F432421

General Info

Members Datasets Scaffolds Average Seq Length
392 226 392 85

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0296619|Ga0501034_0296619_529_834
Length 101
Sequence LDRAALQSGFVRAAEKDLAMAHKKGQGSSRNGRDSNGQRRGVKRYAGEQVRAGNILIRQVGTKFHPGRNVGQGSDFTLFALVDGVVAFDQEGRRINVVTAA

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
101 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
152 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.35
Metatranscriptomes 7.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 4.34
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 2.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10102936 3300003320 Bacteria 2139
2 rootH1_10079918 3300003323 Bacteria 1516
3 Ga0058859_11204941 3300004798 Bacteria 668
4 Ga0058859_11623956 3300004798 Bacteria 620
5 Ga0058859_11672503 3300004798 Unclassified 759
6 Ga0058859_11791455 3300004798 Bacteria 569
7 Ga0058863_10085660 3300004799 Bacteria 1157
8 Ga0058861_11874944 3300004800 Bacteria 797
9 Ga0065707_11142609 3300005295 Bacteria 506
10 Ga0070690_100967524 3300005330 Bacteria 669
11 Ga0070666_10263552 3300005335 Unclassified 1222
12 Ga0070680_101704340 3300005336 Bacteria 546
13 Ga0068868_100121642 3300005338 Bacteria 2130
14 Ga0068868_102077069 3300005338 Bacteria 540
15 Ga0070689_100000005 3300005340 Bacteria 396551
16 Ga0070689_100114991 3300005340 Bacteria 2144
17 Ga0070689_100811460 3300005340 Bacteria 823
18 Ga0070689_101282884 3300005340 Bacteria 659
19 Ga0070689_102016270 3300005340 Bacteria 528
20 Ga0070688_100292025 3300005365 Bacteria 1175
21 Ga0070688_100359394 3300005365 Bacteria 1068
22 Ga0070688_100582831 3300005365 Bacteria 854
23 Ga0070688_100982014 3300005365 Bacteria 670
24 Ga0070709_10642255 3300005434 Bacteria 821
25 Ga0070714_100120962 3300005435 Bacteria 2329
26 Ga0070714_100798176 3300005435 Bacteria 914
27 Ga0070701_10642805 3300005438 Bacteria 707
28 Ga0070700_101136980 3300005441 Bacteria 649
29 Ga0070708_101259678 3300005445 Bacteria 691
30 Ga0070663_102165186 3300005455 Bacteria 502
31 Ga0070678_101366324 3300005456 Bacteria 661
32 Ga0068867_100591256 3300005459 Bacteria 967
33 Ga0070685_10519751 3300005466 Bacteria 845
34 Ga0070706_100578557 3300005467 Bacteria 1044
35 Ga0070706_101523231 3300005467 Bacteria 611
36 Ga0070699_100539837 3300005518 Bacteria 1061
37 Ga0070699_100982116 3300005518 Bacteria 774
38 Ga0070684_101075116 3300005535 Bacteria 756
39 Ga0068853_100024241 3300005539 Bacteria 5085
40 Ga0068853_101143611 3300005539 Bacteria 751
41 Ga0070686_100275858 3300005544 Bacteria 1238
42 Ga0070686_100403534 3300005544 Bacteria 1040
43 Ga0070693_100819881 3300005547 Unclassified 691
44 Ga0070665_100017123 3300005548 Bacteria 7271
45 Ga0070665_100365238 3300005548 Bacteria 1450
46 Ga0070704_100936077 3300005549 Bacteria 781
47 Ga0070704_101638337 3300005549 Bacteria 594
48 Ga0068855_100108239 3300005563 Bacteria 3192
49 Ga0068855_100406978 3300005563 Bacteria 1490
50 Ga0068854_100202898 3300005578 Unclassified 1560
51 Ga0068856_100076884 3300005614 Bacteria 3307
52 Ga0070702_101478837 3300005615 Bacteria 558
53 Ga0068859_100002929 3300005617 Bacteria 17332
54 Ga0068859_100944479 3300005617 Bacteria 946
55 Ga0068863_101660545 3300005841 Bacteria 648
56 Ga0068863_101883969 3300005841 Bacteria 608
57 Ga0068858_102558526 3300005842 Bacteria 504
58 Ga0068860_100387910 3300005843 Bacteria 1380
59 Ga0068860_101185262 3300005843 Unclassified 784
60 Ga0068860_102231719 3300005843 Bacteria 568
61 Ga0068862_101913295 3300005844 Bacteria 603
62 Ga0068862_102374152 3300005844 Unclassified 542
63 Ga0081455_10055999 3300005937 Bacteria 3350
64 Ga0070715_10311490 3300006163 Unclassified 846
65 Ga0075428_100046035 3300006844 Bacteria 4793
66 Ga0075428_101010512 3300006844 Bacteria 880
67 Ga0075429_100691931 3300006880 Bacteria 893
68 Ga0097620_100002929 3300006931 Bacteria 17332
69 Ga0097620_100944442 3300006931 Bacteria 946
70 Ga0099795_10205923 3300007788 Unclassified 832
71 Ga0105240_10448143 3300009093 Bacteria 1445
72 Ga0105240_11940751 3300009093 Bacteria 612
73 Ga0105240_12015640 3300009093 Bacteria 600
74 Ga0111539_11329694 3300009094 Bacteria 834
75 Ga0111539_11753501 3300009094 Bacteria 720
76 Ga0111539_12094429 3300009094 Bacteria 656
77 Ga0111539_12381022 3300009094 Bacteria 614
78 Ga0105245_10818916 3300009098 Bacteria 970
79 Ga0105247_10093244 3300009101 Unclassified 1914
80 Ga0114129_10617012 3300009147 Bacteria 1403
81 Ga0105243_10559989 3300009148 Bacteria 1094
82 Ga0105243_12770409 3300009148 Bacteria 531
83 Ga0105241_10680424 3300009174 Unclassified 937
84 Ga0105241_11833570 3300009174 Bacteria 593
85 Ga0105248_12000615 3300009177 Bacteria 658
86 Ga0105237_10153543 3300009545 Bacteria 2299
87 Ga0105238_10013115 3300009551 Bacteria 8363
88 Ga0105238_12718300 3300009551 Bacteria 531
89 Ga0105249_10985868 3300009553 Unclassified 911
90 Ga0105249_11183440 3300009553 Bacteria 835
91 Ga0105239_11235084 3300010375 Bacteria 861
92 Ga0105239_12479458 3300010375 Bacteria 604
93 Ga0105246_12344873 3300011119 Bacteria 522
94 Ga0157370_10458082 3300013104 Bacteria 1172
95 Ga0157374_10131766 3300013296 Bacteria 2420
96 Ga0157378_11263213 3300013297 Bacteria 779
