F432622

General Info

Members Datasets Scaffolds Average Seq Length
393 294 786 250

Family's Representative Sequence

Representative Sequence 3300027312|Ga0209371_1010590|Ga0209371_10105902
Length 286
Sequence MRIEPTPEALRAPPSRGHADGPAEPAPWHPDEASNMQTLLRLSGLRKAFDAVVATNGVDLDVRAGEIHAIIGPNGAGKSTLIAQICGEIRPDSGTIELDGRDVTALRAFERARLGLGRSFQITELCQEYTALENVILSSMLKGGRAFGAWSDPRRDAGLKAQAMQWLTHVGLAERRHVRTADLAHGEKRQLELAVALARSPRLLLLDEPMAGMGPEESARMTRLLLGMKGDYGILLVEHDMDAVFALADRISVLVYGKVVFSGAPDEVRRHPEVRAAYLGEEHVEG

Samples

Sample ID Description Type Environment
1 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
104 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
105 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
106 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
107 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
265 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
266 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
269 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
270 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
271 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
272 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
273 2643221569 Achromobacter sp. Root565 Isolate Unclassified
274 2643221594 Achromobacter sp. Root170 Isolate Unclassified
275 2643221621 Achromobacter sp. Root83 Isolate Unclassified
276 2773857925 Microvirga vignae BR3299 Isolate Unclassified
277 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
278 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
279 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
280 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
281 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
282 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
283 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
284 2858950400 Achromobacter sp. K91 Isolate Unclassified
285 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
286 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
287 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
288 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
289 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
290 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
291 2941479691
292 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
293 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
294 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.62
Metatranscriptomes 0
Isolates 7.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 1.27
Rhizoplane 7.89
Rhizosphere 70.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209371_1010590 3300027312 Bacteria 2818
2 2214800767 2209111006 Bacteria 10478
3 ARcpr5oldR_c000002 3300000041 Bacteria 79314
4 ARSoilYngRDRAFT_c00455 3300000042 Bacteria 5023
5 ARcpr5yngRDRAFT_c000078 3300000043 Bacteria 16068
6 ARSoilOldRDRAFT_c000044 3300000044 Bacteria 26451
7 ARCol0oldRDRAFT_c00421 3300000045 Bacteria 4068
8 ARCol0yngRDRAFT_1000006 3300000652 Bacteria 46794
9 JGI24749J21850_1003180 3300002076 Bacteria 2291
10 JGI25162J39368_1000375 3300002737 Bacteria 38023
11 JGI25165J46597_1000276 3300003214 Bacteria 66076
12 JGI26129J50193_1005021 3300003349 Bacteria 943
13 Ga0055529_1001068 3300003763 Bacteria 12713
14 Ga0065165_1000240 3300005262 Bacteria 93895
15 Ga0065716_1001767 3300005277 Bacteria 3509
16 Ga0065712_10000525 3300005290 Bacteria 16096
17 Ga0065715_10000786 3300005293 Bacteria 27945
18 Ga0065707_10093700 3300005295 Bacteria 3591
19 Ga0070676_10081060 3300005328 Bacteria 1969
20 Ga0070676_10138169 3300005328 Bacteria 1548
21 Ga0070690_100003470 3300005330 Bacteria 8626
22 Ga0070670_100172555 3300005331 Bacteria 1876
23 Ga0068869_100173836 3300005334 Bacteria 1684
24 Ga0068869_100425024 3300005334 Bacteria 1097
25 Ga0070680_100070455 3300005336 Bacteria 2871
26 Ga0070660_100006708 3300005339 Bacteria 7988
27 Ga0070689_100025669 3300005340 Bacteria 4429
