 Ga0105240_10398513 3300009093 Bacteria 1551
126 Ga0111539_10109127 3300009094 Bacteria 3247
127 Ga0111539_10435658 3300009094 Bacteria 1526
128 Ga0111539_10588403 3300009094 Bacteria 1296
129 Ga0105245_10023190 3300009098 Bacteria 5447
130 Ga0105245_10257606 3300009098 Bacteria 1697
131 Ga0105245_10560789 3300009098 Bacteria 1165
132 Ga0105245_12971211 3300009098 Bacteria 525
133 Ga0114129_10266861 3300009147 Bacteria 2291
134 Ga0114129_12698035 3300009147 Unclassified 592
135 Ga0105243_10027099 3300009148 Bacteria 4389
136 Ga0105243_10176644 3300009148 Bacteria 1854
137 Ga0105241_10022419 3300009174 Bacteria 4678
138 Ga0105242_10000143 3300009176 Bacteria 52133
139 Ga0105242_11824722 3300009176 Bacteria 647
140 Ga0105248_11570818 3300009177 Bacteria 745
141 Ga0105248_12643523 3300009177 Bacteria 572
142 Ga0105237_10993076 3300009545 Bacteria 846
143 Ga0105238_10242202 3300009551 Bacteria 1781
144 Ga0105249_10056196 3300009553 Bacteria 3603
145 Ga0105239_10053894 3300010375 Bacteria 4410
146 Ga0105239_10330607 3300010375 Bacteria 1719
147 Ga0105246_10001595 3300011119 Bacteria 13510
148 Ga0157373_11122909 3300013100 Bacteria 590
149 Ga0157371_10040293 3300013102 Bacteria 3337
150 Ga0157370_10003483 3300013104 Bacteria 18465
151 Ga0157374_10339721 3300013296 Bacteria 1491
152 Ga0157378_10001762 3300013297 Bacteria 19427
153 Ga0157378_10447903 3300013297 Bacteria 1281
154 Ga0157378_13201845 3300013297 Bacteria 508
155 Ga0163162_10038525 3300013306 Bacteria 4770
156 Ga0157375_10047115 3300013308 Bacteria 4208
157 Ga0163163_10455717 3300014325 Bacteria 1339
158 Ga0163163_12837803 3300014325 Bacteria 541
159 Ga0157380_10028023 3300014326 Bacteria 4291
160 Ga0182008_10170759 3300014497 Bacteria 1098
161 Ga0157377_10022084 3300014745 Bacteria 3356
162 Ga0157379_12166636 3300014968 Bacteria 552
163 Ga0182006_1000217 3300015261 Bacteria 55940
164 Ga0182005_1104153 3300015265 Bacteria 797
165 Ga0163161_11214363 3300017792 Bacteria 652
166 Ga0213873_10307443 3300021358 Unclassified 513
167 Ga0213874_10263399 3300021377 Bacteria 639
168 Ga0213876_10096469 3300021384 Unclassified 1566
169 Ga0213876_10269311 3300021384 Bacteria 905
170 Ga0207682_10031534 3300025893 Bacteria 2127
171 Ga0207692_10813188 3300025898 Bacteria 611
172 Ga0207688_10009027 3300025901 Bacteria 5426
173 Ga0207647_10105839 3300025904 Bacteria 1666
174 Ga0207645_10000165 3300025907 Bacteria 52518
175 Ga0207643_10006582 3300025908 Bacteria 6229
176 Ga0207643_10808791 3300025908 Bacteria 607
177 Ga0207705_10948672 3300025909 Bacteria 666
178 Ga0207684_10077272 3300025910 Bacteria 2830
179 Ga0207693_10729260 3300025915 Bacteria 767
180 Ga0207660_10052110 3300025917 Bacteria 2912
181 Ga0207662_10010294 3300025918 Bacteria 5161
182 Ga0207662_10938042 3300025918 Bacteria 613
183 Ga0207652_10070688 3300025921 Bacteria 3031
184 Ga0207652_10513409 3300025921 Bacteria 1078
185 Ga0207652_10892989 3300025921 Unclassified 785
186 Ga0207646_11069533 3300025922 Bacteria 711
