F432946

General Info

Members Datasets Scaffolds Average Seq Length
394 178 394 134

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101011571|Ga0307409_1010115712
Length 132
Sequence MTKEATMKGYNDNIEELTTSNKDFRRVLYTGNHLQLVLMTLQPGEEIGSEVHDGIDQFFRFEAGSGVVDIDGVENAVEPSGARHNVRNTGSQPLKLYSIYGPPEHKDQVVQATKAEADARHEHEEFDGTTSE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
118 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
122 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
123 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
124 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
125 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
126 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
127 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
128 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
166 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
169 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
170 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
173 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
174 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.57
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005352 3300001979 Bacteria 5440
2 JGI24740J21852_10036722 3300001979 Bacteria 1519
3 JGI24737J22298_10020179 3300001990 Bacteria 2129
4 rootH2_10056805 3300003320 Bacteria 1142
5 Ga0065712_10113254 3300005290 Unclassified 1786
6 Ga0065715_10553745 3300005293 Bacteria 739
7 Ga0070658_10016695 3300005327 Bacteria 5877
8 Ga0070658_10027893 3300005327 Bacteria 4531
9 Ga0070658_10114719 3300005327 Bacteria 2234
10 Ga0070658_10196476 3300005327 Bacteria 1701
11 Ga0070658_10246088 3300005327 Bacteria 1516
12 Ga0070658_10712369 3300005327 Bacteria 871
13 Ga0070658_10764738 3300005327 Bacteria 839
14 Ga0070658_10855405 3300005327 Bacteria 790
15 Ga0070658_10922102 3300005327 Bacteria 759
16 Ga0070658_10994638 3300005327 Bacteria 729
17 Ga0070658_11335267 3300005327 Bacteria 623
18 Ga0070683_100015954 3300005329 Bacteria 6608
19 Ga0070683_100315444 3300005329 Bacteria 1488
20 Ga0070680_100170922 3300005336 Bacteria 1829
21 Ga0070680_100187967 3300005336 Bacteria 1740
22 Ga0070680_100234948 3300005336 Bacteria 1548
23 Ga0070680_101090703 3300005336 Bacteria 690
24 Ga0070680_101300600 3300005336 Bacteria 629
25 Ga0070682_100297356 3300005337 Bacteria 1183
26 Ga0070660_100004854 3300005339 Bacteria 9287
27 Ga0070660_100112473 3300005339 Bacteria 2167
28 Ga0070660_100377844 3300005339 Bacteria 1169
29 Ga0070661_100028809 3300005344 Bacteria 4007
30 Ga0070661_100047897 3300005344 Bacteria 3128
31 Ga0070661_100052375 3300005344 Bacteria 2987
32 Ga0070661_100113261 3300005344 Bacteria 2027
33 Ga0070661_100326640 3300005344 Bacteria 1199
34 Ga0070661_100865436 3300005344 Bacteria 744
35 Ga0070692_10007883 3300005345 Bacteria 4720
36 Ga0070692_10244421 3300005345 Bacteria 1071
37 Ga0070692_10444989 3300005345 Bacteria 828
38 Ga0070668_100073778 3300005347 Bacteria 2661
39 Ga0070669_100459897 3300005353 Bacteria 1050
40 Ga0070671_100090101 3300005355 Bacteria 2567
41 Ga0070671_100131790 3300005355 Bacteria 2105
42 Ga0070674_100611188 3300005356 Bacteria 922
43 Ga0070673_100355347 3300005364 Bacteria 1301
44 Ga0070673_100537028 3300005364 Bacteria 1061
45 Ga0070673_101037040 3300005364 Bacteria 765
46 Ga0070659_100018672 3300005366 Bacteria 5235
47 Ga0070659_100073165 3300005366 Bacteria 2728
48 Ga0070659_100084505 3300005366 Bacteria 2538
49 Ga0070659_100090461 3300005366 Bacteria 2453
50 Ga0070659_100110709 3300005366 Bacteria 2216
51 Ga0070659_100577039 3300005366 Unclassified 965
52 Ga0070709_10324966 3300005434 Bacteria 1130
53 Ga0070714_101351339 3300005435 Bacteria 696
54 Ga0070663_100007697 3300005455 Bacteria 6577
55 Ga0070663_100060356 3300005455 Bacteria 2727
56 Ga0070663_100126604 3300005455 Bacteria 1936
57 Ga0070663_100153148 3300005455 Bacteria 1769
58 Ga0070663_100316053 3300005455 Bacteria 1254
59 Ga0070678_101607640 3300005456 Bacteria 610
60 Ga0070662_100944178 3300005457 Bacteria 737
61 Ga0070681_10017873 3300005458 Bacteria 7086
62 Ga0070681_10145140 3300005458 Bacteria 2302
63 Ga0070681_11062662 3300005458 Bacteria 730
64 Ga0070679_100031444 3300005530 Bacteria 5243
65 Ga0070679_100041062 3300005530 Bacteria 4605
66 Ga0070679_100166260 3300005530 Bacteria 2179
67 Ga0070679_100479024 3300005530 Bacteria 1189
68 Ga0070679_100614699 3300005530 Bacteria 1030
69 Ga0070679_100922893 3300005530 Bacteria 817
70 Ga0070679_101256803 3300005530 Bacteria 686
71 Ga0070684_100244722 3300005535 Bacteria 1639
72 Ga0070684_101167441 3300005535 Bacteria 724
73 Ga0068853_100750605 3300005539 Bacteria 932
74 Ga0070672_100063801 3300005543 Bacteria 2909
75 Ga0070672_100395957 3300005543 Bacteria 1183
76 Ga0070695_100047661 3300005545 Bacteria 2738
77 Ga0070696_100014305 3300005546 Bacteria 5321
78 Ga0070693_100208757 3300005547 Bacteria 1273
79 Ga0070665_100063309 3300005548 Bacteria 3708
80 Ga0068855_100055077 3300005563 Bacteria 4672
81 Ga0070664_100029446 3300005564 Bacteria 4578
82 Ga0070664_100088618 3300005564 Bacteria 2676
83 Ga0070664_100091102 3300005564 Bacteria 2639
84 Ga0068857_100280028 3300005577 Bacteria 1534
85 Ga0068857_100535506 3300005577 Bacteria 1102
86 Ga0068854_100533340 3300005578 Bacteria 993
87 Ga0068856_100019402 3300005614 Bacteria 6600
88 Ga0068856_100164823 3300005614 Bacteria 2227
89 Ga0068856_100370684 3300005614 Bacteria 1451
90 Ga0068856_100852707 3300005614 Bacteria 930
91 Ga0068856_101312134 3300005614 Bacteria 739
92 Ga0068852_100001333 3300005616 Bacteria 16553
93 Ga0068852_100017053 3300005616 Bacteria 5688