28 Ga0070689_100305600 3300005340 Bacteria 1325
29 Ga0070691_10044321 3300005341 Bacteria 2109
30 Ga0070661_100554349 3300005344 Bacteria 925
31 Ga0070692_10004117 3300005345 Bacteria 6017
32 Ga0070668_100056420 3300005347 Bacteria 3033
33 Ga0070668_100178776 3300005347 Bacteria 1732
34 Ga0070669_100021880 3300005353 Bacteria 4572
35 Ga0070669_100036132 3300005353 Bacteria 3578
36 Ga0070675_100098084 3300005354 Bacteria 2464
37 Ga0070674_100118747 3300005356 Bacteria 1955
38 Ga0070674_100204491 3300005356 Bacteria 1527
39 Ga0070673_100643882 3300005364 Bacteria 970
40 Ga0070688_100100690 3300005365 Bacteria 1904
41 Ga0070659_100078810 3300005366 Bacteria 2629
42 Ga0070667_100044093 3300005367 Bacteria 3745
43 Ga0070667_100399663 3300005367 Bacteria 1250
44 Ga0070703_10012139 3300005406 Bacteria 2440
45 Ga0070714_100082203 3300005435 Bacteria 2806
46 Ga0070701_10013239 3300005438 Bacteria 3747
47 Ga0070700_100054906 3300005441 Bacteria 2491
48 Ga0070694_100008532 3300005444 Bacteria 6270
49 Ga0070708_100042049 3300005445 Bacteria 4009
50 Ga0070708_100143378 3300005445 Bacteria 2217
51 Ga0070708_100255667 3300005445 Bacteria 1646
52 Ga0070663_100012889 3300005455 Bacteria 5307
53 Ga0070663_100072402 3300005455 Bacteria 2511
54 Ga0070663_100603136 3300005455 Bacteria 924
55 Ga0070662_100022982 3300005457 Bacteria 4278
56 Ga0070662_100023409 3300005457 Bacteria 4242
57 Ga0070681_10167760 3300005458 Bacteria 2118
58 Ga0068867_100203490 3300005459 Bacteria 1586
59 Ga0070685_10042406 3300005466 Bacteria 2597
60 Ga0070706_100000313 3300005467 Bacteria 58951
61 Ga0070706_100052017 3300005467 Bacteria 3782
62 Ga0070707_100009832 3300005468 Bacteria 8900
63 Ga0070707_100047207 3300005468 Bacteria 4122
64 Ga0070707_100100734 3300005468 Bacteria 2799
65 Ga0070707_100288324 3300005468 Bacteria 1595
66 Ga0070698_100000782 3300005471 Bacteria 34479
67 Ga0070698_100008388 3300005471 Bacteria 11168
68 Ga0070698_100011929 3300005471 Bacteria 9221
69 Ga0070698_100052166 3300005471 Bacteria 4162
70 Ga0070699_100099490 3300005518 Bacteria 2548
71 Ga0070699_100120685 3300005518 Bacteria 2305
72 Ga0070679_100029480 3300005530 Bacteria 5414
73 Ga0070697_100079918 3300005536 Bacteria 2693
74 Ga0068853_100016210 3300005539 Bacteria 6130
75 Ga0068853_100474580 3300005539 Bacteria 1179
76 Ga0070672_100144174 3300005543 Bacteria 1967
77 Ga0070686_100005478 3300005544 Bacteria 7029
78 Ga0070695_100017290 3300005545 Bacteria 4371
79 Ga0070695_100027246 3300005545 Bacteria 3539
80 Ga0070696_100035450 3300005546 Bacteria 3435
81 Ga0070704_100001627 3300005549 Bacteria 12176
82 Ga0068855_100453529 3300005563 Bacteria 1399
83 Ga0070664_100040276 3300005564 Bacteria 3939
84 Ga0068857_100242391 3300005577 Bacteria 1651
85 Ga0068856_100059292 3300005614 Bacteria 3781
86 Ga0068856_101006128 3300005614 Bacteria 852
87 Ga0068859_100258914 3300005617 Bacteria 1831
88 Ga0068861_100011543 3300005719 Bacteria 6147
89 Ga0068861_100323401 3300005719 Bacteria 1344
90 Ga0068858_100082132 3300005842 Bacteria 2995
91 Ga0068860_100042317 3300005843 Bacteria 4351
92 Ga0068860_100525343 3300005843 Bacteria 1184
93 Ga0068862_100012095 3300005844 Bacteria 7131
94 Ga0068862_100083712 3300005844 Bacteria 2770
95 Ga0081455_10098818 3300005937 Bacteria 2349
96 Ga0081539_10001176 3300005985 Bacteria 47379
97 Ga0070717_10201502 3300006028 Bacteria 1743
98 Ga0075365_10014072 3300006038 Bacteria 4805
99 Ga0075365_10045055 3300006038 Bacteria 2892
100 Ga0075365_10096837 3300006038 Bacteria 2017
101 Ga0075365_10185690 3300006038 Bacteria 1454
102 Ga0075365_10332859 3300006038 Bacteria 1070
103 Ga0075363_100087910 3300006048 Bacteria 1708
104 Ga0070716_100062190 3300006173 Bacteria 2163
105 Ga0070716_100097629 3300006173 Bacteria 1793
106 Ga0075367_10093670 3300006178 Bacteria 1830
107 Ga0075367_10227328 3300006178 Bacteria 1168
108 Ga0075369_10028277 3300006186 Bacteria 2349
109 Ga0075369_10158376 3300006186 Bacteria 1037