187 Ga0207681_10016113 3300025923 Bacteria 4669
188 Ga0207694_10781420 3300025924 Bacteria 806
189 Ga0207650_10009711 3300025925 Bacteria 6580
190 Ga0207659_10094132 3300025926 Bacteria 2244
191 Ga0207687_10012974 3300025927 Bacteria 5444
192 Ga0207687_10166357 3300025927 Bacteria 1697
193 Ga0207690_10018626 3300025932 Bacteria 4259
194 Ga0207706_10000519 3300025933 Bacteria 41066
195 Ga0207686_10007326 3300025934 Bacteria 5937
196 Ga0207686_11023262 3300025934 Bacteria 671
197 Ga0207686_11821501 3300025934 Unclassified 504
198 Ga0207709_10010903 3300025935 Bacteria 5008
199 Ga0207709_10139169 3300025935 Bacteria 1666
200 Ga0207670_10031285 3300025936 Bacteria 3408
201 Ga0207670_10047401 3300025936 Bacteria 2862
202 Ga0207670_10065597 3300025936 Bacteria 2492
203 Ga0207669_10002724 3300025937 Bacteria 7566
204 Ga0207669_10111620 3300025937 Bacteria 1834
205 Ga0207704_10009795 3300025938 Bacteria 4640
206 Ga0207704_10400031 3300025938 Bacteria 1083
207 Ga0207691_10000475 3300025940 Bacteria 39812
208 Ga0207711_10630381 3300025941 Bacteria 1000
209 Ga0207711_11352385 3300025941 Bacteria 655
210 Ga0207689_10035514 3300025942 Bacteria 4141
211 Ga0207689_10208150 3300025942 Bacteria 1616
212 Ga0207689_10221597 3300025942 Bacteria 1563
213 Ga0207661_10158166 3300025944 Bacteria 1964
214 Ga0207661_11013549 3300025944 Bacteria 765
215 Ga0207679_10033135 3300025945 Bacteria 3633
216 Ga0207667_10115829 3300025949 Bacteria 2762
217 Ga0207651_10001507 3300025960 Bacteria 10618
218 Ga0207668_10039599 3300025972 Bacteria 3174
219 Ga0207658_10017206 3300025986 Bacteria 4981
220 Ga0207677_10051046 3300026023 Bacteria 2802
221 Ga0207677_10324315 3300026023 Bacteria 1281
222 Ga0207677_11071403 3300026023 Bacteria 734
223 Ga0207678_10011450 3300026067 Bacteria 7788
224 Ga0207708_10001641 3300026075 Bacteria 16650
225 Ga0207708_10506723 3300026075 Bacteria 1012
226 Ga0207702_10842934 3300026078 Bacteria 907
227 Ga0207641_10038117 3300026088 Bacteria 4018
228 Ga0207641_10963845 3300026088 Bacteria 849
229 Ga0207676_11134716 3300026095 Bacteria 773
230 Ga0207674_10027820 3300026116 Bacteria 5974
231 Ga0207674_10106838 3300026116 Bacteria 2776
232 Ga0207674_10502649 3300026116 Bacteria 1171
233 Ga0207675_100126715 3300026118 Bacteria 2418
234 Ga0207683_10000345 3300026121 Bacteria 42229
235 Ga0207683_10160169 3300026121 Bacteria 2034
236 Ga0207698_10610449 3300026142 Bacteria 1076
237 Ga0209973_1000297 3300027252 Bacteria 3508
238 Ga0209969_1000099 3300027360 Bacteria 10685
239 Ga0209967_1000194 3300027364 Bacteria 8586
240 Ga0209981_1000171 3300027378 Bacteria 7889
241 Ga0209996_1000040 3300027395 Bacteria 19099
242 Ga0209984_1006448 3300027424 Bacteria 1440
243 Ga0210000_1000029 3300027462 Bacteria 22322
244 Ga0209995_1000964 3300027471 Bacteria 4460
245 Ga0209968_1000046 3300027526 Bacteria 22470
246 Ga0209999_1000159 3300027543 Bacteria 8931
247 Ga0209982_1001352 3300027552 Bacteria 3330
248 Ga0209982_1010122 3300027552 Bacteria 1397