97 Ga0157378_11365836 3300013297 Bacteria 751
98 Ga0157378_11712231 3300013297 Bacteria 676
99 Ga0157378_13194855 3300013297 Bacteria 509
100 Ga0163162_12460270 3300013306 Bacteria 599
101 Ga0157372_11051670 3300013307 Bacteria 942
102 Ga0163163_10812001 3300014325 Bacteria 999
103 Ga0163163_11152681 3300014325 Bacteria 838
104 Ga0163163_12726545 3300014325 Bacteria 551
105 Ga0157379_10703215 3300014968 Bacteria 949
106 Ga0157379_11268452 3300014968 Bacteria 710
107 Ga0157376_12236446 3300014969 Bacteria 586
108 Ga0206356_10982865 3300020070 Bacteria 636
109 Ga0207692_10242949 3300025898 Bacteria 1076
110 Ga0207710_10248862 3300025900 Unclassified 888
111 Ga0207684_10330616 3300025910 Bacteria 1313
112 Ga0207654_10839050 3300025911 Unclassified 665
113 Ga0207707_10776058 3300025912 Bacteria 800
114 Ga0207695_10326858 3300025913 Bacteria 1422
115 Ga0207652_10668674 3300025921 Bacteria 928
116 Ga0207694_10397223 3300025924 Bacteria 1146
117 Ga0207650_11199289 3300025925 Bacteria 646
118 Ga0207687_10161638 3300025927 Bacteria 1719
119 Ga0207687_10607599 3300025927 Bacteria 922
120 Ga0207664_10769855 3300025929 Bacteria 866
121 Ga0207664_11116778 3300025929 Bacteria 704
122 Ga0207709_10569014 3300025935 Bacteria 893
123 Ga0207670_10000004 3300025936 Bacteria 707262
124 Ga0207670_10102134 3300025936 Bacteria 2049
125 Ga0207670_10494089 3300025936 Unclassified 993
126 Ga0207669_10600280 3300025937 Bacteria 895
127 Ga0207689_10183039 3300025942 Bacteria 1728
128 Ga0207667_10081373 3300025949 Bacteria 3355
129 Ga0207667_10366891 3300025949 Bacteria 1468
130 Ga0207667_11568013 3300025949 Bacteria 628
131 Ga0207677_10597240 3300026023 Bacteria 968
132 Ga0207703_11707528 3300026035 Bacteria 605
133 Ga0207703_11980909 3300026035 Unclassified 559
134 Ga0207639_10039200 3300026041 Bacteria 3529
135 Ga0207639_11068101 3300026041 Bacteria 757
136 Ga0207678_10802969 3300026067 Bacteria 831
137 Ga0207678_11469754 3300026067 Bacteria 602
138 Ga0207708_11453967 3300026075 Bacteria 602
139 Ga0207702_10673406 3300026078 Bacteria 1018
140 Ga0207641_11278245 3300026088 Bacteria 734
141 Ga0207641_11478109 3300026088 Bacteria 681
142 Ga0207641_11738718 3300026088 Bacteria 626
143 Ga0207648_10545136 3300026089 Bacteria 1065
144 Ga0207676_10376648 3300026095 Bacteria 1320
145 Ga0207676_10380931 3300026095 Bacteria 1313
146 Ga0207676_11080503 3300026095 Bacteria 793
147 Ga0207674_11741909 3300026116 Bacteria 591
148 Ga0207675_102540729 3300026118 Bacteria 523
149 Ga0207683_10640523 3300026121 Bacteria 984
150 Ga0207698_11026681 3300026142 Bacteria 836
151 Ga0209974_10230298 3300027876 Bacteria 692
152 Ga0268266_10222930 3300028379 Bacteria 1734
153 Ga0268266_10302172 3300028379 Bacteria 1493
154 Ga0268266_12206919 3300028379 Bacteria 523
155 Ga0268265_10792341 3300028380 Unclassified 923
156 Ga0268264_10113260 3300028381 Bacteria 2379
157 Ga0268264_10857568 3300028381 Bacteria 910
158 Ga0268264_11422438 3300028381 Unclassified 704
159 Ga0268264_11426301 3300028381 Bacteria 703
160 Ga0265319_1038824 3300028563 Bacteria 1617
161 Ga0265334_10025088 3300028573 Bacteria 2416
162 Ga0265318_10000074 3300028577 Bacteria 95383
163 Ga0265338_10017547 3300028800 Bacteria 7709
164 Ga0265762_1072594 3300030760 Bacteria 725
165 Ga0265770_1074128 3300030878 Bacteria 655
166 Ga0265760_10011135 3300031090 Bacteria 2570
167 Ga0265330_10000063 3300031235 Bacteria 93489
168 Ga0265332_10000180 3300031238 Bacteria 52220
169 Ga0265332_10026747 3300031238 Bacteria 2529
170 Ga0265332_10034205 3300031238 Bacteria 2210
171 Ga0265328_10001798 3300031239 Bacteria 9785
172 Ga0265328_10016264 3300031239 Bacteria 2898
173 Ga0265320_10000016 3300031240 Bacteria 197556
174 Ga0265320_10003776 3300031240 Bacteria 10075
175 Ga0265325_10008739 3300031241 Bacteria 5957
176 Ga0265325_10033844 3300031241 Bacteria 2723
177 Ga0265329_10001581 3300031242 Bacteria 10906
178 Ga0265329_10008291 3300031242 Bacteria 3949
179 Ga0265339_10000153 3300031249 Bacteria 56918
180 Ga0265339_10003936 3300031249 Bacteria 10269
181 Ga0265339_10018516 3300031249 Bacteria 4102
182 Ga0265339_10066837 3300031249 Bacteria 1924
183 Ga0265331_10000010 3300031250 Bacteria 312076
184 Ga0265331_10014016 3300031250 Bacteria 4284
185 Ga0265316_10006236 3300031344 Bacteria 11430
186 Ga0265316_10132181 3300031344 Bacteria 1879
187 Ga0307408_101027248 3300031548 Bacteria 761
188 Ga0265313_10000077 3300031595 Bacteria 96430
189 Ga0265313_10002231 3300031595 Bacteria 17043
190 Ga0265313_10447983 3300031595 Bacteria 502
191 Ga0265314_10000035 3300031711 Bacteria 240629
192 Ga0265314_10000084 3300031711 Bacteria 143039
193 Ga0265314_10004576 3300031711 Bacteria 12772
194 Ga0265314_10010204 3300031711 Bacteria 7862
195 Ga0265342_10001220 3300031712 Bacteria 24313
196 Ga0265342_10001532 3300031712 Bacteria 21380
197 Ga0265342_10006463 3300031712 Bacteria 8727
198 Ga0265342_10415071 3300031712 Bacteria 694
199 Ga0316576_10012002 3300031727 Bacteria 5705
200 Ga0316576_10118898 3300031727 Unclassified 1984
201 Ga0316576_11257757 3300031727 Bacteria 522
202 Ga0316578_10054771 3300031728 Bacteria 2340
203 Ga0307405_10021094 3300031731 Bacteria 3657