110 Ga0075366_10276036 3300006195 Bacteria 1027
111 Ga0075370_10052661 3300006353 Bacteria 2310
112 Ga0075430_100000325 3300006846 Bacteria 34035
113 Ga0075430_100490995 3300006846 Bacteria 1013
114 Ga0075433_10581476 3300006852 Bacteria 984
115 Ga0075434_100111015 3300006871 Bacteria 2753
116 Ga0068865_100087516 3300006881 Bacteria 2252
117 Ga0075436_100128055 3300006914 Bacteria 1779
118 Ga0097620_100258907 3300006931 Bacteria 1831
119 Ga0075435_100186044 3300007076 Bacteria 1756
120 Ga0105244_10146063 3300009036 Bacteria 1135
121 Ga0105240_10205142 3300009093 Bacteria 2308
122 Ga0111539_10000114 3300009094 Bacteria 88757
123 Ga0111539_10228130 3300009094 Bacteria 2169
124 Ga0111539_10665567 3300009094 Bacteria 1212
125 Ga0105245_10143401 3300009098 Bacteria 2252
126 Ga0105247_10029803 3300009101 Bacteria 3308
127 Ga0105247_10193275 3300009101 Bacteria 1364
128 Ga0105243_10013412 3300009148 Bacteria 6198
129 Ga0105243_10492223 3300009148 Bacteria 1160
130 Ga0105237_10017286 3300009545 Bacteria 7478
131 Ga0105237_10539584 3300009545 Bacteria 1173
132 Ga0105249_10025849 3300009553 Bacteria 5288
133 Ga0105249_10083027 3300009553 Bacteria 2981
134 Ga0105239_10030215 3300010375 Bacteria 5956
135 Ga0105239_10175950 3300010375 Bacteria 2393
136 Ga0105239_10552085 3300010375 Bacteria 1312
137 Ga0105246_10015049 3300011119 Bacteria 4875
138 Ga0105246_10094921 3300011119 Bacteria 2158
139 Ga0105246_10452612 3300011119 Bacteria 1079
140 Ga0157373_10319716 3300013100 Bacteria 1104
141 Ga0157371_10067261 3300013102 Bacteria 2536
142 Ga0163162_10421639 3300013306 Bacteria 1467
143 Ga0157375_10145412 3300013308 Bacteria 2501
144 Ga0157375_10353000 3300013308 Bacteria 1636
145 Ga0157380_10004799 3300014326 Bacteria 9422
146 Ga0157380_10466142 3300014326 Bacteria 1217
147 Ga0157376_10092590 3300014969 Bacteria 2621
148 Ga0163161_10134081 3300017792 Bacteria 1870
149 Ga0214544_1000003 3300021320 Bacteria 643752
150 Ga0214542_1000003 3300021321 Bacteria 435700
151 Ga0214545_1000004 3300021324 Bacteria 453352
152 Ga0214543_1000007 3300021327 Bacteria 414744
153 Ga0209760_102857 3300025207 Bacteria 1583
154 Ga0209672_105681 3300025228 Bacteria 2112
155 Ga0209437_100023 3300025233 Bacteria 614195
156 Ga0209233_1000062 3300025261 Bacteria 399685
157 Ga0207666_1001868 3300025271 Bacteria 2504
158 Ga0209455_1000227 3300025272 Bacteria 75434
159 Ga0209130_1000061 3300025284 Bacteria 200990
160 Ga0209025_1001266 3300025294 Bacteria 34874
161 Ga0207426_1015006 3300025302 Bacteria 2826
162 Ga0207697_10015857 3300025315 Bacteria 3108
163 Ga0207710_10144699 3300025900 Bacteria 1150
164 Ga0207688_10010172 3300025901 Bacteria 5119
165 Ga0207647_10018614 3300025904 Bacteria 4690
166 Ga0207645_10073391 3300025907 Bacteria 2190
167 Ga0207645_10143859 3300025907 Bacteria 1554
168 Ga0207643_10018870 3300025908 Bacteria 3778
169 Ga0207684_10000077 3300025910 Bacteria 182957
170 Ga0207684_10145875 3300025910 Bacteria 2036
171 Ga0207684_10291844 3300025910 Bacteria 1406
172 Ga0207671_10031226 3300025914 Bacteria 3969
173 Ga0207693_10043179 3300025915 Bacteria 3548
174 Ga0207660_10012737 3300025917 Bacteria 5506
175 Ga0207657_10013896 3300025919 Bacteria 7879
176 Ga0207652_10054048 3300025921 Bacteria 3451
177 Ga0207646_10021362 3300025922 Bacteria 5981
178 Ga0207646_10023295 3300025922 Bacteria 5690
179 Ga0207646_10044853 3300025922 Bacteria 3968
180 Ga0207646_10319068 3300025922 Bacteria 1404
181 Ga0207681_10022351 3300025923 Bacteria 4034
182 Ga0207681_10426580 3300025923 Bacteria 1075
183 Ga0207659_10068029 3300025926 Bacteria 2590
184 Ga0207659_10074459 3300025926 Bacteria 2489
185 Ga0207687_10138417 3300025927 Bacteria 1844
186 Ga0207664_10067030 3300025929 Bacteria 2879
187 Ga0207690_10180127 3300025932 Bacteria 1590
188 Ga0207706_10010128 3300025933 Bacteria 8629
189 Ga0207709_10018404 3300025935 Bacteria 3913
190 Ga0207670_10088142 3300025936 Bacteria 2188
191 Ga0207704_10347600 3300025938 Bacteria 1153