249 Ga0209970_1001791 3300027614 Bacteria 3721
250 Ga0210002_1000036 3300027617 Bacteria 20451
251 Ga0209983_1001000 3300027665 Bacteria 6244
252 Ga0209971_1000238 3300027682 Bacteria 15587
253 Ga0209966_1000066 3300027695 Bacteria 47015
254 Ga0209998_10000064 3300027717 Bacteria 42414
255 Ga0209974_10003280 3300027876 Bacteria 5851
256 Ga0209974_10050498 3300027876 Bacteria 1397
257 Ga0207428_10002969 3300027907 Bacteria 16780
258 Ga0268264_10022795 3300028381 Bacteria 5109
259 Ga0307517_10015966 3300028786 Bacteria 9917
260 Ga0307515_10019196 3300028794 Bacteria 12323
261 Ga0265338_10081604 3300028800 Bacteria 2711
262 Ga0265332_10035559 3300031238 Bacteria 2162
263 Ga0307513_10040466 3300031456 Bacteria 5153
264 Ga0307509_10000280 3300031507 Bacteria 84178
265 Ga0307509_10047527 3300031507 Bacteria 4616
266 Ga0307509_10132649 3300031507 Bacteria 2443
267 Ga0307509_10306728 3300031507 Bacteria 1332
268 Ga0307508_10005617 3300031616 Bacteria 11889
269 Ga0307508_10092099 3300031616 Bacteria 2620
270 Ga0265314_10455563 3300031711 Bacteria 681
271 Ga0307516_10084954 3300031730 Bacteria 3003
272 Ga0373949_0000177 3300035090 Bacteria 24478
273 Ga0373932_0044788 3300035112 Bacteria 1292
274 Ga0373936_0000064 3300035113 Bacteria 50371
275 Ga0373941_0219619 3300035115 Bacteria 730
276 Ga0373954_0342399 3300035118 Bacteria 738
277 Ga0373956_0581469 3300035119 Bacteria 535
278 Ga0373933_0973804 3300035724 Unclassified 559
279 Ga0395900_0091976 3300037418 Bacteria 3117
280 Ga0395900_0745629 3300037418 Bacteria 910
281 Ga0395898_1236225 3300037466 Bacteria 677
282 Ga0395905_0197011 3300037471 Bacteria 1889
283 Ga0395905_0287846 3300037471 Bacteria 1530
284 Ga0395901_0119651 3300038443 Bacteria 2767
285 Ga0436365_0432836 3300039437 Bacteria 985
286 Ga0436365_0532818 3300039437 Bacteria 1451
287 Ga0436365_1747536 3300039437 Bacteria 7242
288 Ga0436362_0779128 3300039453 Unclassified 611
289 Ga0451797_0325993 3300041453 Bacteria 1175
290 Ga0451843_0641620 3300041509 Bacteria 572
291 Ga0439448_0219759 3300042005 Bacteria 668
292 Ga0439456_063089 3300042013 Bacteria 816
293 Ga0450902_000512 3300042137 Bacteria 4848
294 Ga0439435_0027879 3300042436 Bacteria 1514
295 Ga0439460_0058424 3300042461 Bacteria 1172
296 Ga0439460_0193369 3300042461 Bacteria 691
297 Ga0451576_0036916 3300045051 Bacteria 5177
298 Ga0451576_0220449 3300045051 Bacteria 1980
299 Ga0451576_2649919 3300045051 Bacteria 511
300 Ga0495584_0268168 3300046491 Bacteria 868
301 Ga0495630_0905230 3300046517 Bacteria 672
302 Ga0495654_0008519 3300046530 Bacteria 5656
303 Ga0495622_0046953 3300046557 Bacteria 2007
304 Ga0495661_0110925 3300046665 Bacteria 1529
305 Ga0495649_0073013 3300046694 Bacteria 1839
306 Ga0495672_0432161 3300047320 Bacteria 597
307 Ga0495677_0188756 3300047445 Bacteria 800
308 Ga0496105_1084928 3300048908 Bacteria 595
309 Ga0496106_0128012 3300048909 Bacteria 1990
310 Ga0496107_1200780 3300048910 Bacteria 545
311 Ga0496112_0421411 3300048915 Bacteria 1274