94 Ga0068852_100182959 3300005616 Bacteria 1972
95 Ga0068852_100640236 3300005616 Bacteria 1070
96 Ga0068852_100898730 3300005616 Bacteria 902
97 Ga0068859_101337016 3300005617 Unclassified 790
98 Ga0068864_100032940 3300005618 Bacteria 4404
99 Ga0068861_100155467 3300005719 Bacteria 1881
100 Ga0068851_10016346 3300005834 Bacteria 3549
101 Ga0068863_102150482 3300005841 Bacteria 568
102 Ga0068862_100056484 3300005844 Bacteria 3364
103 Ga0097621_100114810 3300006237 Bacteria 2279
104 Ga0075429_100255898 3300006880 Bacteria 1533
105 Ga0097620_101336642 3300006931 Unclassified 790
106 Ga0111539_10257256 3300009094 Bacteria 2033
107 Ga0114129_11645683 3300009147 Bacteria 785
108 Ga0105243_10054049 3300009148 Bacteria 3187
109 Ga0105242_12328046 3300009176 Bacteria 582
110 Ga0105248_10001787 3300009177 Bacteria 23901
111 Ga0105248_10129360 3300009177 Bacteria 2848
112 Ga0105248_10173668 3300009177 Bacteria 2429
113 Ga0157373_10048864 3300013100 Bacteria 3016
114 Ga0157373_10130220 3300013100 Bacteria 1769
115 Ga0157371_10037032 3300013102 Bacteria 3494
116 Ga0157371_10142770 3300013102 Bacteria 1705
117 Ga0157371_11484395 3300013102 Bacteria 528
118 Ga0157370_10068880 3300013104 Bacteria 3343
119 Ga0157370_10863711 3300013104 Bacteria 822
120 Ga0157370_11531136 3300013104 Bacteria 599
121 Ga0157369_10075308 3300013105 Bacteria 3619
122 Ga0157369_10077059 3300013105 Bacteria 3574
123 Ga0157369_10547283 3300013105 Bacteria 1196
124 Ga0157372_10160087 3300013307 Bacteria 2601
125 Ga0157372_10891316 3300013307 Bacteria 1032
126 Ga0157380_10302288 3300014326 Bacteria 1474
127 Ga0206353_11865858 3300020082 Bacteria 2452
128 Ga0207656_10078979 3300025321 Bacteria 1476
129 Ga0207647_10013688 3300025904 Bacteria 5617
130 Ga0207647_10034367 3300025904 Bacteria 3237
131 Ga0207645_10095870 3300025907 Unclassified 1911
132 Ga0207643_10371982 3300025908 Bacteria 900
133 Ga0207705_10001335 3300025909 Bacteria 19759
134 Ga0207705_10004507 3300025909 Bacteria 10527
135 Ga0207705_10021476 3300025909 Bacteria 4608
136 Ga0207705_10028545 3300025909 Bacteria 3978
137 Ga0207705_10040460 3300025909 Bacteria 3343
138 Ga0207705_10344000 3300025909 Bacteria 1148
139 Ga0207705_11191488 3300025909 Bacteria 584
140 Ga0207707_10125695 3300025912 Bacteria 2242
141 Ga0207707_10536445 3300025912 Bacteria 995
142 Ga0207660_10203545 3300025917 Bacteria 1547
143 Ga0207660_10216231 3300025917 Bacteria 1502
144 Ga0207660_11076343 3300025917 Bacteria 655
145 Ga0207660_11485110 3300025917 Unclassified 548
146 Ga0207657_10011481 3300025919 Bacteria 8794
147 Ga0207657_10014923 3300025919 Bacteria 7553
148 Ga0207657_10053926 3300025919 Bacteria 3480
149 Ga0207657_10054858 3300025919 Bacteria 3444
150 Ga0207657_10087267 3300025919 Bacteria 2610
151 Ga0207657_10484459 3300025919 Bacteria 969
152 Ga0207649_10004386 3300025920 Bacteria 7659
153 Ga0207649_10063519 3300025920 Bacteria 2331
154 Ga0207649_10086031 3300025920 Bacteria 2047
155 Ga0207649_10354817 3300025920 Bacteria 1086
156 Ga0207649_10706555 3300025920 Bacteria 782
157 Ga0207652_10213671 3300025921 Bacteria 1737
158 Ga0207652_10307718 3300025921 Bacteria 1430
159 Ga0207652_10856343 3300025921 Bacteria 805
160 Ga0207652_10905358 3300025921 Bacteria 779
161 Ga0207681_11819303 3300025923 Bacteria 508
162 Ga0207650_10120009 3300025925 Bacteria 2046
163 Ga0207644_10006942 3300025931 Bacteria 7372
164 Ga0207644_10240021 3300025931 Bacteria 1442
165 Ga0207690_10131515 3300025932 Bacteria 1832
166 Ga0207690_10136217 3300025932 Bacteria 1803
167 Ga0207690_10475126 3300025932 Bacteria 1008
168 Ga0207690_11077660 3300025932 Bacteria 669
169 Ga0207706_10039096 3300025933 Bacteria 4206
170 Ga0207709_10119612 3300025935 Bacteria 1776
171 Ga0207691_10311108 3300025940 Bacteria 1352
172 Ga0207711_10075045 3300025941 Bacteria 2942
173 Ga0207711_10834301 3300025941 Bacteria 858
174 Ga0207689_10503404 3300025942 Bacteria 1015
175 Ga0207661_10246525 3300025944 Bacteria 1586
176 Ga0207661_10461467 3300025944 Bacteria 1158
177 Ga0207661_11862942 3300025944 Bacteria 547
178 Ga0207679_10071447 3300025945 Bacteria 2618
179 Ga0207679_10153101 3300025945 Bacteria 1879
180 Ga0207679_10235010 3300025945 Unclassified 1550
181 Ga0207667_10138547 3300025949 Bacteria 2505
182 Ga0207667_10172694 3300025949 Bacteria 2221
183 Ga0207651_10492405 3300025960 Bacteria 1058
184 Ga0207651_10511626 3300025960 Bacteria 1039
185 Ga0207651_10607858 3300025960 Bacteria 956
186 Ga0207668_10105307 3300025972 Bacteria 2105
187 Ga0207640_10273399 3300025981 Bacteria 1323
188 Ga0207640_10408896 3300025981 Bacteria 1107
189 Ga0207640_10952243 3300025981 Bacteria 753
190 Ga0207678_10011904 3300026067 Bacteria 7638
191 Ga0207678_10023367 3300026067 Bacteria 5406
192 Ga0207678_10085983 3300026067 Bacteria 2687
193 Ga0207678_10198230 3300026067 Bacteria 1716
194 Ga0207678_10242728 3300026067 Bacteria 1543
195 Ga0207678_10609689 3300026067 Unclassified 957
196 Ga0207702_10125656 3300026078 Bacteria 2302
197 Ga0207702_11300862 3300026078 Bacteria 721
198 Ga0207676_10025877 3300026095 Bacteria 4357
199 Ga0207674_10363668 3300026116 Bacteria 1398
200 Ga0207675_100360894 3300026118 Bacteria 1425
201 Ga0207698_10004706 3300026142 Bacteria 8345
202 Ga0207698_10018306 3300026142 Bacteria 4770
203 Ga0207698_10495190 3300026142 Bacteria 1188
204 Ga0207698_10900668 3300026142 Bacteria 892
205 Ga0209967_1013809 3300027364 Bacteria 1148
206 Ga0209984_1021310 3300027424 Bacteria 888
207 Ga0209995_1064222 3300027471 Bacteria 626
208 Ga0209974_10003282 3300027876 Bacteria 5850
209 Ga0207428_10540441 3300027907 Bacteria 843
210 Ga0268266_10066521 3300028379 Bacteria 3117