192 Ga0207665_10097960 3300025939 Bacteria 2042
193 Ga0207665_10541806 3300025939 Bacteria 903
194 Ga0207691_10155002 3300025940 Bacteria 2012
195 Ga0207689_10021409 3300025942 Bacteria 5436
196 Ga0207689_10103202 3300025942 Bacteria 2343
197 Ga0207689_10411682 3300025942 Bacteria 1128
198 Ga0207679_10477331 3300025945 Bacteria 1109
199 Ga0207667_10399777 3300025949 Bacteria 1399
200 Ga0207712_10036690 3300025961 Bacteria 3341
201 Ga0207712_10322698 3300025961 Bacteria 1275
202 Ga0207668_10008224 3300025972 Bacteria 6215
203 Ga0207668_10025367 3300025972 Bacteria 3836
204 Ga0207640_10233042 3300025981 Bacteria 1418
205 Ga0207640_10351961 3300025981 Bacteria 1184
206 Ga0207658_10029450 3300025986 Bacteria 3878
207 Ga0207703_10618765 3300026035 Bacteria 1025
208 Ga0207703_10844188 3300026035 Bacteria 876
209 Ga0207639_10052011 3300026041 Bacteria 3119
210 Ga0207639_10188406 3300026041 Bacteria 1760
211 Ga0207639_10673688 3300026041 Bacteria 958
212 Ga0207678_10148027 3300026067 Bacteria 2004
213 Ga0207708_10008025 3300026075 Bacteria 7825
214 Ga0207702_10083355 3300026078 Bacteria 2782
215 Ga0207702_10681912 3300026078 Bacteria 1012
216 Ga0207641_10150272 3300026088 Bacteria 2109
217 Ga0207648_10071023 3300026089 Bacteria 3035
218 Ga0207675_100009096 3300026118 Bacteria 9321
219 Ga0207675_100327012 3300026118 Bacteria 1498
220 Ga0207698_11167030 3300026142 Bacteria 784
221 Ga0209968_1007727 3300027526 Bacteria 1630
222 Ga0209971_1018509 3300027682 Bacteria 1653
223 Ga0209966_1000408 3300027695 Bacteria 12602
224 Ga0209998_10002086 3300027717 Bacteria 4673
225 Ga0209813_10029563 3300027866 Bacteria 1605
226 Ga0209974_10014912 3300027876 Bacteria 2581
227 Ga0207428_10000312 3300027907 Bacteria 64494
228 Ga0268266_10433520 3300028379 Bacteria 1247
229 Ga0268265_10087609 3300028380 Bacteria 2478
230 Ga0268265_10223458 3300028380 Bacteria 1649
231 Ga0268264_10079841 3300028381 Bacteria 2792
232 Ga0307515_10320988 3300028794 Bacteria 1215
233 Ga0268256_1010796 3300030500 Bacteria 2937
234 Ga0265325_10106203 3300031241 Bacteria 1369
235 Ga0307513_10066569 3300031456 Bacteria 3784
236 Ga0307408_100052036 3300031548 Bacteria 2953
237 Ga0307405_10343448 3300031731 Bacteria 1149
238 Ga0307410_10122174 3300031852 Bacteria 1901
239 Ga0307406_10041474 3300031901 Bacteria 2868
240 Ga0307412_10000103 3300031911 Bacteria 69660
241 Ga0307412_10205231 3300031911 Bacteria 1499
242 Ga0307416_100786397 3300032002 Bacteria 1046
243 Ga0307411_10354178 3300032005 Bacteria 1198
244 Ga0307510_10264168 3300033180 Bacteria 1201
245 Ga0373930_0000163 3300034816 Bacteria 7694
246 Ga0373948_0000214 3300034817 Bacteria 6726
247 Ga0373958_0000109 3300034819 Bacteria 8787
248 Ga0373959_0000195 3300034820 Bacteria 13522
249 Ga0373938_0000044 3300034957 Bacteria 16525
250 Ga0373928_0000075 3300035084 Bacteria 17387
251 Ga0373940_0000064 3300035088 Bacteria 12264
252 Ga0373949_0002004 3300035090 Bacteria 5440
253 Ga0373951_0000281 3300035091 Bacteria 16289
254 Ga0373952_0000436 3300035092 Bacteria 7228
255 Ga0373932_0000556 3300035112 Bacteria 11439
256 Ga0373939_0000729 3300035114 Bacteria 8139
257 Ga0373941_0001036 3300035115 Bacteria 5781
258 Ga0373960_0000031 3300035121 Bacteria 17642
259 Ga0373942_0000621 3300035207 Bacteria 9944
260 Ga0373961_0000705 3300035241 Bacteria 11654
261 Ga0373962_0001884 3300035242 Bacteria 4990
262 Ga0373931_0209027 3300035691 Bacteria 1169
263 Ga0316584_0020398 3300036712 Bacteria 4805
264 Ga0400483_163745 3300039062 Bacteria 9015
265 Ga0436360_0208766 3300039438 Bacteria 4725
266 Ga0436360_0315955 3300039438 Bacteria 1056
267 Ga0436361_0221705 3300039447 Bacteria 1563
268 Ga0436363_1393737 3300039450 Bacteria 730
269 Ga0453683_0133417 3300044673 Bacteria 1566
270 Ga0453684_0259581 3300044712 Bacteria 1991
271 Ga0466960_0196574 3300044901 Bacteria 1100
272 Ga0451576_0015043 3300045051 Bacteria 8594
273 Ga0495638_0010625 3300046460 Bacteria 6376