312 Ga0501295_182489 3300049518 Bacteria 526
313 Ga0501298_039317 3300049521 Bacteria 955
314 Ga0501298_182264 3300049521 Bacteria 527
315 Ga0501032_0195076 3300049569 Bacteria 1323
316 Ga0501034_0163571 3300049571 Bacteria 2195
317 Ga0501038_0451131 3300049574 Bacteria 989
318 Ga0501043_0379244 3300049579 Bacteria 1071
319 Ga0501046_0244495 3300049580 Bacteria 1323
320 Ga0501047_0064650 3300049581 Bacteria 3528
321 Ga0501068_0054359 3300049584 Bacteria 2426
322 Ga0501069_0039329 3300049585 Bacteria 2613
323 Ga0501069_0138675 3300049585 Bacteria 1395
324 Ga0501070_0037911 3300049586 Bacteria 4023
325 Ga0501070_0917669 3300049586 Bacteria 682
326 Ga0501071_0240378 3300049587 Bacteria 1365
327 Ga0501071_1261198 3300049587 Unclassified 571
328 Ga0501073_0387368 3300049589 Unclassified 966
329 Ga0501074_0069164 3300049590 Bacteria 2539
330 Ga0501074_0601051 3300049590 Bacteria 778
331 Ga0501216_003745 3300049660 Bacteria 2235
332 Ga0501227_011711 3300049665 Bacteria 1913
333 Ga0501230_002074 3300049667 Bacteria 2512
334 Ga0501233_010168 3300049668 Bacteria 1847
335 Ga0501235_111774 3300049669 Bacteria 676
336 Ga0501236_006546 3300049670 Bacteria 1434
337 Ga0501221_054072 3300049704 Bacteria 912
338 Ga0501225_0032893 3300049705 Bacteria 1426
339 Ga0501229_028229 3300049706 Bacteria 762
340 Ga0501079_0372959 3300049741 Bacteria 1119
341 Ga0501079_1421725 3300049741 Bacteria 546
342 Ga0501080_0244713 3300049742 Bacteria 1636
343 Ga0501080_1241486 3300049742 Bacteria 640
344 Ga0501035_0394403 3300049822 Bacteria 1152
345 Ga0501044_0076391 3300049823 Bacteria 3399
346 nmdc:mga05p37_1997461_c1 3300050507 Unclassified 549
347 nmdc:mga05p37_40545_c1 3300050507 Bacteria 5718
348 nmdc:mga09592_17741_c1 3300050508 Bacteria 5833
349 nmdc:mga09592_292614_c1 3300050508 Bacteria 1412
350 nmdc:mga09592_36194_c1 3300050508 Bacteria 4136
351 nmdc:mga0qj67_51048_c1 3300050509 Bacteria 3270
352 nmdc:mga06r32_13349_c1 3300050510 Bacteria 7439
353 nmdc:mga08y16_100685_c1 3300050511 Bacteria 3009
354 nmdc:mga0n895_101814_c1 3300050512 Bacteria 2883
355 nmdc:mga0n895_144016_c1 3300050512 Bacteria 2412
356 nmdc:mga0n895_154425_c1 3300050512 Bacteria 2326
357 nmdc:mga0n895_499289_c1 3300050512 Bacteria 1226
358 nmdc:mga0rr50_227586_c1 3300050513 Bacteria 1542
359 nmdc:mga0rr50_64849_c1 3300050513 Bacteria 2765
360 nmdc:mga0rr50_99010_c1 3300050513 Bacteria 2287
361 nmdc:mga08x19_67052_c1 3300050514 Bacteria 2334
362 nmdc:mga08x19_68876_c1 3300050514 Bacteria 2304
363 nmdc:mga0a205_141636_c1 3300050515 Bacteria 2305
364 nmdc:mga0a205_1564433_c1 3300050515 Bacteria 508
365 Ga0500635_0002535 3300053080 Bacteria 4540
366 Ga0500646_0014890 3300053090 Bacteria 2021
367 Ga0500647_0144414 3300053091 Unclassified 1114
368 Ga0500583_0101747 3300053092 Bacteria 1408
369 Ga0500566_0006621 3300053094 Bacteria 6861
370 Ga0500566_0026070 3300053094 Bacteria 3423
371 Ga0500640_000390 3300053095 Bacteria 10466
372 Ga0500650_0274970 3300053098 Bacteria 750