211 Ga0268265_10705363 3300028380 Bacteria 975
212 Ga0307408_100032524 3300031548 Bacteria 3637
213 Ga0307408_100047415 3300031548 Bacteria 3077
214 Ga0307408_100075214 3300031548 Bacteria 2509
215 Ga0307408_100140138 3300031548 Bacteria 1897
216 Ga0307408_100252472 3300031548 Bacteria 1455
217 Ga0307408_100340951 3300031548 Bacteria 1268
218 Ga0307408_101976489 3300031548 Unclassified 560
219 Ga0307405_10009007 3300031731 Bacteria 5097
220 Ga0307405_10026556 3300031731 Bacteria 3342
221 Ga0307405_10075953 3300031731 Bacteria 2178
222 Ga0307405_10311032 3300031731 Bacteria 1199
223 Ga0307405_10386774 3300031731 Bacteria 1091
224 Ga0307405_10723311 3300031731 Bacteria 827
225 Ga0307405_10857140 3300031731 Bacteria 765
226 Ga0307405_11200425 3300031731 Bacteria 656
227 Ga0307413_10013139 3300031824 Bacteria 4147
228 Ga0307413_10014958 3300031824 Bacteria 3961
229 Ga0307413_10064612 3300031824 Bacteria 2275
230 Ga0307413_11082712 3300031824 Unclassified 691
231 Ga0307410_10003359 3300031852 Bacteria 8016
232 Ga0307410_10010746 3300031852 Bacteria 5204
233 Ga0307410_10018013 3300031852 Bacteria 4257
234 Ga0307410_10028573 3300031852 Bacteria 3540
235 Ga0307410_10112177 3300031852 Bacteria 1974
236 Ga0307410_10328567 3300031852 Bacteria 1215
237 Ga0307410_10622109 3300031852 Bacteria 903
238 Ga0307410_11009274 3300031852 Bacteria 718
239 Ga0307410_11038390 3300031852 Bacteria 708
240 Ga0307410_11300494 3300031852 Unclassified 636
241 Ga0307406_10009057 3300031901 Bacteria 5567
242 Ga0307406_10020987 3300031901 Bacteria 3858
243 Ga0307406_10035273 3300031901 Bacteria 3075
244 Ga0307406_10055316 3300031901 Bacteria 2536
245 Ga0307406_10331172 3300031901 Bacteria 1182
246 Ga0307406_10349846 3300031901 Bacteria 1154
247 Ga0307406_10561486 3300031901 Unclassified 935
248 Ga0307407_10018726 3300031903 Bacteria 3509
249 Ga0307407_10025057 3300031903 Bacteria 3139
250 Ga0307407_10053317 3300031903 Bacteria 2326
251 Ga0307407_10157595 3300031903 Bacteria 1482
252 Ga0307407_10187281 3300031903 Bacteria 1376
253 Ga0307407_10273877 3300031903 Bacteria 1166
254 Ga0307412_10022986 3300031911 Bacteria 3830
255 Ga0307412_10039032 3300031911 Bacteria 3062
256 Ga0307412_10368917 3300031911 Bacteria 1158
257 Ga0307412_10422572 3300031911 Bacteria 1091
258 Ga0307409_100010541 3300031995 Bacteria 5755
259 Ga0307409_100060527 3300031995 Bacteria 2953
260 Ga0307409_100145436 3300031995 Bacteria 2049
261 Ga0307409_100147780 3300031995 Bacteria 2035
262 Ga0307409_100212918 3300031995 Bacteria 1738
263 Ga0307409_100397345 3300031995 Bacteria 1315
264 Ga0307409_100672216 3300031995 Bacteria 1032
265 Ga0307409_101011571 3300031995 Bacteria 850
266 Ga0307409_101614432 3300031995 Bacteria 677
267 Ga0307416_100019528 3300032002 Bacteria 4807
268 Ga0307416_100031272 3300032002 Bacteria 4004
269 Ga0307416_100072279 3300032002 Bacteria 2870
270 Ga0307416_100287040 3300032002 Bacteria 1626
271 Ga0307416_100823767 3300032002 Bacteria 1025
272 Ga0307416_101003578 3300032002 Bacteria 938
273 Ga0307416_101629553 3300032002 Unclassified 750
274 Ga0307414_10022779 3300032004 Bacteria 3958
275 Ga0307414_10041423 3300032004 Bacteria 3120
276 Ga0307414_10211300 3300032004 Bacteria 1586
277 Ga0307414_10224450 3300032004 Bacteria 1544
278 Ga0307414_10605078 3300032004 Bacteria 983
279 Ga0307414_10999520 3300032004 Bacteria 770
280 Ga0307411_10022496 3300032005 Bacteria 3712
281 Ga0307411_10022844 3300032005 Bacteria 3692
282 Ga0307411_10038225 3300032005 Bacteria 3025
283 Ga0307411_10052764 3300032005 Bacteria 2660
284 Ga0307411_10136177 3300032005 Bacteria 1803
285 Ga0307411_10380322 3300032005 Unclassified 1161
286 Ga0307411_10847439 3300032005 Bacteria 808
287 Ga0307411_11071665 3300032005 Bacteria 725
288 Ga0307415_100019145 3300032126 Bacteria 4150
289 Ga0307415_100026736 3300032126 Bacteria 3645
290 Ga0307415_100031947 3300032126 Bacteria 3399
291 Ga0307415_100211008 3300032126 Bacteria 1549
292 Ga0307415_100694468 3300032126 Bacteria 917
293 Ga0307415_100849841 3300032126 Bacteria 837
294 Ga0373961_0264163 3300035241 Bacteria 626
295 Ga0395899_0002112 3300037312 Bacteria 16334
296 Ga0395899_0123141 3300037312 Bacteria 1856
297 Ga0395899_0260408 3300037312 Bacteria 1186
298 Ga0395899_0378325 3300037312 Bacteria 941
299 Ga0395900_0010588 3300037418 Bacteria 9430
300 Ga0395900_0017242 3300037418 Bacteria 7370
301 Ga0395900_0022458 3300037418 Bacteria 6453
302 Ga0395900_0235416 3300037418 Bacteria 1839
303 Ga0395900_0514145 3300037418 Bacteria 1146
304 Ga0395898_0007746 3300037466 Bacteria 11403
305 Ga0395898_0014405 3300037466 Bacteria 8125
306 Ga0395898_0164581 3300037466 Bacteria 2121
307 Ga0395898_0226029 3300037466 Bacteria 1785
308 Ga0395905_0007702 3300037471 Bacteria 10686
309 Ga0395905_0230116 3300037471 Bacteria 1733
310 Ga0395905_0429001 3300037471 Bacteria 1219
311 Ga0395905_1138461 3300037471 Bacteria 684
312 Ga0436364_0530371 3300037853 Bacteria 703
313 Ga0395901_0000936 3300038443 Bacteria 31749
314 Ga0395901_0002713 3300038443 Bacteria 17828
315 Ga0395901_0024147 3300038443 Bacteria 6236
316 Ga0395901_0434542 3300038443 Bacteria 1344
317 Ga0439438_071416 3300041405 Bacteria 859
318 Ga0451833_0960793 3300041491 Bacteria 725
319 Ga0439445_0018261 3300042004 Bacteria 1740
320 Ga0439432_094933 3300042006 Bacteria 895
321 Ga0439452_050602 3300042010 Bacteria 953
322 Ga0450917_001447 3300042120 Bacteria 1702
323 Ga0450923_031452 3300042125 Bacteria 1084
324 Ga0450890_003877 3300042127 Bacteria 1970
325 Ga0450903_013401 3300042138 Bacteria 1304
326 Ga0450905_000788 3300042142 Bacteria 3909
327 Ga0450889_000242 3300042144 Bacteria 6037