274 Ga0495605_0136281 3300046474 Bacteria 1104
275 Ga0495594_0017972 3300046499 Bacteria 3743
276 Ga0495596_0156495 3300046500 Bacteria 885
277 Ga0495607_0000064 3300046501 Bacteria 104740
278 Ga0495598_0014537 3300046537 Bacteria 1970
279 Ga0495656_0020546 3300046615 Bacteria 2563
280 Ga0495589_0054807 3300046794 Bacteria 1966
281 Ga0495674_0471574 3300047319 Bacteria 1007
282 Ga0495677_0095639 3300047445 Bacteria 1122
283 Ga0496100_0094518 3300048903 Bacteria 2047
284 Ga0496101_0195247 3300048904 Bacteria 1563
285 Ga0496102_0007877 3300048905 Bacteria 9101
286 Ga0496102_0009878 3300048905 Bacteria 8206
287 Ga0496103_0030002 3300048906 Bacteria 3307
288 Ga0496103_0034427 3300048906 Bacteria 3097
289 Ga0496104_0010684 3300048907 Bacteria 8207
290 Ga0496104_0240306 3300048907 Bacteria 1723
291 Ga0496104_0537215 3300048907 Bacteria 1080
292 Ga0496105_0010560 3300048908 Bacteria 7264
293 Ga0496105_0168899 3300048908 Bacteria 1794
294 Ga0496106_0004784 3300048909 Bacteria 10012
295 Ga0496106_0009427 3300048909 Bacteria 7216
296 Ga0496107_0029402 3300048910 Bacteria 3908
297 Ga0496107_0068033 3300048910 Bacteria 2584
298 Ga0496108_0005041 3300048911 Bacteria 10671
299 Ga0496108_0012254 3300048911 Bacteria 6973
300 Ga0496109_0009938 3300048912 Bacteria 8125
301 Ga0496110_0033022 3300048913 Bacteria 4474
302 Ga0496110_0048177 3300048913 Bacteria 3735
303 Ga0496110_0338270 3300048913 Bacteria 1371
304 Ga0496111_0046553 3300048914 Bacteria 3123
305 Ga0496112_0005332 3300048915 Bacteria 11101
306 Ga0496112_0010445 3300048915 Bacteria 8422
307 Ga0496112_0037027 3300048915 Bacteria 4762
308 Ga0496112_0634020 3300048915 Bacteria 999
309 Ga0496113_0058187 3300048916 Bacteria 2908
310 Ga0496114_0026093 3300048917 Bacteria 4781
311 Ga0496115_0023154 3300048918 Bacteria 4819
312 Ga0496115_0549472 3300048918 Bacteria 923
313 Ga0496116_0010631 3300048919 Bacteria 7695
314 Ga0496116_0086060 3300048919 Bacteria 1929
315 Ga0496116_0103907 3300048919 Bacteria 1689
316 Ga0496117_0048484 3300048920 Bacteria 3034
317 Ga0496118_0006462 3300048921 Bacteria 12872
318 Ga0496118_0012206 3300048921 Bacteria 8276
319 Ga0496119_0024757 3300048922 Bacteria 4212
320 Ga0496119_0199041 3300048922 Bacteria 1038
321 Ga0496120_0022089 3300048923 Bacteria 4006
322 Ga0496121_0000628 3300048924 Bacteria 65856
323 Ga0496122_0000497 3300048925 Bacteria 81763
324 Ga0496122_0091690 3300048925 Bacteria 2068
325 Ga0496123_0003447 3300048926 Bacteria 17729
326 Ga0496123_0029646 3300048926 Bacteria 4021
327 Ga0496124_0059784 3300048927 Bacteria 3200
328 Ga0496125_0000166 3300048928 Bacteria 147432
329 Ga0496125_0009105 3300048928 Bacteria 10268
330 Ga0496125_0027392 3300048928 Bacteria 5166
331 Ga0496126_0097186 3300048929 Bacteria 2581
332 Ga0501033_0216389 3300049570 Bacteria 1365
333 Ga0501033_0246033 3300049570 Bacteria 1268
334 Ga0501034_0009527 3300049571 Bacteria 10167
335 Ga0501043_0059119 3300049579 Bacteria 3008
336 Ga0501047_0061063 3300049581 Bacteria 3637
337 Ga0501075_0089128 3300049591 Bacteria 2339
338 Ga0501081_0098271 3300049743 Bacteria 2067
339 Ga0501035_0006258 3300049822 Bacteria 11193
340 Ga0501044_0000617 3300049823 Bacteria 42992
341 Ga0501044_0049464 3300049823 Bacteria 4340
342 Ga0501045_0156535 3300049824 Bacteria 1695
343 nmdc:mga00v17_151076_c1 3300050491 Bacteria 1492
344 nmdc:mga0yw44_185082_c1 3300050492 Bacteria 1372
345 nmdc:mga06z11_21963_c1 3300050494 Bacteria 2973
346 nmdc:mga04h51_52354_c1 3300050495 Bacteria 1374
347 nmdc:mga07m45_7420_c1 3300050496 Bacteria 2251
348 nmdc:mga0qj67_1988_c1 3300050509 Bacteria 14569
349 nmdc:mga0qj67_209251_c1 3300050509 Bacteria 1584
350 nmdc:mga06r32_345113_c1 3300050510 Bacteria 1473
351 nmdc:mga08y16_15457_c1 3300050511 Bacteria 8028
352 nmdc:mga0n895_36111_c1 3300050512 Bacteria 4770
353 nmdc:mga0n895_366970_c1 3300050512 Bacteria 1458
354 nmdc:mga0n895_407709_c1 3300050512 Bacteria 1375
355 nmdc:mga08x19_113174_c1 3300050514 Bacteria 1812