373 Ga0500650_0311558 3300053098 Bacteria 695
374 Ga0500654_130667 3300053099 Bacteria 952
375 Ga0500554_000138 3300053102 Bacteria 14765
376 Ga0500562_059325 3300053108 Bacteria 1028
377 Ga0500595_000239 3300053119 Bacteria 37131
378 Ga0500597_060990 3300053120 Bacteria 1621
379 Ga0500597_233068 3300053120 Bacteria 760
380 Ga0500614_001371 3300053123 Bacteria 5870
381 Ga0500614_062839 3300053123 Bacteria 1002
382 Ga0500642_0194411 3300053130 Bacteria 945
383 Ga0500642_0226319 3300053130 Unclassified 865
384 Ga0500658_0143507 3300053134 Bacteria 1072
385 Ga0500559_0010052 3300053136 Bacteria 4075
386 Ga0500559_0413195 3300053136 Unclassified 627
387 Ga0500564_064375 3300053138 Bacteria 1660
388 Ga0500568_0008369 3300053139 Bacteria 4993
389 Ga0500585_030071 3300053144 Bacteria 1861
390 Ga0500588_0366083 3300053146 Bacteria 548
391 Ga0500603_001701 3300053150 Bacteria 4957
392 Ga0500630_135061 3300053159 Bacteria 1071
393 Ga0500639_135032 3300053163 Bacteria 1163
394 Ga0500636_0405442 3300053177 Unclassified 631
395 Ga0500637_0451273 3300053178 Unclassified 652
396 Ga0500637_0581354 3300053178 Bacteria 535
397 Ga0500601_019226 3300053737 Unclassified 786
398 Ga0501084_1656190 3300054114 Bacteria 535
399 Ga0501082_0045719 3300060353 Bacteria 3775
400 Ga0070673_100795544
401 SwRhRL3b_contig_2969327
402 SwRhRL2b_contig_3734303
403 JGI24750J21931_1040117
404 rootL2_10047622
405 JGI26128J50194_1005210
406 JGI26144J50225_101474
407 JGI26136J50244_101687
408 JGI26132J50249_100811
409 JGI26138J51218_103854
410 Ga0058862_11761949
411 Ga0065704_10084483
412 Ga0065712_10233202
413 Ga0065715_10154571
414 Ga0065707_10108366
415 Ga0070676_10001548
416 Ga0070683_100348671
417 Ga0070683_101695064
418 Ga0070690_100008409
419 Ga0070670_100006177
420 Ga0070677_10040247
421 Ga0068869_100016042
422 Ga0068869_100198447
423 Ga0068869_101329625
424 Ga0070680_100016076
425 Ga0068868_100006284
426 Ga0068868_100232740
427 Ga0070660_100016918
428 Ga0070689_100016796
429 Ga0070689_100223570
430 Ga0070691_10007205
431 Ga0070687_100005580
432 Ga0070661_100021472
433 Ga0070692_10009895
434 Ga0070692_10049160
435 Ga0070668_100005406
436 Ga0070669_100002515
437 Ga0070675_100009217
438 Ga0070674_100001051
439 Ga0070674_100654216
440 Ga0070673_100017225
441 Ga0070688_101051787
442 Ga0070659_100024758
443 Ga0070667_100031298
444 Ga0070701_10250867
445 Ga0070701_10923598
446 Ga0070711_101639988
447 Ga0070705_100023474
448 Ga0070705_101529401
449 Ga0070700_100000551
450 Ga0070694_100015324
451 Ga0070694_100278742
452 Ga0070694_100972429
453 Ga0070708_100128829
454 Ga0070663_100014292
455 Ga0070678_100001424
456 Ga0070678_101135633
457 Ga0070662_100000376
458 Ga0070681_10721259
459 Ga0068867_100006040
460 Ga0070685_10040332
461 Ga0070685_10371401
462 Ga0070706_100112745
463 Ga0070707_101766757
464 Ga0070698_100001935
465 Ga0070679_100045621
466 Ga0070679_100126387
467 Ga0070679_101165324
468 Ga0070679_101365262
469 Ga0070684_100024468
470 Ga0070684_101363218