328 Ga0450916_024717 3300042530 Bacteria 845
329 Ga0466972_0071300 3300044658 Bacteria 1658
330 Ga0466972_0101592 3300044658 Bacteria 1361
331 Ga0466972_0218637 3300044658 Bacteria 891
332 Ga0453683_0741828 3300044673 Bacteria 645
333 Ga0466965_0148790 3300044683 Bacteria 1223
334 Ga0466965_0238019 3300044683 Bacteria 974
335 Ga0466966_0592872 3300044684 Unclassified 667
336 Ga0466961_0699926 3300044693 Bacteria 607
337 Ga0466963_0356525 3300044694 Bacteria 1030
338 Ga0466963_1032410 3300044694 Bacteria 579
339 Ga0466964_0063485 3300044706 Bacteria 1543
340 Ga0453684_1176660 3300044712 Unclassified 806
341 Ga0466970_0136981 3300044765 Bacteria 1347
342 Ga0466957_0049198 3300044842 Bacteria 2563
343 Ga0466957_0441490 3300044842 Bacteria 895
344 Ga0466958_0097999 3300045836 Bacteria 1820
345 Ga0466967_0178076 3300045976 Bacteria 2004
346 Ga0466967_0281972 3300045976 Bacteria 1594
347 Ga0466967_0874434 3300045976 Bacteria 893
348 Ga0466967_0962903 3300045976 Bacteria 849
349 Ga0466967_1225619 3300045976 Bacteria 747
350 Ga0495650_0259631 3300046471 Bacteria 589
351 Ga0495663_0034517 3300046525 Bacteria 1515
352 Ga0495642_0058827 3300046528 Bacteria 1592
353 Ga0495669_0256218 3300046684 Bacteria 840
354 Ga0495636_0303402 3300047318 Bacteria 747
355 Ga0496100_0241415 3300048903 Bacteria 1333
356 Ga0496101_0052635 3300048904 Bacteria 2936
357 Ga0496101_0415835 3300048904 Bacteria 1060
358 Ga0496102_1576870 3300048905 Bacteria 575
359 Ga0496104_0375152 3300048907 Bacteria 1335
360 Ga0496104_0838546 3300048907 Bacteria 825
361 Ga0496105_0258499 3300048908 Bacteria 1409
362 Ga0496106_0004503 3300048909 Bacteria 10324
363 Ga0496107_0031679 3300048910 Bacteria 3776
364 Ga0496108_0042022 3300048911 Bacteria 3815
365 Ga0496109_0010877 3300048912 Bacteria 7791
366 Ga0496110_0073947 3300048913 Bacteria 3025
367 Ga0496110_0470933 3300048913 Bacteria 1144
368 Ga0496110_0885266 3300048913 Bacteria 799
369 Ga0496111_0024483 3300048914 Bacteria 4251
370 Ga0496111_0027283 3300048914 Bacteria 4038
371 Ga0496112_0019114 3300048915 Bacteria 6458
372 Ga0496113_0197047 3300048916 Bacteria 1600
373 Ga0501292_007841 3300049515 Bacteria 1550
374 Ga0501067_0179592 3300049583 Bacteria 1179
375 Ga0501068_0635092 3300049584 Bacteria 697
376 Ga0501069_0244064 3300049585 Unclassified 1047
377 Ga0501070_0407332 3300049586 Bacteria 1099
378 Ga0501074_0064687 3300049590 Bacteria 2633
379 Ga0501202_041033 3300049652 Bacteria 999
380 Ga0501217_019286 3300049661 Bacteria 1591
381 Ga0501223_004162 3300049663 Bacteria 3117
382 Ga0501224_030811 3300049664 Bacteria 803
383 Ga0501249_004441 3300049679 Bacteria 2851
384 Ga0501234_013137 3300049707 Bacteria 1299
385 Ga0501234_057917 3300049707 Bacteria 653
386 Ga0501080_0687134 3300049742 Bacteria 903
387 Ga0501262_031960 3300049759 Bacteria 761
388 Ga0501268_009941 3300049765 Bacteria 1471
389 Ga0501270_003876 3300049767 Bacteria 1648
390 nmdc:mga05p37_1188898_c1 3300050507 Bacteria 789
391 nmdc:mga09592_349977_c1 3300050508 Bacteria 1279
392 nmdc:mga08y16_250860_c1 3300050511 Bacteria 1829
393 Ga0466962_0068560 3300061719 Bacteria 1694
394 Ga0466962_0242563 3300061719 Bacteria 885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_101011571 Ga0307409_1010115712 126
2 3300005617 Ga0068859_101337016 Ga0068859_1013370162 130
3 3300006931 Ga0097620_101336642 Ga0097620_1013366422 130
4 3300025945 Ga0207679_10235010 Ga0207679_102350102 130
5 3300005290 Ga0065712_10113254 Ga0065712_101132541 131
6 3300005293 Ga0065715_10553745 Ga0065715_105537451 131
7 3300005327 Ga0070658_10027893 Ga0070658_100278936 131
8 3300005327 Ga0070658_10764738 Ga0070658_107647382 131
9 3300005336 Ga0070680_101300600 Ga0070680_1013006001 131
10 3300005337 Ga0070682_100297356 Ga0070682_1002973562 131
11 3300005344 Ga0070661_100865436 Ga0070661_1008654362 131
12 3300005347 Ga0070668_100073778 Ga0070668_1000737783 131
13 3300005353 Ga0070669_100459897 Ga0070669_1004598972 131
14 3300005356 Ga0070674_100611188 Ga0070674_1006111882 131
15 3300005364 Ga0070673_101037040 Ga0070673_1010370401 131
16 3300005366 Ga0070659_100018672 Ga0070659_1000186722 131
17 3300005455 Ga0070663_100060356 Ga0070663_1000603563 131
18 3300005456 Ga0070678_101607640 Ga0070678_1016076401 131
19 3300005457 Ga0070662_100944178 Ga0070662_1009441782 131
20 3300005530 Ga0070679_101256803 Ga0070679_1012568032 131
21 3300005535 Ga0070684_101167441 Ga0070684_1011674411 131
22 3300005564 Ga0070664_100088618 Ga0070664_1000886185 131
23 3300005719 Ga0068861_100155467 Ga0068861_1001554673 131
24 3300005844 Ga0068862_100056484 Ga0068862_1000564843 131
25 3300006880 Ga0075429_100255898 Ga0075429_1002558982 131
26 3300009147 Ga0114129_11645683 Ga0114129_116456832 131
27 3300009148 Ga0105243_10054049 Ga0105243_100540494 131
28 3300009177 Ga0105248_10173668 Ga0105248_101736682 131
29 3300013100 Ga0157373_10130220 Ga0157373_101302202 131
30 3300014326 Ga0157380_10302288 Ga0157380_103022882 131
31 3300025907 Ga0207645_10095870 Ga0207645_100958702 131
32 3300025908 Ga0207643_10371982 Ga0207643_103719821 131
33 3300025909 Ga0207705_10021476 Ga0207705_100214766 131
34 3300025909 Ga0207705_11191488 Ga0207705_111914881 131
35 3300025917 Ga0207660_11076343 Ga0207660_110763431 131
36 3300025920 Ga0207649_10354817 Ga0207649_103548172 131
37 3300025921 Ga0207652_10905358 Ga0207652_109053582 131
38 3300025923 Ga0207681_11819303 Ga0207681_118193031 131
39 3300025932 Ga0207690_10136217 Ga0207690_101362172 131
40 3300025933 Ga0207706_10039096 Ga0207706_100390965 131
41 3300025935 Ga0207709_10119612 Ga0207709_101196123 131
42 3300025944 Ga0207661_11862942 Ga0207661_118629422 131