204 Ga0316577_10240282 3300031733 Bacteria 1024
205 Ga0307410_11232783 3300031852 Bacteria 652
206 Ga0307406_10656220 3300031901 Bacteria 871
207 Ga0307407_10319561 3300031903 Bacteria 1089
208 Ga0307412_10056309 3300031911 Bacteria 2620
209 Ga0307409_100800334 3300031995 Bacteria 950
210 Ga0307416_100045752 3300032002 Bacteria 3448
211 Ga0307415_101341272 3300032126 Unclassified 679
212 Ga0316593_10238493 3300032168 Unclassified 678
213 Ga0316593_10294296 3300032168 Bacteria 613
214 Ga0316593_10387335 3300032168 Bacteria 539
215 Ga0316592_1040956 3300033524 Bacteria 1025
216 Ga0316592_1055223 3300033524 Bacteria 889
217 Ga0316592_1058396 3300033524 Bacteria 865
218 Ga0316592_1136503 3300033524 Bacteria 574
219 Ga0316588_1055986 3300033528 Bacteria 959
220 Ga0316588_1056369 3300033528 Bacteria 956
221 Ga0316588_1070350 3300033528 Bacteria 859
222 Ga0316596_1027792 3300033541 Bacteria 1461
223 Ga0316596_1060690 3300033541 Bacteria 1008
224 Ga0316596_1092650 3300033541 Bacteria 815
225 Ga0316596_1146720 3300033541 Bacteria 647
226 Ga0373950_0000020 3300034818 Bacteria 209621
227 Ga0373950_0000128 3300034818 Bacteria 13063
228 Ga0373934_0025846 3300035086 Bacteria 2276
229 Ga0373923_0563886 3300035111 Bacteria 559
230 Ga0373956_0613044 3300035119 Bacteria 519
231 Ga0373957_0087965 3300035120 Bacteria 1232
232 Ga0373946_0258766 3300035171 Bacteria 851
233 Ga0373955_0046687 3300035172 Bacteria 2342
234 Ga0373942_0161089 3300035207 Bacteria 726
235 Ga0316574_0437895 3300035398 Bacteria 820
236 Ga0373935_0814468 3300035692 Bacteria 690
237 Ga0373933_0000141 3300035724 Bacteria 46355
238 Ga0373933_0806444 3300035724 Unclassified 618
239 Ga0373947_0204596 3300035725 Bacteria 1293
240 Ga0373937_0000498 3300036401 Bacteria 35874
241 Ga0373937_0394243 3300036401 Bacteria 1313
242 Ga0373937_1695610 3300036401 Bacteria 579
243 Ga0316582_0139508 3300036647 Bacteria 1634
244 Ga0316584_0008743 3300036712 Bacteria 6992
245 Ga0316584_0261107 3300036712 Bacteria 1263
246 Ga0373925_0036721 3300037068 Bacteria 3615
247 Ga0373925_0174415 3300037068 Bacteria 1699
248 Ga0316581_0188815 3300037588 Bacteria 635
249 Ga0400484_23470 3300038725 Bacteria 10535
250 Ga0436363_0720636 3300039450 Bacteria 682
251 Ga0451798_0100265 3300041458 Unclassified 631
252 Ga0451802_1940665 3300041460 Bacteria 2650
253 Ga0451807_1204744 3300041486 Unclassified 778
254 Ga0451807_1316249 3300041486 Bacteria 756
255 Ga0451837_0124846 3300041494 Bacteria 503
256 Ga0451853_0846047 3300041512 Bacteria 504
257 Ga0451853_2163999 3300041512 Bacteria 513
258 Ga0453684_0402397 3300044712 Bacteria 1533
259 Ga0451576_0693197 3300045051 Bacteria 1070
260 Ga0451576_1977548 3300045051 Bacteria 601
261 Ga0495638_0375064 3300046460 Bacteria 745
262 Ga0495641_0105221 3300046461 Unclassified 1259
263 Ga0495651_0316783 3300046462 Bacteria 1041
264 Ga0495582_0885556 3300046473 Bacteria 516
265 Ga0495618_0462972 3300046514 Bacteria 768
266 Ga0495630_0861176 3300046517 Bacteria 691
267 Ga0495632_0320208 3300046519 Bacteria 685
268 Ga0495586_0035505 3300046535 Bacteria 2679
269 Ga0495667_0374150 3300046559 Bacteria 899
270 Ga0495634_0375236 3300046642 Bacteria 848
271 Ga0495624_0838305 3300046690 Bacteria 543
272 Ga0495674_1012516 3300047319 Bacteria 636
273 Ga0495675_0840572 3300047444 Bacteria 506
274 Ga0495602_0324351 3300048088 Unclassified 1119
275 Ga0495602_0835668 3300048088 Bacteria 616
276 Ga0496104_0242469 3300048907 Bacteria 1715
277 Ga0496104_0523162 3300048907 Bacteria 1097
278 Ga0496104_0552924 3300048907 Bacteria 1062
279 Ga0496105_0165808 3300048908 Bacteria 1813
280 Ga0496106_1082814 3300048909 Bacteria 628
281 Ga0496107_0648104 3300048910 Bacteria 779
282 Ga0496108_0802954 3300048911 Bacteria 812
283 Ga0496112_0667754 3300048915 Bacteria 968
284 Ga0496112_1531465 3300048915 Unclassified 580
285 Ga0496112_1694268 3300048915 Unclassified 545
286 Ga0496114_0177657 3300048917 Bacteria 1858
287 Ga0496114_1209743 3300048917 Bacteria 642
288 Ga0496115_0296092 3300048918 Bacteria 1326
289 Ga0501032_0059300 3300049569 Bacteria 2569
290 Ga0501032_0520132 3300049569 Bacteria 760
291 Ga0501034_0000026 3300049571 Bacteria 261125
292 Ga0501034_0296619 3300049571 Bacteria 1554
293 Ga0501036_0540157 3300049572 Bacteria 969
294 Ga0501036_1464247 3300049572 Bacteria 553
295 Ga0501038_0149911 3300049574 Bacteria 1902
296 Ga0501038_0836673 3300049574 Bacteria 682
297 Ga0501040_0556135 3300049576 Bacteria 828
298 Ga0501040_1116887 3300049576 Bacteria 572
299 Ga0501041_0271327 3300049577 Bacteria 1067
300 Ga0501042_0214669 3300049578 Bacteria 1388
301 Ga0501043_0002704 3300049579 Bacteria 14860
302 Ga0501043_0149457 3300049579 Bacteria 1828
303 Ga0501043_0497792 3300049579 Bacteria 911
304 Ga0501046_0000134 3300049580 Bacteria 79109
305 Ga0501046_0021165 3300049580 Bacteria 5370
306 Ga0501047_0000017 3300049581 Bacteria 276932
307 Ga0501047_0011167 3300049581 Bacteria 8501
308 Ga0501048_0025231 3300049582 Bacteria 4332
309 Ga0501067_0001369 3300049583 Bacteria 13193
310 Ga0501067_0014626 3300049583 Bacteria 4345
311 Ga0501067_0095679 3300049583 Bacteria 1649
312 Ga0501067_0478520 3300049583 Bacteria 696
313 Ga0501067_0786791 3300049583 Bacteria 536