471 Ga0070697_100954137
472 Ga0070672_100002311
473 Ga0070686_101138715
474 Ga0070695_100126349
475 Ga0070695_101328530
476 Ga0070696_100004305
477 Ga0070665_102109034
478 Ga0070704_100903067
479 Ga0068855_100447938
480 Ga0068857_100102776
481 Ga0068854_100020366
482 Ga0068856_100183565
483 Ga0070702_100006211
484 Ga0068852_100397447
485 Ga0068859_100338498
486 Ga0068859_100402483
487 Ga0068859_100654842
488 Ga0068864_100573631
489 Ga0068866_10325750
490 Ga0068861_100117451
491 Ga0068870_10007024
492 Ga0068863_100040729
493 Ga0068860_100043911
494 Ga0068860_100650554
495 Ga0068862_100040384
496 Ga0081455_10493609
497 Ga0070717_10014205
498 Ga0070717_10076561
499 Ga0075432_10000967
500 Ga0070712_101218470
501 Ga0097621_100008896
502 Ga0097621_100606676
503 Ga0097621_101016136
504 Ga0068871_100137053
505 Ga0068871_100574497
506 Ga0075428_100973168
507 Ga0075428_102524756
508 Ga0075430_100015190
509 Ga0075431_100019083
510 Ga0075433_11087300
511 Ga0075433_11959356
512 Ga0075434_100212946
513 Ga0075434_100984868
514 Ga0075429_100066978
515 Ga0075429_100326575
516 Ga0068865_100000796
517 Ga0075436_100066755
518 Ga0075436_100815039
519 Ga0097620_100338524
520 Ga0097620_100402520
521 Ga0097620_100654846
522 Ga0075435_100323106
523 Ga0075435_100659433
524 Ga0105240_10398513
525 Ga0111539_10109127
526 Ga0111539_10435658
527 Ga0111539_10588403
528 Ga0105245_10023190
529 Ga0105245_10257606
530 Ga0105245_10560789
531 Ga0105245_12971211
532 Ga0114129_10266861
533 Ga0114129_12698035
534 Ga0105243_10027099
535 Ga0105243_10176644
536 Ga0105241_10022419
537 Ga0105242_10000143
538 Ga0105242_11824722
539 Ga0105248_11570818
540 Ga0105248_12643523
541 Ga0105237_10993076
542 Ga0105238_10242202
543 Ga0105249_10056196
544 Ga0105239_10053894
545 Ga0105239_10330607
546 Ga0105246_10001595
547 Ga0157373_11122909
548 Ga0157371_10040293
549 Ga0157370_10003483
550 Ga0157374_10339721
551 Ga0157378_10001762
552 Ga0157378_10447903
553 Ga0157378_13201845
554 Ga0163162_10038525
555 Ga0157375_10047115
556 Ga0163163_10455717
557 Ga0163163_12837803
558 Ga0157380_10028023
559 Ga0182008_10170759
560 Ga0157377_10022084
561 Ga0157379_12166636
562 Ga0182006_1000217
563 Ga0182005_1104153
564 Ga0163161_11214363
565 Ga0213873_10307443
566 Ga0213874_10263399
567 Ga0213876_10096469
568 Ga0213876_10269311
569 Ga0207682_10031534
570 Ga0207692_10813188
571 Ga0207688_10009027
572 Ga0207647_10105839
573 Ga0207645_10000165
574 Ga0207643_10006582
575 Ga0207643_10808791
576 Ga0207705_10948672
577 Ga0207684_10077272
578 Ga0207693_10729260
579 Ga0207660_10052110
580 Ga0207662_10010294
581 Ga0207662_10938042
582 Ga0207652_10070688
583 Ga0207652_10513409
584 Ga0207652_10892989
585 Ga0207646_11069533
586 Ga0207681_10016113
587 Ga0207694_10781420
588 Ga0207650_10009711
589 Ga0207659_10094132
590 Ga0207687_10012974
591 Ga0207687_10166357
592 Ga0207690_10018626
593 Ga0207706_10000519
594 Ga0207686_10007326
595 Ga0207686_11023262
596 Ga0207686_11821501
597 Ga0207709_10010903