356 nmdc:mga08x19_53710_c1 3300050514 Bacteria 2592
357 nmdc:mga0a205_155885_c1 3300050515 Bacteria 2182
358 nmdc:mga0sz30_985_c1 3300050516 Bacteria 10242
359 Ga0495601_0176667 3300053077 Bacteria 1396
360 Ga0495655_0005594 3300053083 Bacteria 2231
361 Ga0500583_0042173 3300053092 Bacteria 2078
362 Ga0500652_000369 3300053131 Bacteria 16152
363 Ga0500616_0000046 3300053153 Bacteria 333409
364 Ga0500616_0000541 3300053153 Bacteria 47231
365 2501069323 2501025501 Bacteria 7768574
366 2511106551 2510917015 Bacteria 7950052
367 2512036780 2511231221 Bacteria 6846400
368 2599105356 2597490356 Bacteria 7030811
369 2599905934 2599185292 Bacteria 6290804
370 2643859069 2643221569 Bacteria 6064337
371 2643980092 2643221594 Bacteria 5811388
372 2644120560 2643221621 Bacteria 6212786
373 2774874427 2773857925 Bacteria 6472445
374 2809033816 2808606395 Bacteria 6020352
375 2837273618 2837268691 Bacteria 7850704
376 2837274217 2837268691 Bacteria 7850704
377 2842486484 2842482326 Bacteria 7212537
378 2846954962 2846952575 Bacteria 6587527
379 2848858745 2848858292 Bacteria 7391279
380 2857539724 2857537821 Bacteria 5248181
381 2857579264 2857576091 Bacteria 5465855
382 2858954578 2858950400 Bacteria 6783797
383 2858956296 2858950400 Bacteria 6783797
384 2867348444 2867346516 Bacteria 7608576
385 2870724829 2870721527 Bacteria 9689237
386 2883580615 2883577096 Bacteria 4709178
387 2895513617 2895511927 Bacteria 6802080
388 2919680612 2919679072 Bacteria 4629602
389 2939631632 2939631187 Bacteria 6118131
390 2941482903
391 8001846810 8001845381 Bacteria 5804942
392 8054007795 8054002106 Bacteria 7987183
393 8054568899 8054563764 Bacteria 5592885
394 Ga0209371_1010590
395 2214800767
396 ARcpr5oldR_c000002
397 ARSoilYngRDRAFT_c00455
398 ARcpr5yngRDRAFT_c000078
399 ARSoilOldRDRAFT_c000044
400 ARCol0oldRDRAFT_c00421
401 ARCol0yngRDRAFT_1000006
402 JGI24749J21850_1003180
403 JGI25162J39368_1000375
404 JGI25165J46597_1000276
405 JGI26129J50193_1005021
406 Ga0055529_1001068
407 Ga0065165_1000240
408 Ga0065716_1001767
409 Ga0065712_10000525
410 Ga0065715_10000786
411 Ga0065707_10093700
412 Ga0070676_10081060
413 Ga0070676_10138169
414 Ga0070690_100003470
415 Ga0070670_100172555
416 Ga0068869_100173836
417 Ga0068869_100425024
418 Ga0070680_100070455
419 Ga0070660_100006708
420 Ga0070689_100025669
421 Ga0070689_100305600
422 Ga0070691_10044321
423 Ga0070661_100554349
424 Ga0070692_10004117
425 Ga0070668_100056420
426 Ga0070668_100178776
427 Ga0070669_100021880
428 Ga0070669_100036132
429 Ga0070675_100098084
430 Ga0070674_100118747
431 Ga0070674_100204491
432 Ga0070673_100643882
433 Ga0070688_100100690
434 Ga0070659_100078810
435 Ga0070667_100044093
436 Ga0070667_100399663
437 Ga0070703_10012139
438 Ga0070714_100082203
439 Ga0070701_10013239
440 Ga0070700_100054906
441 Ga0070694_100008532
442 Ga0070708_100042049
443 Ga0070708_100143378
444 Ga0070708_100255667
445 Ga0070663_100012889
446 Ga0070663_100072402
447 Ga0070663_100603136
448 Ga0070662_100022982
449 Ga0070662_100023409
450 Ga0070681_10167760
451 Ga0068867_100203490
452 Ga0070685_10042406
453 Ga0070706_100000313
454 Ga0070706_100052017
455 Ga0070707_100009832
456 Ga0070707_100047207
457 Ga0070707_100100734
458 Ga0070707_100288324
459 Ga0070698_100000782
460 Ga0070698_100008388
461 Ga0070698_100011929
462 Ga0070698_100052166
463 Ga0070699_100099490
464 Ga0070699_100120685
465 Ga0070679_100029480
466 Ga0070697_100079918
467 Ga0068853_100016210
468 Ga0068853_100474580
469 Ga0070672_100144174
470 Ga0070686_100005478
471 Ga0070695_100017290
472 Ga0070695_100027246
473 Ga0070696_100035450
474 Ga0070704_100001627
475 Ga0068855_100453529
476 Ga0070664_100040276
477 Ga0068857_100242391
478 Ga0068856_100059292
479 Ga0068856_101006128
480 Ga0068859_100258914
481 Ga0068861_100011543
482 Ga0068861_100323401
483 Ga0068858_100082132
484 Ga0068860_100042317
485 Ga0068860_100525343
486 Ga0068862_100012095
487 Ga0068862_100083712
488 Ga0081455_10098818