43 3300025945 Ga0207679_10153101 Ga0207679_101531012 131
44 3300025960 Ga0207651_10511626 Ga0207651_105116262 131
45 3300025972 Ga0207668_10105307 Ga0207668_101053073 131
46 3300025981 Ga0207640_10952243 Ga0207640_109522432 131
47 3300026067 Ga0207678_10085983 Ga0207678_100859832 131
48 3300026118 Ga0207675_100360894 Ga0207675_1003608943 131
49 3300028380 Ga0268265_10705363 Ga0268265_107053632 131
50 3300031548 Ga0307408_100252472 Ga0307408_1002524722 131
51 3300031852 Ga0307410_11300494 Ga0307410_113004942 131
52 3300031901 Ga0307406_10349846 Ga0307406_103498461 131
53 3300037471 Ga0395905_1138461 Ga0395905_1138461_154_555 131
54 3300037853 Ga0436364_0530371 Ga0436364_0530371_230_625 131
55 3300042004 Ga0439445_0018261 Ga0439445_0018261_1022_1417 131
56 3300042125 Ga0450923_031452 Ga0450923_031452_256_651 131
57 3300044712 Ga0453684_1176660 Ga0453684_1176660_187_582 131
58 3300046471 Ga0495650_0259631 Ga0495650_0259631_112_507 131
59 3300049583 Ga0501067_0179592 Ga0501067_0179592_559_954 131
60 3300049585 Ga0501069_0244064 Ga0501069_0244064_613_1008 131
61 3300050507 nmdc:mga05p37_1188898_c1 nmdc:mga05p37_1188898_c1_150_557 131
62 3300050508 nmdc:mga09592_349977_c1 nmdc:mga09592_349977_c1_516_914 131
63 3300031911 Ga0307412_10022986 Ga0307412_100229864 132
64 3300001979 JGI24740J21852_10005352 JGI24740J21852_100053521 133
65 3300001979 JGI24740J21852_10036722 JGI24740J21852_100367222 133
66 3300001990 JGI24737J22298_10020179 JGI24737J22298_100201793 133
67 3300003320 rootH2_10056805 rootH2_100568053 133
68 3300005327 Ga0070658_10016695 Ga0070658_100166952 133
69 3300005327 Ga0070658_10114719 Ga0070658_101147191 133
70 3300005327 Ga0070658_10196476 Ga0070658_101964763 133
71 3300005327 Ga0070658_10246088 Ga0070658_102460882 133
72 3300005327 Ga0070658_10712369 Ga0070658_107123692 133
73 3300005327 Ga0070658_10855405 Ga0070658_108554051 133
74 3300005327 Ga0070658_10922102 Ga0070658_109221021 133
75 3300005327 Ga0070658_10994638 Ga0070658_109946382 133
76 3300005327 Ga0070658_11335267 Ga0070658_113352672 133
77 3300005329 Ga0070683_100015954 Ga0070683_1000159542 133
78 3300005329 Ga0070683_100315444 Ga0070683_1003154442 133
79 3300005336 Ga0070680_100170922 Ga0070680_1001709223 133
80 3300005336 Ga0070680_100187967 Ga0070680_1001879672 133
81 3300005336 Ga0070680_100234948 Ga0070680_1002349482 133
82 3300005336 Ga0070680_101090703 Ga0070680_1010907031 133
83 3300005339 Ga0070660_100004854 Ga0070660_10000485411 133
84 3300005339 Ga0070660_100112473 Ga0070660_1001124732 133
85 3300005339 Ga0070660_100377844 Ga0070660_1003778442 133
86 3300005344 Ga0070661_100028809 Ga0070661_1000288095 133
87 3300005344 Ga0070661_100047897 Ga0070661_1000478975 133
88 3300005344 Ga0070661_100052375 Ga0070661_1000523754 133
89 3300005344 Ga0070661_100113261 Ga0070661_1001132612 133
90 3300005344 Ga0070661_100326640 Ga0070661_1003266401 133
91 3300005345 Ga0070692_10007883 Ga0070692_100078834 133
92 3300005345 Ga0070692_10244421 Ga0070692_102444211 133
93 3300005345 Ga0070692_10444989 Ga0070692_104449892 133
94 3300005355 Ga0070671_100090101 Ga0070671_1000901014 133
95 3300005355 Ga0070671_100131790 Ga0070671_1001317902 133
96 3300005364 Ga0070673_100355347 Ga0070673_1003553472 133
97 3300005364 Ga0070673_100537028 Ga0070673_1005370282 133
98 3300005366 Ga0070659_100073165 Ga0070659_1000731653 133
99 3300005366 Ga0070659_100084505 Ga0070659_1000845052 133
100 3300005366 Ga0070659_100090461 Ga0070659_1000904612 133
101 3300005366 Ga0070659_100110709 Ga0070659_1001107093 133
102 3300005366 Ga0070659_100577039 Ga0070659_1005770392 133
103 3300005434 Ga0070709_10324966 Ga0070709_103249662 133
104 3300005435 Ga0070714_101351339 Ga0070714_1013513392 133
105 3300005455 Ga0070663_100007697 Ga0070663_10000769711 133
106 3300005455 Ga0070663_100126604 Ga0070663_1001266042 133
107 3300005455 Ga0070663_100153148 Ga0070663_1001531482 133
108 3300005455 Ga0070663_100316053 Ga0070663_1003160532 133
109 3300005458 Ga0070681_10017873 Ga0070681_100178733 133
110 3300005458 Ga0070681_10145140 Ga0070681_101451403 133
111 3300005458 Ga0070681_11062662 Ga0070681_110626621 133
112 3300005530 Ga0070679_100031444 Ga0070679_1000314446 133
113 3300005530 Ga0070679_100041062 Ga0070679_1000410622 133
114 3300005530 Ga0070679_100166260 Ga0070679_1001662603 133
115 3300005530 Ga0070679_100479024 Ga0070679_1004790243 133
116 3300005530 Ga0070679_100614699 Ga0070679_1006146992 133
117 3300005530 Ga0070679_100922893 Ga0070679_1009228932 133
118 3300005535 Ga0070684_100244722 Ga0070684_1002447222 133
119 3300005539 Ga0068853_100750605 Ga0068853_1007506052 133
120 3300005543 Ga0070672_100063801 Ga0070672_1000638013 133
121 3300005543 Ga0070672_100395957 Ga0070672_1003959572 133
122 3300005545 Ga0070695_100047661 Ga0070695_1000476611 133
123 3300005546 Ga0070696_100014305 Ga0070696_1000143053 133
124 3300005547 Ga0070693_100208757 Ga0070693_1002087572 133
125 3300005548 Ga0070665_100063309 Ga0070665_1000633093 133
126 3300005563 Ga0068855_100055077 Ga0068855_1000550773 133
127 3300005564 Ga0070664_100029446 Ga0070664_1000294463 133
128 3300005564 Ga0070664_100091102 Ga0070664_1000911023 133
129 3300005577 Ga0068857_100280028 Ga0068857_1002800282 133
130 3300005577 Ga0068857_100535506 Ga0068857_1005355062 133
131 3300005578 Ga0068854_100533340 Ga0068854_1005333402 133
132 3300005614 Ga0068856_100019402 Ga0068856_10001940210 133
133 3300005614 Ga0068856_100164823 Ga0068856_1001648233 133
134 3300005614 Ga0068856_100370684 Ga0068856_1003706842 133
135 3300005614 Ga0068856_100852707 Ga0068856_1008527072 133
136 3300005614 Ga0068856_101312134 Ga0068856_1013121341 133