598 Ga0207709_10139169
599 Ga0207670_10031285
600 Ga0207670_10047401
601 Ga0207670_10065597
602 Ga0207669_10002724
603 Ga0207669_10111620
604 Ga0207704_10009795
605 Ga0207704_10400031
606 Ga0207691_10000475
607 Ga0207711_10630381
608 Ga0207711_11352385
609 Ga0207689_10035514
610 Ga0207689_10208150
611 Ga0207689_10221597
612 Ga0207661_10158166
613 Ga0207661_11013549
614 Ga0207679_10033135
615 Ga0207667_10115829
616 Ga0207651_10001507
617 Ga0207668_10039599
618 Ga0207658_10017206
619 Ga0207677_10051046
620 Ga0207677_10324315
621 Ga0207677_11071403
622 Ga0207678_10011450
623 Ga0207708_10001641
624 Ga0207708_10506723
625 Ga0207702_10842934
626 Ga0207641_10038117
627 Ga0207641_10963845
628 Ga0207676_11134716
629 Ga0207674_10027820
630 Ga0207674_10106838
631 Ga0207674_10502649
632 Ga0207675_100126715
633 Ga0207683_10000345
634 Ga0207683_10160169
635 Ga0207698_10610449
636 Ga0209973_1000297
637 Ga0209969_1000099
638 Ga0209967_1000194
639 Ga0209981_1000171
640 Ga0209996_1000040
641 Ga0209984_1006448
642 Ga0210000_1000029
643 Ga0209995_1000964
644 Ga0209968_1000046
645 Ga0209999_1000159
646 Ga0209982_1001352
647 Ga0209982_1010122
648 Ga0209970_1001791
649 Ga0210002_1000036
650 Ga0209983_1001000
651 Ga0209971_1000238
652 Ga0209966_1000066
653 Ga0209998_10000064
654 Ga0209974_10003280
655 Ga0209974_10050498
656 Ga0207428_10002969
657 Ga0268264_10022795
658 Ga0307517_10015966
659 Ga0307515_10019196
660 Ga0265338_10081604
661 Ga0265332_10035559
662 Ga0307513_10040466
663 Ga0307509_10000280
664 Ga0307509_10047527
665 Ga0307509_10132649
666 Ga0307509_10306728
667 Ga0307508_10005617
668 Ga0307508_10092099
669 Ga0265314_10455563
670 Ga0307516_10084954
671 Ga0373949_0000177
672 Ga0373932_0044788
673 Ga0373936_0000064
674 Ga0373941_0219619
675 Ga0373954_0342399
676 Ga0373956_0581469
677 Ga0373933_0973804
678 Ga0395900_0091976
679 Ga0395900_0745629
680 Ga0395898_1236225
681 Ga0395905_0197011
682 Ga0395905_0287846
683 Ga0395901_0119651
684 Ga0436365_0432836
685 Ga0436365_0532818
686 Ga0436365_1747536
687 Ga0436362_0779128
688 Ga0451797_0325993
689 Ga0451843_0641620
690 Ga0439448_0219759
691 Ga0439456_063089
692 Ga0450902_000512
693 Ga0439435_0027879
694 Ga0439460_0058424
695 Ga0439460_0193369
696 Ga0451576_0036916
697 Ga0451576_0220449
698 Ga0451576_2649919
699 Ga0495584_0268168
700 Ga0495630_0905230
701 Ga0495654_0008519
702 Ga0495622_0046953
703 Ga0495661_0110925
704 Ga0495649_0073013
705 Ga0495672_0432161
706 Ga0495677_0188756
707 Ga0496105_1084928
708 Ga0496106_0128012
709 Ga0496107_1200780
710 Ga0496112_0421411
711 Ga0501295_182489
712 Ga0501298_039317
713 Ga0501298_182264
714 Ga0501032_0195076
715 Ga0501034_0163571
716 Ga0501038_0451131
717 Ga0501043_0379244
718 Ga0501046_0244495
719 Ga0501047_0064650
720 Ga0501068_0054359
721 Ga0501069_0039329
722 Ga0501069_0138675
723 Ga0501070_0037911
724 Ga0501070_0917669
725 Ga0501071_0240378
726 Ga0501071_1261198
727 Ga0501073_0387368
728 Ga0501074_0069164
729 Ga0501074_0601051
730 Ga0501216_003745