489 Ga0081539_10001176
490 Ga0070717_10201502
491 Ga0075365_10014072
492 Ga0075365_10045055
493 Ga0075365_10096837
494 Ga0075365_10185690
495 Ga0075365_10332859
496 Ga0075363_100087910
497 Ga0070716_100062190
498 Ga0070716_100097629
499 Ga0075367_10093670
500 Ga0075367_10227328
501 Ga0075369_10028277
502 Ga0075369_10158376
503 Ga0075366_10276036
504 Ga0075370_10052661
505 Ga0075430_100000325
506 Ga0075430_100490995
507 Ga0075433_10581476
508 Ga0075434_100111015
509 Ga0068865_100087516
510 Ga0075436_100128055
511 Ga0097620_100258907
512 Ga0075435_100186044
513 Ga0105244_10146063
514 Ga0105240_10205142
515 Ga0111539_10000114
516 Ga0111539_10228130
517 Ga0111539_10665567
518 Ga0105245_10143401
519 Ga0105247_10029803
520 Ga0105247_10193275
521 Ga0105243_10013412
522 Ga0105243_10492223
523 Ga0105237_10017286
524 Ga0105237_10539584
525 Ga0105249_10025849
526 Ga0105249_10083027
527 Ga0105239_10030215
528 Ga0105239_10175950
529 Ga0105239_10552085
530 Ga0105246_10015049
531 Ga0105246_10094921
532 Ga0105246_10452612
533 Ga0157373_10319716
534 Ga0157371_10067261
535 Ga0163162_10421639
536 Ga0157375_10145412
537 Ga0157375_10353000
538 Ga0157380_10004799
539 Ga0157380_10466142
540 Ga0157376_10092590
541 Ga0163161_10134081
542 Ga0214544_1000003
543 Ga0214542_1000003
544 Ga0214545_1000004
545 Ga0214543_1000007
546 Ga0209760_102857
547 Ga0209672_105681
548 Ga0209437_100023
549 Ga0209233_1000062
550 Ga0207666_1001868
551 Ga0209455_1000227
552 Ga0209130_1000061
553 Ga0209025_1001266
554 Ga0207426_1015006
555 Ga0207697_10015857
556 Ga0207710_10144699
557 Ga0207688_10010172
558 Ga0207647_10018614
559 Ga0207645_10073391
560 Ga0207645_10143859
561 Ga0207643_10018870
562 Ga0207684_10000077
563 Ga0207684_10145875
564 Ga0207684_10291844
565 Ga0207671_10031226
566 Ga0207693_10043179
567 Ga0207660_10012737
568 Ga0207657_10013896
569 Ga0207652_10054048
570 Ga0207646_10021362
571 Ga0207646_10023295
572 Ga0207646_10044853
573 Ga0207646_10319068
574 Ga0207681_10022351
575 Ga0207681_10426580
576 Ga0207659_10068029
577 Ga0207659_10074459
578 Ga0207687_10138417
579 Ga0207664_10067030
580 Ga0207690_10180127
581 Ga0207706_10010128
582 Ga0207709_10018404
583 Ga0207670_10088142
584 Ga0207704_10347600
585 Ga0207665_10097960
586 Ga0207665_10541806
587 Ga0207691_10155002
588 Ga0207689_10021409
589 Ga0207689_10103202
590 Ga0207689_10411682
591 Ga0207679_10477331
592 Ga0207667_10399777
593 Ga0207712_10036690
594 Ga0207712_10322698
595 Ga0207668_10008224
596 Ga0207668_10025367
597 Ga0207640_10233042
598 Ga0207640_10351961
599 Ga0207658_10029450
600 Ga0207703_10618765
601 Ga0207703_10844188
602 Ga0207639_10052011
603 Ga0207639_10188406
604 Ga0207639_10673688
605 Ga0207678_10148027
606 Ga0207708_10008025
607 Ga0207702_10083355
608 Ga0207702_10681912
609 Ga0207641_10150272
610 Ga0207648_10071023
611 Ga0207675_100009096
612 Ga0207675_100327012
613 Ga0207698_11167030
614 Ga0209968_1007727
615 Ga0209971_1018509
616 Ga0209966_1000408
617 Ga0209998_10002086
618 Ga0209813_10029563
619 Ga0209974_10014912
620 Ga0207428_10000312
621 Ga0268266_10433520
622 Ga0268265_10087609
623 Ga0268265_10223458
624 Ga0268264_10079841
625 Ga0307515_10320988
626 Ga0268256_1010796
627 Ga0265325_10106203
628 Ga0307513_10066569
629 Ga0307408_100052036
630 Ga0307405_10343448
631 Ga0307410_10122174
632 Ga0307406_10041474
633 Ga0307412_10000103
634 Ga0307412_10205231
635 Ga0307416_100786397
636 Ga0307411_10354178
637 Ga0307510_10264168
638 Ga0373930_0000163
639 Ga0373948_0000214
640 Ga0373958_0000109
641 Ga0373959_0000195
642 Ga0373938_0000044
643 Ga0373928_0000075
644 Ga0373940_0000064
645 Ga0373949_0002004
646 Ga0373951_0000281
647 Ga0373952_0000436
648 Ga0373932_0000556
649 Ga0373939_0000729
650 Ga0373941_0001036
651 Ga0373960_0000031
652 Ga0373942_0000621
653 Ga0373961_0000705
654 Ga0373962_0001884
655 Ga0373931_0209027
656 Ga0316584_0020398
657 Ga0400483_163745
658 Ga0436360_0208766
659 Ga0436360_0315955
660 Ga0436361_0221705