137 3300005616 Ga0068852_100001333 Ga0068852_1000013337 133
138 3300005616 Ga0068852_100017053 Ga0068852_1000170535 133
139 3300005616 Ga0068852_100182959 Ga0068852_1001829592 133
140 3300005616 Ga0068852_100640236 Ga0068852_1006402362 133
141 3300005616 Ga0068852_100898730 Ga0068852_1008987302 133
142 3300005618 Ga0068864_100032940 Ga0068864_1000329403 133
143 3300005834 Ga0068851_10016346 Ga0068851_100163462 133
144 3300005841 Ga0068863_102150482 Ga0068863_1021504821 133
145 3300006237 Ga0097621_100114810 Ga0097621_1001148102 133
146 3300009094 Ga0111539_10257256 Ga0111539_102572562 133
147 3300009176 Ga0105242_12328046 Ga0105242_123280461 133
148 3300009177 Ga0105248_10001787 Ga0105248_100017877 133
149 3300009177 Ga0105248_10129360 Ga0105248_101293604 133
150 3300013100 Ga0157373_10048864 Ga0157373_100488644 133
151 3300013102 Ga0157371_10037032 Ga0157371_100370322 133
152 3300013102 Ga0157371_10142770 Ga0157371_101427703 133
153 3300013102 Ga0157371_11484395 Ga0157371_114843951 133
154 3300013104 Ga0157370_10068880 Ga0157370_100688802 133
155 3300013104 Ga0157370_10863711 Ga0157370_108637111 133
156 3300013104 Ga0157370_11531136 Ga0157370_115311362 133
157 3300013105 Ga0157369_10075308 Ga0157369_100753084 133
158 3300013105 Ga0157369_10077059 Ga0157369_100770592 133
159 3300013105 Ga0157369_10547283 Ga0157369_105472832 133
160 3300013307 Ga0157372_10160087 Ga0157372_101600872 133
161 3300013307 Ga0157372_10891316 Ga0157372_108913161 133
162 3300020082 Ga0206353_11865858 Ga0206353_118658583 133
163 3300025321 Ga0207656_10078979 Ga0207656_100789791 133
164 3300025904 Ga0207647_10013688 Ga0207647_1001368810 133
165 3300025904 Ga0207647_10034367 Ga0207647_100343672 133
166 3300025909 Ga0207705_10001335 Ga0207705_1000133515 133
167 3300025909 Ga0207705_10004507 Ga0207705_100045073 133
168 3300025909 Ga0207705_10028545 Ga0207705_100285452 133
169 3300025909 Ga0207705_10040460 Ga0207705_100404604 133
170 3300025909 Ga0207705_10344000 Ga0207705_103440002 133
171 3300025912 Ga0207707_10125695 Ga0207707_101256951 133
172 3300025912 Ga0207707_10536445 Ga0207707_105364451 133
173 3300025917 Ga0207660_10203545 Ga0207660_102035453 133
174 3300025917 Ga0207660_10216231 Ga0207660_102162312 133
175 3300025917 Ga0207660_11485110 Ga0207660_114851102 133
176 3300025919 Ga0207657_10011481 Ga0207657_100114814 133
177 3300025919 Ga0207657_10014923 Ga0207657_100149237 133
178 3300025919 Ga0207657_10053926 Ga0207657_100539262 133
179 3300025919 Ga0207657_10054858 Ga0207657_100548582 133
180 3300025919 Ga0207657_10087267 Ga0207657_100872672 133
181 3300025919 Ga0207657_10484459 Ga0207657_104844592 133
182 3300025920 Ga0207649_10004386 Ga0207649_100043863 133
183 3300025920 Ga0207649_10063519 Ga0207649_100635193 133
184 3300025920 Ga0207649_10086031 Ga0207649_100860312 133
185 3300025920 Ga0207649_10706555 Ga0207649_107065552 133
186 3300025921 Ga0207652_10213671 Ga0207652_102136713 133
187 3300025921 Ga0207652_10307718 Ga0207652_103077182 133
188 3300025921 Ga0207652_10856343 Ga0207652_108563432 133
189 3300025925 Ga0207650_10120009 Ga0207650_101200092 133
190 3300025931 Ga0207644_10006942 Ga0207644_100069429 133
191 3300025931 Ga0207644_10240021 Ga0207644_102400211 133
192 3300025932 Ga0207690_10131515 Ga0207690_101315152 133
193 3300025932 Ga0207690_10475126 Ga0207690_104751262 133
194 3300025932 Ga0207690_11077660 Ga0207690_110776602 133
195 3300025940 Ga0207691_10311108 Ga0207691_103111083 133
196 3300025941 Ga0207711_10075045 Ga0207711_100750453 133
197 3300025941 Ga0207711_10834301 Ga0207711_108343011 133
198 3300025942 Ga0207689_10503404 Ga0207689_105034042 133
199 3300025944 Ga0207661_10246525 Ga0207661_102465252 133
200 3300025944 Ga0207661_10461467 Ga0207661_104614672 133
201 3300025945 Ga0207679_10071447 Ga0207679_100714473 133
202 3300025949 Ga0207667_10138547 Ga0207667_101385473 133
203 3300025949 Ga0207667_10172694 Ga0207667_101726943 133
204 3300025960 Ga0207651_10492405 Ga0207651_104924052 133
205 3300025960 Ga0207651_10607858 Ga0207651_106078582 133
206 3300025981 Ga0207640_10273399 Ga0207640_102733992 133
207 3300025981 Ga0207640_10408896 Ga0207640_104088962 133
208 3300026067 Ga0207678_10011904 Ga0207678_1001190411 133
209 3300026067 Ga0207678_10023367 Ga0207678_100233675 133
210 3300026067 Ga0207678_10198230 Ga0207678_101982302 133
211 3300026067 Ga0207678_10242728 Ga0207678_102427282 133
212 3300026067 Ga0207678_10609689 Ga0207678_106096892 133
213 3300026078 Ga0207702_10125656 Ga0207702_101256563 133
214 3300026078 Ga0207702_11300862 Ga0207702_113008622 133
215 3300026095 Ga0207676_10025877 Ga0207676_100258776 133
216 3300026116 Ga0207674_10363668 Ga0207674_103636682 133
217 3300026142 Ga0207698_10004706 Ga0207698_100047066 133
218 3300026142 Ga0207698_10018306 Ga0207698_100183065 133
219 3300026142 Ga0207698_10495190 Ga0207698_104951902 133
220 3300026142 Ga0207698_10900668 Ga0207698_109006682 133
221 3300027364 Ga0209967_1013809 Ga0209967_10138093 133
222 3300027424 Ga0209984_1021310 Ga0209984_10213102 133
223 3300027471 Ga0209995_1064222 Ga0209995_10642222 133
224 3300027876 Ga0209974_10003282 Ga0209974_100032823 133
225 3300027907 Ga0207428_10540441 Ga0207428_105404412 133
226 3300028379 Ga0268266_10066521 Ga0268266_100665212 133
227 3300031548 Ga0307408_100032524 Ga0307408_1000325243 133
228 3300031548 Ga0307408_100047415 Ga0307408_1000474153 133
229 3300031548 Ga0307408_100075214 Ga0307408_1000752144 133
230 3300031548 Ga0307408_100140138 Ga0307408_1001401382 133
231 3300031548 Ga0307408_100340951 Ga0307408_1003409513 133
232 3300031548 Ga0307408_101976489 Ga0307408_1019764891 133