731 Ga0501227_011711
732 Ga0501230_002074
733 Ga0501233_010168
734 Ga0501235_111774
735 Ga0501236_006546
736 Ga0501221_054072
737 Ga0501225_0032893
738 Ga0501229_028229
739 Ga0501079_0372959
740 Ga0501079_1421725
741 Ga0501080_0244713
742 Ga0501080_1241486
743 Ga0501035_0394403
744 Ga0501044_0076391
745 nmdc:mga05p37_1997461_c1
746 nmdc:mga05p37_40545_c1
747 nmdc:mga09592_17741_c1
748 nmdc:mga09592_292614_c1
749 nmdc:mga09592_36194_c1
750 nmdc:mga0qj67_51048_c1
751 nmdc:mga06r32_13349_c1
752 nmdc:mga08y16_100685_c1
753 nmdc:mga0n895_101814_c1
754 nmdc:mga0n895_144016_c1
755 nmdc:mga0n895_154425_c1
756 nmdc:mga0n895_499289_c1
757 nmdc:mga0rr50_227586_c1
758 nmdc:mga0rr50_64849_c1
759 nmdc:mga0rr50_99010_c1
760 nmdc:mga08x19_67052_c1
761 nmdc:mga08x19_68876_c1
762 nmdc:mga0a205_141636_c1
763 nmdc:mga0a205_1564433_c1
764 Ga0500635_0002535
765 Ga0500646_0014890
766 Ga0500647_0144414
767 Ga0500583_0101747
768 Ga0500566_0006621
769 Ga0500566_0026070
770 Ga0500640_000390
771 Ga0500650_0274970
772 Ga0500650_0311558
773 Ga0500654_130667
774 Ga0500554_000138
775 Ga0500562_059325
776 Ga0500595_000239
777 Ga0500597_060990
778 Ga0500597_233068
779 Ga0500614_001371
780 Ga0500614_062839
781 Ga0500642_0194411
782 Ga0500642_0226319
783 Ga0500658_0143507
784 Ga0500559_0010052
785 Ga0500559_0413195
786 Ga0500564_064375
787 Ga0500568_0008369
788 Ga0500585_030071
789 Ga0500588_0366083
790 Ga0500603_001701
791 Ga0500630_135061
792 Ga0500639_135032
793 Ga0500636_0405442
794 Ga0500637_0451273
795 Ga0500637_0581354
796 Ga0500601_019226
797 Ga0501084_1656190
798 Ga0501082_0045719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

9

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9852 13 134
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9828 13 131
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9827 10 135
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9801 9 133
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9691 10 131
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9848 13 134 2.40.50.100
af_K7TZ76_31_128_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9629 42 132 2.40.50.100
3a8jE00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9605 10 131 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9539 13 134 2.40.50.100
3mxuA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9414 10 119 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A356TLI4-F1-model_v4 Glycine cleavage system H protein 0.9979 10 133 GO:0005829
GO:0005960
GO:0019464
AF-A0A419SEM3-F1-model_v4 Glycine cleavage system H protein (Octanoyl/lipoyl carrier protein) 0.9977 10 131 GO:0005829
GO:0005960
GO:0019464
AF-A0A532DA06-F1-model_v4 Glycine cleavage system H protein 0.9974 8 134 GO:0005829
GO:0005960
GO:0019464
AF-A0A660TUI8-F1-model_v4 Glycine cleavage system H protein 0.9958 9 135 GO:0005737
GO:0005960
GO:0019464
AF-A0A7Y8HDC9-F1-model_v4 Glycine cleavage system H protein 0.9956 10 135 GO:0005829
GO:0005960
GO:0019464

Map