661 Ga0436363_1393737
662 Ga0453683_0133417
663 Ga0453684_0259581
664 Ga0466960_0196574
665 Ga0451576_0015043
666 Ga0495638_0010625
667 Ga0495605_0136281
668 Ga0495594_0017972
669 Ga0495596_0156495
670 Ga0495607_0000064
671 Ga0495598_0014537
672 Ga0495656_0020546
673 Ga0495589_0054807
674 Ga0495674_0471574
675 Ga0495677_0095639
676 Ga0496100_0094518
677 Ga0496101_0195247
678 Ga0496102_0007877
679 Ga0496102_0009878
680 Ga0496103_0030002
681 Ga0496103_0034427
682 Ga0496104_0010684
683 Ga0496104_0240306
684 Ga0496104_0537215
685 Ga0496105_0010560
686 Ga0496105_0168899
687 Ga0496106_0004784
688 Ga0496106_0009427
689 Ga0496107_0029402
690 Ga0496107_0068033
691 Ga0496108_0005041
692 Ga0496108_0012254
693 Ga0496109_0009938
694 Ga0496110_0033022
695 Ga0496110_0048177
696 Ga0496110_0338270
697 Ga0496111_0046553
698 Ga0496112_0005332
699 Ga0496112_0010445
700 Ga0496112_0037027
701 Ga0496112_0634020
702 Ga0496113_0058187
703 Ga0496114_0026093
704 Ga0496115_0023154
705 Ga0496115_0549472
706 Ga0496116_0010631
707 Ga0496116_0086060
708 Ga0496116_0103907
709 Ga0496117_0048484
710 Ga0496118_0006462
711 Ga0496118_0012206
712 Ga0496119_0024757
713 Ga0496119_0199041
714 Ga0496120_0022089
715 Ga0496121_0000628
716 Ga0496122_0000497
717 Ga0496122_0091690
718 Ga0496123_0003447
719 Ga0496123_0029646
720 Ga0496124_0059784
721 Ga0496125_0000166
722 Ga0496125_0009105
723 Ga0496125_0027392
724 Ga0496126_0097186
725 Ga0501033_0216389
726 Ga0501033_0246033
727 Ga0501034_0009527
728 Ga0501043_0059119
729 Ga0501047_0061063
730 Ga0501075_0089128
731 Ga0501081_0098271
732 Ga0501035_0006258
733 Ga0501044_0000617
734 Ga0501044_0049464
735 Ga0501045_0156535
736 nmdc:mga00v17_151076_c1
737 nmdc:mga0yw44_185082_c1
738 nmdc:mga06z11_21963_c1
739 nmdc:mga04h51_52354_c1
740 nmdc:mga07m45_7420_c1
741 nmdc:mga0qj67_1988_c1
742 nmdc:mga0qj67_209251_c1
743 nmdc:mga06r32_345113_c1
744 nmdc:mga08y16_15457_c1
745 nmdc:mga0n895_36111_c1
746 nmdc:mga0n895_366970_c1
747 nmdc:mga0n895_407709_c1
748 nmdc:mga08x19_113174_c1
749 nmdc:mga08x19_53710_c1
750 nmdc:mga0a205_155885_c1
751 nmdc:mga0sz30_985_c1
752 Ga0495601_0176667
753 Ga0495655_0005594
754 Ga0500583_0042173
755 Ga0500652_000369
756 Ga0500616_0000046
757 Ga0500616_0000541
758 2501069323
759 2511106551
760 2512036780
761 2599105356
762 2599905934
763 2643859069
764 2643980092
765 2644120560
766 2774874427
767 2809033816
768 2837273618
769 2837274217
770 2842486484
771 2846954962
772 2848858745
773 2857539724
774 2857579264
775 2858954578
776 2858956296
777 2867348444
778 2870724829
779 2883580615
780 2895513617
781 2919680612
782 2939631632
783 2941482903
784 8001846810
785 8054007795
786 8054568899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

211

0.94

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

258

284

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9421 5 233
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9419 1 234
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.94 1 234
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9302 5 233
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9296 5 233
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9399 5 228 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 1 229 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9338 4 244 3.40.50.300
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9323 3 234 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9313 1 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A536RKR8-F1-model_v4 ABC transporter ATP-binding protein 0.9673 123 246 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A257UMR1-F1-model_v4 deleted 0.9429 2 244
AF-A0A2E2NPD1-F1-model_v4 deleted 0.9409 1 244
AF-A0A271M4U6-F1-model_v4 ABC transporter ATP-binding protein 0.9403 4 237 GO:0005524
GO:0016887
AF-A0A094PMW3-F1-model_v4 ABC transporter domain-containing protein 0.9398 2 237 GO:0005524
GO:0016887
GO:0022857
GO:0043190

Map