314 Ga0501068_0025441 3300049584 Bacteria 3481
315 Ga0501068_0412523 3300049584 Bacteria 871
316 Ga0501069_0047353 3300049585 Bacteria 2386
317 Ga0501069_0053976 3300049585 Bacteria 2238
318 Ga0501069_0989335 3300049585 Bacteria 513
319 Ga0501070_0000028 3300049586 Bacteria 140133
320 Ga0501070_0000859 3300049586 Bacteria 27615
321 Ga0501070_0005593 3300049586 Bacteria 10720
322 Ga0501070_0736966 3300049586 Bacteria 777
323 Ga0501072_0014084 3300049588 Bacteria 6128
324 Ga0501072_0743152 3300049588 Bacteria 770
325 Ga0501072_1104655 3300049588 Bacteria 617
326 Ga0501073_0000431 3300049589 Bacteria 28778
327 Ga0501073_0000744 3300049589 Bacteria 23059
328 Ga0501073_0001807 3300049589 Bacteria 15917
329 Ga0501073_0054860 3300049589 Bacteria 2789
330 Ga0501073_0057374 3300049589 Bacteria 2722
331 Ga0501074_0003988 3300049590 Bacteria 10523
332 Ga0501074_0139546 3300049590 Bacteria 1734
333 Ga0501074_0486054 3300049590 Bacteria 875
334 Ga0501075_0238667 3300049591 Bacteria 1386
335 Ga0501076_0584970 3300049592 Bacteria 921
336 Ga0501076_0786912 3300049592 Bacteria 785
337 Ga0501076_1376572 3300049592 Bacteria 580
338 Ga0501077_0674242 3300049593 Bacteria 664
339 Ga0501079_0000023 3300049741 Bacteria 63622
340 Ga0501079_0152977 3300049741 Bacteria 1798
341 Ga0501079_0780814 3300049741 Bacteria 752
342 Ga0501079_1176707 3300049741 Unclassified 604
343 Ga0501080_0017594 3300049742 Bacteria 6609
344 Ga0501080_0021590 3300049742 Bacteria 5959
345 Ga0501080_0106072 3300049742 Bacteria 2604
346 Ga0501080_0184103 3300049742 Bacteria 1921
347 Ga0501080_0329892 3300049742 Bacteria 1380
348 Ga0501080_0524527 3300049742 Bacteria 1057
349 Ga0501080_0857527 3300049742 Bacteria 794
350 Ga0501080_0947757 3300049742 Bacteria 748
351 Ga0501080_1299312 3300049742 Bacteria 623
352 Ga0501080_1665828 3300049742 Bacteria 539
353 Ga0501080_1856247 3300049742 Unclassified 505
354 Ga0501081_0067592 3300049743 Bacteria 2488
355 Ga0501081_0478472 3300049743 Bacteria 927
356 Ga0501081_1287923 3300049743 Bacteria 554
357 Ga0501083_0001187 3300049744 Bacteria 17592
358 Ga0501083_0008005 3300049744 Bacteria 7486
359 Ga0501083_0452570 3300049744 Bacteria 835
360 Ga0501083_0529207 3300049744 Bacteria 767
361 Ga0501083_1069163 3300049744 Bacteria 525
362 Ga0501035_0676097 3300049822 Bacteria 835
363 Ga0501035_0721059 3300049822 Bacteria 803
364 Ga0501044_0449838 3300049823 Bacteria 1195
365 Ga0501044_0526543 3300049823 Bacteria 1081
366 Ga0501044_0934407 3300049823 Bacteria 741
367 Ga0501045_0787764 3300049824 Bacteria 700
368 Ga0501045_0810817 3300049824 Unclassified 689
369 nmdc:mga06z11_854524_c1 3300050494 Bacteria 554
370 nmdc:mga09592_1056414_c1 3300050508 Bacteria 677
371 nmdc:mga08y16_1633395_c1 3300050511 Bacteria 601
372 nmdc:mga08y16_1968039_c1 3300050511 Unclassified 534
373 nmdc:mga08y16_81872_c1 3300050511 Bacteria 3365
374 Ga0495601_0300805 3300053077 Bacteria 1045
375 Ga0495601_0612437 3300053077 Unclassified 698
376 Ga0495595_0141878 3300053084 Bacteria 1179
377 Ga0495619_0053757 3300053085 Bacteria 2665
378 Ga0500641_0378897 3300053096 Bacteria 561
379 Ga0501084_0000003 3300054114 Bacteria 267909
380 Ga0501084_0288377 3300054114 Unclassified 1386
381 Ga0501084_1637953 3300054114 Unclassified 538
382 Ga0587085_139526 3300059506 Bacteria 549
383 Ga0587089_113704 3300059509 Bacteria 502
384 Ga0587092_162916 3300059512 Bacteria 506
385 Ga0587109_118849 3300059624 Unclassified 626
386 Ga0587068_091512 3300059641 Bacteria 628
387 Ga0587111_0118222 3300060346 Bacteria 680
388 Ga0501082_0000753 3300060353 Bacteria 28439
389 Ga0501082_0232719 3300060353 Unclassified 1604
390 Ga0501082_0588487 3300060353 Bacteria 973
391 Ga0530510_0126350 3300061734 Bacteria 1880
392 Ga0530510_0994603 3300061734 Bacteria 642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_11833570 Ga0105241_118335701 81
2 3300010375 Ga0105239_11235084 Ga0105239_112350842 81
3 3300011119 Ga0105246_12344873 Ga0105246_123448731 81
4 3300014325 Ga0163163_11152681 Ga0163163_111526812 81
5 3300053077 Ga0495601_0300805 Ga0495601_0300805_38_283 81
6 3300053096 Ga0500641_0378897 Ga0500641_0378897_64_309 81
7 3300004798 Ga0058859_11623956 Ga0058859_116239562 82
8 3300004798 Ga0058859_11672503 Ga0058859_116725031 82
9 3300004799 Ga0058863_10085660 Ga0058863_100856601 82
10 3300004800 Ga0058861_11874944 Ga0058861_118749442 82
11 3300005336 Ga0070680_101704340 Ga0070680_1017043402 82
12 3300005340 Ga0070689_100114991 Ga0070689_1001149912 82
13 3300005340 Ga0070689_102016270 Ga0070689_1020162702 82
14 3300005365 Ga0070688_100982014 Ga0070688_1009820142 82
15 3300005435 Ga0070714_100120962 Ga0070714_1001209622 82
16 3300005435 Ga0070714_100798176 Ga0070714_1007981762 82
17 3300005438 Ga0070701_10642805 Ga0070701_106428052 82
18 3300005466 Ga0070685_10519751 Ga0070685_105197511 82
19 3300005467 Ga0070706_101523231 Ga0070706_1015232312 82
20 3300005563 Ga0068855_100406978 Ga0068855_1004069782 82
21 3300005615 Ga0070702_101478837 Ga0070702_1014788372 82
22 3300005617 Ga0068859_100944479 Ga0068859_1009444792 82
23 3300005841 Ga0068863_101883969 Ga0068863_1018839692 82
24 3300005842 Ga0068858_102558526 Ga0068858_1025585262 82
25 3300005844 Ga0068862_102374152 Ga0068862_1023741521 82