233 3300031731 Ga0307405_10009007 Ga0307405_100090077 133
234 3300031731 Ga0307405_10026556 Ga0307405_100265563 133
235 3300031731 Ga0307405_10075953 Ga0307405_100759533 133
236 3300031731 Ga0307405_10311032 Ga0307405_103110322 133
237 3300031731 Ga0307405_10386774 Ga0307405_103867742 133
238 3300031731 Ga0307405_10723311 Ga0307405_107233112 133
239 3300031731 Ga0307405_10857140 Ga0307405_108571402 133
240 3300031731 Ga0307405_11200425 Ga0307405_112004252 133
241 3300031824 Ga0307413_10013139 Ga0307413_100131393 133
242 3300031824 Ga0307413_10014958 Ga0307413_100149586 133
243 3300031824 Ga0307413_10064612 Ga0307413_100646122 133
244 3300031824 Ga0307413_11082712 Ga0307413_110827121 133
245 3300031852 Ga0307410_10003359 Ga0307410_100033594 133
246 3300031852 Ga0307410_10010746 Ga0307410_100107466 133
247 3300031852 Ga0307410_10018013 Ga0307410_100180133 133
248 3300031852 Ga0307410_10028573 Ga0307410_100285732 133
249 3300031852 Ga0307410_10112177 Ga0307410_101121773 133
250 3300031852 Ga0307410_10328567 Ga0307410_103285672 133
251 3300031852 Ga0307410_10622109 Ga0307410_106221092 133
252 3300031852 Ga0307410_11009274 Ga0307410_110092741 133
253 3300031852 Ga0307410_11038390 Ga0307410_110383901 133
254 3300031901 Ga0307406_10009057 Ga0307406_100090575 133
255 3300031901 Ga0307406_10020987 Ga0307406_100209872 133
256 3300031901 Ga0307406_10035273 Ga0307406_100352733 133
257 3300031901 Ga0307406_10055316 Ga0307406_100553163 133
258 3300031901 Ga0307406_10331172 Ga0307406_103311722 133
259 3300031901 Ga0307406_10561486 Ga0307406_105614862 133
260 3300031903 Ga0307407_10018726 Ga0307407_100187266 133
261 3300031903 Ga0307407_10025057 Ga0307407_100250575 133
262 3300031903 Ga0307407_10053317 Ga0307407_100533172 133
263 3300031903 Ga0307407_10157595 Ga0307407_101575952 133
264 3300031903 Ga0307407_10187281 Ga0307407_101872812 133
265 3300031903 Ga0307407_10273877 Ga0307407_102738772 133
266 3300031911 Ga0307412_10039032 Ga0307412_100390322 133
267 3300031911 Ga0307412_10368917 Ga0307412_103689171 133
268 3300031911 Ga0307412_10422572 Ga0307412_104225722 133
269 3300031995 Ga0307409_100010541 Ga0307409_1000105417 133
270 3300031995 Ga0307409_100060527 Ga0307409_1000605272 133
271 3300031995 Ga0307409_100145436 Ga0307409_1001454362 133
272 3300031995 Ga0307409_100147780 Ga0307409_1001477802 133
273 3300031995 Ga0307409_100212918 Ga0307409_1002129183 133
274 3300031995 Ga0307409_100397345 Ga0307409_1003973452 133
275 3300031995 Ga0307409_100672216 Ga0307409_1006722161 133
276 3300031995 Ga0307409_101614432 Ga0307409_1016144321 133
277 3300032002 Ga0307416_100019528 Ga0307416_1000195285 133
278 3300032002 Ga0307416_100031272 Ga0307416_1000312724 133
279 3300032002 Ga0307416_100072279 Ga0307416_1000722794 133
280 3300032002 Ga0307416_100287040 Ga0307416_1002870403 133
281 3300032002 Ga0307416_100823767 Ga0307416_1008237671 133
282 3300032002 Ga0307416_101003578 Ga0307416_1010035782 133
283 3300032002 Ga0307416_101629553 Ga0307416_1016295531 133
284 3300032004 Ga0307414_10022779 Ga0307414_100227793 133
285 3300032004 Ga0307414_10041423 Ga0307414_100414235 133
286 3300032004 Ga0307414_10211300 Ga0307414_102113003 133
287 3300032004 Ga0307414_10224450 Ga0307414_102244502 133
288 3300032004 Ga0307414_10605078 Ga0307414_106050781 133
289 3300032004 Ga0307414_10999520 Ga0307414_109995202 133
290 3300032005 Ga0307411_10022496 Ga0307411_100224963 133
291 3300032005 Ga0307411_10022844 Ga0307411_100228446 133
292 3300032005 Ga0307411_10038225 Ga0307411_100382252 133
293 3300032005 Ga0307411_10052764 Ga0307411_100527643 133
294 3300032005 Ga0307411_10136177 Ga0307411_101361772 133
295 3300032005 Ga0307411_10380322 Ga0307411_103803222 133
296 3300032005 Ga0307411_10847439 Ga0307411_108474392 133
297 3300032005 Ga0307411_11071665 Ga0307411_110716651 133
298 3300032126 Ga0307415_100019145 Ga0307415_1000191452 133
299 3300032126 Ga0307415_100026736 Ga0307415_1000267363 133
300 3300032126 Ga0307415_100031947 Ga0307415_1000319473 133
301 3300032126 Ga0307415_100211008 Ga0307415_1002110082 133
302 3300032126 Ga0307415_100694468 Ga0307415_1006944682 133
303 3300032126 Ga0307415_100849841 Ga0307415_1008498412 133
304 3300035241 Ga0373961_0264163 Ga0373961_0264163_40_441 133
305 3300037312 Ga0395899_0002112 Ga0395899_0002112_11678_12079 133
306 3300037312 Ga0395899_0123141 Ga0395899_0123141_1013_1414 133
307 3300037312 Ga0395899_0260408 Ga0395899_0260408_299_703 133
308 3300037312 Ga0395899_0378325 Ga0395899_0378325_280_681 133
309 3300037418 Ga0395900_0010588 Ga0395900_0010588_3639_4043 133
310 3300037418 Ga0395900_0017242 Ga0395900_0017242_2714_3115 133
311 3300037418 Ga0395900_0022458 Ga0395900_0022458_3310_3711 133
312 3300037418 Ga0395900_0235416 Ga0395900_0235416_1116_1517 133
313 3300037418 Ga0395900_0514145 Ga0395900_0514145_360_761 133
314 3300037466 Ga0395898_0007746 Ga0395898_0007746_2670_3071 133
315 3300037466 Ga0395898_0014405 Ga0395898_0014405_5638_6042 133
316 3300037466 Ga0395898_0164581 Ga0395898_0164581_730_1131 133
317 3300037466 Ga0395898_0226029 Ga0395898_0226029_988_1389 133
318 3300037471 Ga0395905_0007702 Ga0395905_0007702_7616_8017 133
319 3300037471 Ga0395905_0230116 Ga0395905_0230116_558_959 133
320 3300037471 Ga0395905_0429001 Ga0395905_0429001_143_544 133
321 3300038443 Ga0395901_0000936 Ga0395901_0000936_3197_3598 133
322 3300038443 Ga0395901_0002713 Ga0395901_0002713_4260_4661 133
323 3300038443 Ga0395901_0024147 Ga0395901_0024147_3649_4053 133
324 3300038443 Ga0395901_0434542 Ga0395901_0434542_164_565 133
325 3300041405 Ga0439438_071416 Ga0439438_071416_89_493 133
326 3300041491 Ga0451833_0960793 Ga0451833_0960793_62_466 133
327 3300042006 Ga0439432_094933 Ga0439432_094933_435_857 133
328 3300042010 Ga0439452_050602 Ga0439452_050602_384_788 133
329 3300042120 Ga0450917_001447 Ga0450917_001447_626_1030 133
330 3300042127 Ga0450890_003877 Ga0450890_003877_1468_1872 133
331 3300042138 Ga0450903_013401 Ga0450903_013401_291_695 133
332 3300042142 Ga0450905_000788 Ga0450905_000788_1745_2149 133
333 3300042144 Ga0450889_000242 Ga0450889_000242_1445_1849 133
334 3300042530 Ga0450916_024717 Ga0450916_024717_266_670 133
335 3300044658 Ga0466972_0071300 Ga0466972_0071300_385_858 133
336 3300044658 Ga0466972_0101592 Ga0466972_0101592_224_625 133
337 3300044658 Ga0466972_0218637 Ga0466972_0218637_293_694 133
338 3300044673 Ga0453683_0741828 Ga0453683_0741828_203_607 133
339 3300044683 Ga0466965_0148790 Ga0466965_0148790_566_967 133
340 3300044683 Ga0466965_0238019 Ga0466965_0238019_173_574 133
341 3300044684 Ga0466966_0592872 Ga0466966_0592872_69_470 133
342 3300044693 Ga0466961_0699926 Ga0466961_0699926_143_544 133
343 3300044694 Ga0466963_0356525 Ga0466963_0356525_328_729 133
344 3300044694 Ga0466963_1032410 Ga0466963_1032410_38_439 133
345 3300044706 Ga0466964_0063485 Ga0466964_0063485_827_1228 133
346 3300044765 Ga0466970_0136981 Ga0466970_0136981_154_555 133
347 3300044842 Ga0466957_0049198 Ga0466957_0049198_1094_1495 133
348 3300044842 Ga0466957_0441490 Ga0466957_0441490_399_800 133
349 3300045836 Ga0466958_0097999 Ga0466958_0097999_37_561 133
350 3300045976 Ga0466967_0178076 Ga0466967_0178076_295_696 133
351 3300045976 Ga0466967_0281972 Ga0466967_0281972_488_889 133
352 3300045976 Ga0466967_0874434 Ga0466967_0874434_366_767 133
353 3300045976 Ga0466967_0962903 Ga0466967_0962903_333_734 133
354 3300045976 Ga0466967_1225619 Ga0466967_1225619_119_520 133
355 3300046525 Ga0495663_0034517 Ga0495663_0034517_728_1129 133
356 3300046528 Ga0495642_0058827 Ga0495642_0058827_544_945 133
357 3300046684 Ga0495669_0256218 Ga0495669_0256218_150_551 133
358 3300047318 Ga0495636_0303402 Ga0495636_0303402_151_552 133
359 3300048903 Ga0496100_0241415 Ga0496100_0241415_766_1167 133
360 3300048904 Ga0496101_0052635 Ga0496101_0052635_106_507 133
361 3300048904 Ga0496101_0415835 Ga0496101_0415835_405_806 133
362 3300048905 Ga0496102_1576870 Ga0496102_1576870_31_432 133
363 3300048907 Ga0496104_0375152 Ga0496104_0375152_502_903 133
364 3300048907 Ga0496104_0838546 Ga0496104_0838546_285_686 133
365 3300048908 Ga0496105_0258499 Ga0496105_0258499_16_417 133
366 3300048909 Ga0496106_0004503 Ga0496106_0004503_80_481 133
367 3300048910 Ga0496107_0031679 Ga0496107_0031679_2975_3376 133
368 3300048911 Ga0496108_0042022 Ga0496108_0042022_2929_3330 133
369 3300048912 Ga0496109_0010877 Ga0496109_0010877_6724_7125 133
370 3300048913 Ga0496110_0073947 Ga0496110_0073947_1774_2175 133
371 3300048913 Ga0496110_0470933 Ga0496110_0470933_586_987 133
372 3300048913 Ga0496110_0885266 Ga0496110_0885266_23_424 133
373 3300048914 Ga0496111_0024483 Ga0496111_0024483_1850_2251 133
374 3300048914 Ga0496111_0027283 Ga0496111_0027283_3314_3715 133
375 3300048915 Ga0496112_0019114 Ga0496112_0019114_3242_3643 133
376 3300048916 Ga0496113_0197047 Ga0496113_0197047_678_1079 133
377 3300049515 Ga0501292_007841 Ga0501292_007841_484_906 133
378 3300049584 Ga0501068_0635092 Ga0501068_0635092_137_538 133
379 3300049586 Ga0501070_0407332 Ga0501070_0407332_251_652 133
380 3300049590 Ga0501074_0064687 Ga0501074_0064687_657_1058 133
381 3300049652 Ga0501202_041033 Ga0501202_041033_349_771 133
382 3300049661 Ga0501217_019286 Ga0501217_019286_252_674 133
383 3300049663 Ga0501223_004162 Ga0501223_004162_200_622 133
384 3300049664 Ga0501224_030811 Ga0501224_030811_173_595 133
385 3300049679 Ga0501249_004441 Ga0501249_004441_700_1122 133
386 3300049707 Ga0501234_013137 Ga0501234_013137_823_1245 133
387 3300049707 Ga0501234_057917 Ga0501234_057917_168_569 133
388 3300049742 Ga0501080_0687134 Ga0501080_0687134_453_854 133
389 3300049759 Ga0501262_031960 Ga0501262_031960_48_470 133
390 3300049765 Ga0501268_009941 Ga0501268_009941_1032_1454 133
391 3300049767 Ga0501270_003876 Ga0501270_003876_823_1245 133
392 3300050511 nmdc:mga08y16_250860_c1 nmdc:mga08y16_250860_c1_1178_1582 133
393 3300061719 Ga0466962_0068560 Ga0466962_0068560_575_1048 133
394 3300061719 Ga0466962_0242563 Ga0466962_0242563_135_536 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

37

100

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.974 2 120
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9359 27 101
3nst-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans 0.9351 27 101
3nw4-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate 0.9349 27 101
2phd-assembly1.cif.gz_A crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9348 27 101
ID Description Score Start End Superfamily
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9612 7 118 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9571 19 102 2.60.120.10
3cewA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9362 27 102 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9267 15 102 2.60.120.10
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9262 28 102 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2H0NJ51-F1-model_v4 Cupin 0.9916 1 99
AF-A0A7V1MPV6-F1-model_v4 Cupin domain-containing protein 0.9849 3 117 GO:0016020
AF-A0A4V0NEP1-F1-model_v4 Cupin type-2 domain-containing protein 0.9846 1 120
AF-A0A653G3I1-F1-model_v4 Cupin domain-containing protein 0.9824 1 119
AF-A0A843L4J4-F1-model_v4 Cupin domain-containing protein 0.9824 2 119

Feature Viewer

pLDDT pTM Quality
91.97 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map