26 3300006931 Ga0097620_100944442 Ga0097620_1009444422 82
27 3300009093 Ga0105240_12015640 Ga0105240_120156401 82
28 3300009094 Ga0111539_12381022 Ga0111539_123810222 82
29 3300009147 Ga0114129_10617012 Ga0114129_106170122 82
30 3300013104 Ga0157370_10458082 Ga0157370_104580822 82
31 3300025910 Ga0207684_10330616 Ga0207684_103306163 82
32 3300025912 Ga0207707_10776058 Ga0207707_107760582 82
33 3300025925 Ga0207650_11199289 Ga0207650_111992891 82
34 3300025929 Ga0207664_10769855 Ga0207664_107698552 82
35 3300025936 Ga0207670_10102134 Ga0207670_101021342 82
36 3300025936 Ga0207670_10494089 Ga0207670_104940892 82
37 3300025942 Ga0207689_10183039 Ga0207689_101830394 82
38 3300025949 Ga0207667_10366891 Ga0207667_103668912 82
39 3300026035 Ga0207703_11980909 Ga0207703_119809092 82
40 3300026095 Ga0207676_10376648 Ga0207676_103766482 82
41 3300028379 Ga0268266_12206919 Ga0268266_122069191 82
42 3300028380 Ga0268265_10792341 Ga0268265_107923412 82
43 3300028381 Ga0268264_10857568 Ga0268264_108575682 82
44 3300031238 Ga0265332_10026747 Ga0265332_100267473 82
45 3300031241 Ga0265325_10008739 Ga0265325_100087392 82
46 3300031241 Ga0265325_10033844 Ga0265325_100338443 82
47 3300031249 Ga0265339_10000153 Ga0265339_1000015338 82
48 3300031250 Ga0265331_10014016 Ga0265331_100140165 82
49 3300031595 Ga0265313_10000077 Ga0265313_1000007771 82
50 3300031711 Ga0265314_10000084 Ga0265314_1000008470 82
51 3300031712 Ga0265342_10006463 Ga0265342_100064636 82
52 3300037068 Ga0373925_0036721 Ga0373925_0036721_1930_2178 82
53 3300048915 Ga0496112_1531465 Ga0496112_1531465_114_362 82
54 3300049571 Ga0501034_0296619 Ga0501034_0296619_529_834 82
55 3300049579 Ga0501043_0149457 Ga0501043_0149457_187_492 82
56 3300049580 Ga0501046_0021165 Ga0501046_0021165_4484_4789 82
57 3300049581 Ga0501047_0011167 Ga0501047_0011167_3720_4025 82
58 3300049586 Ga0501070_0005593 Ga0501070_0005593_843_1148 82
59 3300049588 Ga0501072_1104655 Ga0501072_1104655_238_486 82
60 3300049742 Ga0501080_0947757 Ga0501080_0947757_351_656 82
61 3300049823 Ga0501044_0449838 Ga0501044_0449838_68_316 82
62 3300050511 nmdc:mga08y16_81872_c1 nmdc:mga08y16_81872_c1_1033_1281 82
63 3300059512 Ga0587092_162916 Ga0587092_162916_50_298 82
64 3300005295 Ga0065707_11142609 Ga0065707_111426091 83
65 3300005330 Ga0070690_100967524 Ga0070690_1009675241 83
66 3300005338 Ga0068868_102077069 Ga0068868_1020770692 83
67 3300005365 Ga0070688_100582831 Ga0070688_1005828312 83
68 3300005445 Ga0070708_101259678 Ga0070708_1012596781 83
69 3300005455 Ga0070663_102165186 Ga0070663_1021651861 83
70 3300005456 Ga0070678_101366324 Ga0070678_1013663242 83
71 3300005518 Ga0070699_100539837 Ga0070699_1005398371 83
72 3300005549 Ga0070704_100936077 Ga0070704_1009360772 83
73 3300005549 Ga0070704_101638337 Ga0070704_1016383371 83
74 3300005841 Ga0068863_101660545 Ga0068863_1016605452 83
75 3300005843 Ga0068860_102231719 Ga0068860_1022317192 83
76 3300005844 Ga0068862_101913295 Ga0068862_1019132952 83
77 3300006880 Ga0075429_100691931 Ga0075429_1006919312 83
78 3300009093 Ga0105240_11940751 Ga0105240_119407511 83
79 3300009094 Ga0111539_11329694 Ga0111539_113296942 83
80 3300009094 Ga0111539_11753501 Ga0111539_117535012 83
81 3300009094 Ga0111539_12094429 Ga0111539_120944292 83
82 3300009098 Ga0105245_10818916 Ga0105245_108189163 83
83 3300009148 Ga0105243_10559989 Ga0105243_105599892 83
84 3300009177 Ga0105248_12000615 Ga0105248_120006152 83
85 3300009551 Ga0105238_12718300 Ga0105238_127183001 83
86 3300009553 Ga0105249_11183440 Ga0105249_111834402 83
87 3300013297 Ga0157378_11263213 Ga0157378_112632131 83
88 3300013297 Ga0157378_13194855 Ga0157378_131948552 83
89 3300013306 Ga0163162_12460270 Ga0163162_124602701 83
90 3300014325 Ga0163163_10812001 Ga0163163_108120012 83
91 3300014325 Ga0163163_12726545 Ga0163163_127265451 83
92 3300014968 Ga0157379_10703215 Ga0157379_107032151 83
93 3300014968 Ga0157379_11268452 Ga0157379_112684521 83
94 3300014969 Ga0157376_12236446 Ga0157376_122364462 83
95 3300025898 Ga0207692_10242949 Ga0207692_102429491 83
96 3300025927 Ga0207687_10607599 Ga0207687_106075992 83
97 3300025935 Ga0207709_10569014 Ga0207709_105690142 83
98 3300026035 Ga0207703_11707528 Ga0207703_117075282 83
99 3300026067 Ga0207678_10802969 Ga0207678_108029692 83
100 3300026067 Ga0207678_11469754 Ga0207678_114697541 83
101 3300026088 Ga0207641_11478109 Ga0207641_114781091 83
102 3300026088 Ga0207641_11738718 Ga0207641_117387181 83
103 3300026121 Ga0207683_10640523 Ga0207683_106405232 83
104 3300026142 Ga0207698_11026681 Ga0207698_110266812 83
105 3300027876 Ga0209974_10230298 Ga0209974_102302981 83
106 3300028381 Ga0268264_11426301 Ga0268264_114263012 83
107 3300030760 Ga0265762_1072594 Ga0265762_10725942 83
108 3300030878 Ga0265770_1074128 Ga0265770_10741281 83
109 3300031090 Ga0265760_10011135 Ga0265760_100111351 83
110 3300031727 Ga0316576_10012002 Ga0316576_100120021 83
111 3300031727 Ga0316576_10118898 Ga0316576_101188982 83
112 3300031727 Ga0316576_11257757 Ga0316576_112577572 83
113 3300031728 Ga0316578_10054771 Ga0316578_100547712 83
114 3300031733 Ga0316577_10240282 Ga0316577_102402822 83
115 3300031903 Ga0307407_10319561 Ga0307407_103195612 83
116 3300031995 Ga0307409_100800334 Ga0307409_1008003343 83
117 3300032168 Ga0316593_10238493 Ga0316593_102384931 83
118 3300032168 Ga0316593_10387335 Ga0316593_103873352 83
119 3300033524 Ga0316592_1040956 Ga0316592_10409562 83
120 3300033524 Ga0316592_1055223 Ga0316592_10552232 83
121 3300033524 Ga0316592_1058396 Ga0316592_10583962 83
122 3300033524 Ga0316592_1136503 Ga0316592_11365032 83
123 3300033528 Ga0316588_1055986 Ga0316588_10559862 83
124 3300033528 Ga0316588_1056369 Ga0316588_10563692 83
125 3300033528 Ga0316588_1070350 Ga0316588_10703502 83
126 3300033541 Ga0316596_1027792 Ga0316596_10277922 83
127 3300033541 Ga0316596_1060690 Ga0316596_10606902 83
128 3300033541 Ga0316596_1146720 Ga0316596_11467201 83
129 3300035398 Ga0316574_0437895 Ga0316574_0437895_54_308 83
130 3300035724 Ga0373933_0806444 Ga0373933_0806444_209_460 83
131 3300036401 Ga0373937_0394243 Ga0373937_0394243_990_1247 83
132 3300036401 Ga0373937_1695610 Ga0373937_1695610_172_423 83
133 3300036712 Ga0316584_0008743 Ga0316584_0008743_1850_2104 83
134 3300036712 Ga0316584_0261107 Ga0316584_0261107_49_303 83
135 3300037588 Ga0316581_0188815 Ga0316581_0188815_11_265 83
136 3300038725 Ga0400484_23470 Ga0400484_23470_4263_4517 83
137 3300039450 Ga0436363_0720636 Ga0436363_0720636_401_655 83
138 3300041486 Ga0451807_1316249 Ga0451807_1316249_349_600 83
139 3300041512 Ga0451853_0846047 Ga0451853_0846047_186_437 83
140 3300046473 Ga0495582_0885556 Ga0495582_0885556_250_501 83
141 3300046517 Ga0495630_0861176 Ga0495630_0861176_122_373 83
142 3300047319 Ga0495674_1012516 Ga0495674_1012516_358_609 83
143 3300047444 Ga0495675_0840572 Ga0495675_0840572_17_268 83
144 3300048907 Ga0496104_0242469 Ga0496104_0242469_120_371 83
145 3300048907 Ga0496104_0523162 Ga0496104_0523162_518_772 83
146 3300048907 Ga0496104_0552924 Ga0496104_0552924_322_573 83
147 3300048908 Ga0496105_0165808 Ga0496105_0165808_1091_1342 83
148 3300048909 Ga0496106_1082814 Ga0496106_1082814_16_270 83
149 3300048910 Ga0496107_0648104 Ga0496107_0648104_42_296 83
150 3300048911 Ga0496108_0802954 Ga0496108_0802954_150_401 83
151 3300048917 Ga0496114_0177657 Ga0496114_0177657_1360_1614 83
152 3300048917 Ga0496114_1209743 Ga0496114_1209743_155_406 83
153 3300048918 Ga0496115_0296092 Ga0496115_0296092_969_1220 83
154 3300049569 Ga0501032_0520132 Ga0501032_0520132_73_324 83
155 3300049572 Ga0501036_0540157 Ga0501036_0540157_501_752 83
156 3300049572 Ga0501036_1464247 Ga0501036_1464247_88_339 83
157 3300049574 Ga0501038_0836673 Ga0501038_0836673_148_399 83
158 3300049576 Ga0501040_0556135 Ga0501040_0556135_561_812 83
159 3300049577 Ga0501041_0271327 Ga0501041_0271327_716_967 83
160 3300049591 Ga0501075_0238667 Ga0501075_0238667_864_1115 83
161 3300049592 Ga0501076_1376572 Ga0501076_1376572_32_283 83
162 3300049593 Ga0501077_0674242 Ga0501077_0674242_93_344 83
163 3300049741 Ga0501079_0780814 Ga0501079_0780814_204_455 83
164 3300049741 Ga0501079_1176707 Ga0501079_1176707_180_431 83
165 3300049742 Ga0501080_0524527 Ga0501080_0524527_251_502 83
166 3300049742 Ga0501080_1665828 Ga0501080_1665828_67_318 83
167 3300049743 Ga0501081_1287923 Ga0501081_1287923_12_263 83
168 3300049744 Ga0501083_0529207 Ga0501083_0529207_114_365 83
169 3300049822 Ga0501035_0676097 Ga0501035_0676097_291_542 83
170 3300049822 Ga0501035_0721059 Ga0501035_0721059_118_369 83
171 3300049823 Ga0501044_0934407 Ga0501044_0934407_474_725 83
172 3300049824 Ga0501045_0787764 Ga0501045_0787764_113_364 83
173 3300050511 nmdc:mga08y16_1633395_c1 nmdc:mga08y16_1633395_c1_221_472 83
174 3300050511 nmdc:mga08y16_1968039_c1 nmdc:mga08y16_1968039_c1_256_507 83
175 3300053077 Ga0495601_0612437 Ga0495601_0612437_345_596 83
176 3300053084 Ga0495595_0141878 Ga0495595_0141878_145_396 83
177 3300053085 Ga0495619_0053757 Ga0495619_0053757_1359_1610 83
178 3300054114 Ga0501084_1637953 Ga0501084_1637953_72_323 83
179 3300060353 Ga0501082_0232719 Ga0501082_0232719_936_1187 83
180 3300061734 Ga0530510_0994603 Ga0530510_0994603_242_493 83
181 3300004798 Ga0058859_11204941 Ga0058859_112049412 84
182 3300005335 Ga0070666_10263552 Ga0070666_102635523 84
183 3300005338 Ga0068868_100121642 Ga0068868_1001216422 84
184 3300005340 Ga0070689_100000005 Ga0070689_100000005107 84
185 3300005340 Ga0070689_100811460 Ga0070689_1008114602 84
186 3300005365 Ga0070688_100292025 Ga0070688_1002920252 84
187 3300005365 Ga0070688_100359394 Ga0070688_1003593941 84
188 3300005441 Ga0070700_101136980 Ga0070700_1011369802 84
189 3300005459 Ga0068867_100591256 Ga0068867_1005912562 84
190 3300005467 Ga0070706_100578557 Ga0070706_1005785572 84
191 3300005518 Ga0070699_100982116 Ga0070699_1009821162 84
192 3300005539 Ga0068853_100024241 Ga0068853_1000242414 84
193 3300005539 Ga0068853_101143611 Ga0068853_1011436111 84
194 3300005544 Ga0070686_100275858 Ga0070686_1002758583 84
195 3300005544 Ga0070686_100403534 Ga0070686_1004035342 84
196 3300005547 Ga0070693_100819881 Ga0070693_1008198812 84
197 3300005548 Ga0070665_100365238 Ga0070665_1003652383 84
198 3300005563 Ga0068855_100108239 Ga0068855_1001082392 84
199 3300005578 Ga0068854_100202898 Ga0068854_1002028983 84
200 3300005614 Ga0068856_100076884 Ga0068856_1000768844 84
201 3300005617 Ga0068859_100002929 Ga0068859_1000029293 84
202 3300005843 Ga0068860_100387910 Ga0068860_1003879103 84
203 3300005937 Ga0081455_10055999 Ga0081455_100559993 84
204 3300006163 Ga0070715_10311490 Ga0070715_103114902 84
205 3300006844 Ga0075428_100046035 Ga0075428_1000460355 84
206 3300006931 Ga0097620_100002929 Ga0097620_1000029293 84
207 3300009101 Ga0105247_10093244 Ga0105247_100932443 84
208 3300009148 Ga0105243_12770409 Ga0105243_127704091 84
209 3300009174 Ga0105241_10680424 Ga0105241_106804241 84
210 3300009551 Ga0105238_10013115 Ga0105238_100131155 84
211 3300010375 Ga0105239_12479458 Ga0105239_124794582 84
212 3300013307 Ga0157372_11051670 Ga0157372_110516702 84
213 3300025900 Ga0207710_10248862 Ga0207710_102488622 84
214 3300025911 Ga0207654_10839050 Ga0207654_108390501 84
215 3300025921 Ga0207652_10668674 Ga0207652_106686742 84
216 3300025924 Ga0207694_10397223 Ga0207694_103972232 84
217 3300025936 Ga0207670_10000004 Ga0207670_10000004353 84
218 3300025937 Ga0207669_10600280 Ga0207669_106002802 84
219 3300025949 Ga0207667_10081373 Ga0207667_100813733 84
220 3300025949 Ga0207667_11568013 Ga0207667_115680132 84
221 3300026023 Ga0207677_10597240 Ga0207677_105972402 84
222 3300026041 Ga0207639_10039200 Ga0207639_100392002 84
223 3300026041 Ga0207639_11068101 Ga0207639_110681011 84
224 3300026075 Ga0207708_11453967 Ga0207708_114539671 84
225 3300026078 Ga0207702_10673406 Ga0207702_106734062 84
226 3300026088 Ga0207641_11278245 Ga0207641_112782452 84
227 3300026089 Ga0207648_10545136 Ga0207648_105451362 84
228 3300026095 Ga0207676_10380931 Ga0207676_103809312 84
229 3300026095 Ga0207676_11080503 Ga0207676_110805032 84
230 3300026116 Ga0207674_11741909 Ga0207674_117419092 84
231 3300028379 Ga0268266_10302172 Ga0268266_103021722 84
232 3300028381 Ga0268264_10113260 Ga0268264_101132603 84
233 3300041458 Ga0451798_0100265 Ga0451798_0100265_216_470 84
234 3300041460 Ga0451802_1940665 Ga0451802_1940665_897_1151 84
235 3300041486 Ga0451807_1204744 Ga0451807_1204744_61_315 84
236 3300046462 Ga0495651_0316783 Ga0495651_0316783_490_744 84
237 3300048088 Ga0495602_0324351 Ga0495602_0324351_97_351 84
238 3300048915 Ga0496112_1694268 Ga0496112_1694268_220_474 84
239 3300049583 Ga0501067_0786791 Ga0501067_0786791_71_325 84
240 3300050508 nmdc:mga09592_1056414_c1 nmdc:mga09592_1056414_c1_412_666 84
241 3300059509 Ga0587089_113704 Ga0587089_113704_206_460 84
242 3300059624 Ga0587109_118849 Ga0587109_118849_284_538 84
243 3300060346 Ga0587111_0118222 Ga0587111_0118222_336_590 84
244 3300003320 rootH2_10102936 rootH2_101029363 85
245 3300003323 rootH1_10079918 rootH1_100799183 85
246 3300004798 Ga0058859_11791455 Ga0058859_117914551 85
247 3300005340 Ga0070689_101282884 Ga0070689_1012828842 85
248 3300005434 Ga0070709_10642255 Ga0070709_106422552 85
249 3300005535 Ga0070684_101075116 Ga0070684_1010751161 85
250 3300005548 Ga0070665_100017123 Ga0070665_1000171234 85
251 3300005843 Ga0068860_101185262 Ga0068860_1011852622 85
252 3300006844 Ga0075428_101010512 Ga0075428_1010105122 85
253 3300007788 Ga0099795_10205923 Ga0099795_102059232 85
254 3300009093 Ga0105240_10448143 Ga0105240_104481433 85
255 3300009545 Ga0105237_10153543 Ga0105237_101535432 85
256 3300009553 Ga0105249_10985868 Ga0105249_109858681 85
257 3300013296 Ga0157374_10131766 Ga0157374_101317663 85
258 3300013297 Ga0157378_11365836 Ga0157378_113658362 85
259 3300013297 Ga0157378_11712231 Ga0157378_117122311 85
260 3300020070 Ga0206356_10982865 Ga0206356_109828652 85
261 3300025913 Ga0207695_10326858 Ga0207695_103268582 85
262 3300025927 Ga0207687_10161638 Ga0207687_101616382 85
263 3300025929 Ga0207664_11116778 Ga0207664_111167782 85
264 3300026118 Ga0207675_102540729 Ga0207675_1025407292 85
265 3300028379 Ga0268266_10222930 Ga0268266_102229302 85
266 3300028381 Ga0268264_11422438 Ga0268264_114224382 85
267 3300028563 Ga0265319_1038824 Ga0265319_10388241 85
268 3300028573 Ga0265334_10025088 Ga0265334_100250882 85
269 3300028577 Ga0265318_10000074 Ga0265318_100000748 85
270 3300028800 Ga0265338_10017547 Ga0265338_100175474 85
271 3300031235 Ga0265330_10000063 Ga0265330_100000637 85
272 3300031238 Ga0265332_10000180 Ga0265332_100001804 85
273 3300031238 Ga0265332_10034205 Ga0265332_100342054 85
274 3300031239 Ga0265328_10001798 Ga0265328_100017983 85
275 3300031239 Ga0265328_10016264 Ga0265328_100162644 85
276 3300031240 Ga0265320_10000016 Ga0265320_10000016139 85
277 3300031240 Ga0265320_10003776 Ga0265320_100037765 85
278 3300031242 Ga0265329_10001581 Ga0265329_100015812 85
279 3300031242 Ga0265329_10008291 Ga0265329_100082914 85
280 3300031249 Ga0265339_10003936 Ga0265339_100039365 85
281 3300031249 Ga0265339_10018516 Ga0265339_100185162 85
282 3300031249 Ga0265339_10066837 Ga0265339_100668373 85
283 3300031250 Ga0265331_10000010 Ga0265331_10000010139 85
284 3300031344 Ga0265316_10006236 Ga0265316_100062365 85
285 3300031344 Ga0265316_10132181 Ga0265316_101321812 85
286 3300031548 Ga0307408_101027248 Ga0307408_1010272481 85
287 3300031595 Ga0265313_10002231 Ga0265313_100022312 85
288 3300031595 Ga0265313_10447983 Ga0265313_104479831 85
289 3300031711 Ga0265314_10000035 Ga0265314_10000035128 85
290 3300031711 Ga0265314_10004576 Ga0265314_100045767 85
291 3300031711 Ga0265314_10010204 Ga0265314_100102045 85
292 3300031712 Ga0265342_10001220 Ga0265342_1000122021 85
293 3300031712 Ga0265342_10001532 Ga0265342_1000153221 85
294 3300031712 Ga0265342_10415071 Ga0265342_104150712 85
295 3300031731 Ga0307405_10021094 Ga0307405_100210943 85
296 3300031852 Ga0307410_11232783 Ga0307410_112327832 85
297 3300031901 Ga0307406_10656220 Ga0307406_106562202 85
298 3300031911 Ga0307412_10056309 Ga0307412_100563093 85
299 3300032002 Ga0307416_100045752 Ga0307416_1000457522 85
300 3300032126 Ga0307415_101341272 Ga0307415_1013412722 85
301 3300032168 Ga0316593_10294296 Ga0316593_102942962 85
302 3300033541 Ga0316596_1092650 Ga0316596_10926502 85
303 3300034818 Ga0373950_0000020 Ga0373950_0000020_76958_77224 85
304 3300034818 Ga0373950_0000128 Ga0373950_0000128_6999_7265 85
305 3300035086 Ga0373934_0025846 Ga0373934_0025846_1083_1352 85
306 3300035111 Ga0373923_0563886 Ga0373923_0563886_65_331 85
307 3300035119 Ga0373956_0613044 Ga0373956_0613044_184_453 85
308 3300035120 Ga0373957_0087965 Ga0373957_0087965_290_559 85
309 3300035171 Ga0373946_0258766 Ga0373946_0258766_238_507 85
310 3300035172 Ga0373955_0046687 Ga0373955_0046687_1357_1626 85
311 3300035207 Ga0373942_0161089 Ga0373942_0161089_94_360 85
312 3300035692 Ga0373935_0814468 Ga0373935_0814468_113_382 85
313 3300035724 Ga0373933_0000141 Ga0373933_0000141_9344_9613 85
314 3300035725 Ga0373947_0204596 Ga0373947_0204596_12_284 85
315 3300036401 Ga0373937_0000498 Ga0373937_0000498_4425_4694 85
316 3300036647 Ga0316582_0139508 Ga0316582_0139508_576_836 85
317 3300037068 Ga0373925_0174415 Ga0373925_0174415_584_856 85
318 3300041494 Ga0451837_0124846 Ga0451837_0124846_73_444 85
319 3300041512 Ga0451853_2163999 Ga0451853_2163999_13_270 85
320 3300044712 Ga0453684_0402397 Ga0453684_0402397_435_713 85
321 3300045051 Ga0451576_0693197 Ga0451576_0693197_736_996 85
322 3300045051 Ga0451576_1977548 Ga0451576_1977548_147_419 85
323 3300046460 Ga0495638_0375064 Ga0495638_0375064_215_472 85
324 3300046461 Ga0495641_0105221 Ga0495641_0105221_453_719 85
325 3300046514 Ga0495618_0462972 Ga0495618_0462972_231_500 85
326 3300046519 Ga0495632_0320208 Ga0495632_0320208_172_441 85
327 3300046535 Ga0495586_0035505 Ga0495586_0035505_1917_2195 85
328 3300046559 Ga0495667_0374150 Ga0495667_0374150_207_473 85
329 3300046642 Ga0495634_0375236 Ga0495634_0375236_101_367 85
330 3300046690 Ga0495624_0838305 Ga0495624_0838305_223_489 85
331 3300048088 Ga0495602_0835668 Ga0495602_0835668_28_294 85
332 3300048915 Ga0496112_0667754 Ga0496112_0667754_334_600 85
333 3300049569 Ga0501032_0059300 Ga0501032_0059300_1063_1335 85
334 3300049571 Ga0501034_0000026 Ga0501034_0000026_177856_178122 85
335 3300049574 Ga0501038_0149911 Ga0501038_0149911_774_1040 85
336 3300049576 Ga0501040_1116887 Ga0501040_1116887_218_475 85
337 3300049578 Ga0501042_0214669 Ga0501042_0214669_1115_1372 85
338 3300049579 Ga0501043_0002704 Ga0501043_0002704_13814_14080 85
339 3300049579 Ga0501043_0497792 Ga0501043_0497792_21_293 85
340 3300049580 Ga0501046_0000134 Ga0501046_0000134_25777_26043 85
341 3300049581 Ga0501047_0000017 Ga0501047_0000017_193676_193942 85
342 3300049582 Ga0501048_0025231 Ga0501048_0025231_1419_1685 85
343 3300049583 Ga0501067_0001369 Ga0501067_0001369_4821_5087 85
344 3300049583 Ga0501067_0014626 Ga0501067_0014626_578_835 85
345 3300049583 Ga0501067_0095679 Ga0501067_0095679_864_1130 85
346 3300049583 Ga0501067_0478520 Ga0501067_0478520_123_395 85
347 3300049584 Ga0501068_0025441 Ga0501068_0025441_1242_1514 85
348 3300049584 Ga0501068_0412523 Ga0501068_0412523_124_396 85
349 3300049585 Ga0501069_0047353 Ga0501069_0047353_2022_2288 85
350 3300049585 Ga0501069_0053976 Ga0501069_0053976_263_535 85
351 3300049585 Ga0501069_0989335 Ga0501069_0989335_136_402 85
352 3300049586 Ga0501070_0000028 Ga0501070_0000028_135855_136127 85
353 3300049586 Ga0501070_0000859 Ga0501070_0000859_18659_18925 85
354 3300049586 Ga0501070_0736966 Ga0501070_0736966_89_355 85
355 3300049588 Ga0501072_0014084 Ga0501072_0014084_774_1040 85
356 3300049588 Ga0501072_0743152 Ga0501072_0743152_474_743 85
357 3300049589 Ga0501073_0000431 Ga0501073_0000431_3045_3311 85
358 3300049589 Ga0501073_0000744 Ga0501073_0000744_11926_12204 85
359 3300049589 Ga0501073_0001807 Ga0501073_0001807_11111_11377 85
360 3300049589 Ga0501073_0054860 Ga0501073_0054860_2440_2712 85
361 3300049589 Ga0501073_0057374 Ga0501073_0057374_410_682 85
362 3300049590 Ga0501074_0003988 Ga0501074_0003988_1519_1785 85
363 3300049590 Ga0501074_0139546 Ga0501074_0139546_1297_1575 85
364 3300049590 Ga0501074_0486054 Ga0501074_0486054_508_765 85
365 3300049592 Ga0501076_0584970 Ga0501076_0584970_548_805 85
366 3300049592 Ga0501076_0786912 Ga0501076_0786912_118_384 85
367 3300049741 Ga0501079_0000023 Ga0501079_0000023_13115_13381 85
368 3300049741 Ga0501079_0152977 Ga0501079_0152977_513_785 85
369 3300049742 Ga0501080_0017594 Ga0501080_0017594_4541_4807 85
370 3300049742 Ga0501080_0021590 Ga0501080_0021590_3022_3294 85
371 3300049742 Ga0501080_0106072 Ga0501080_0106072_60_332 85
372 3300049742 Ga0501080_0184103 Ga0501080_0184103_1323_1589 85
373 3300049742 Ga0501080_0329892 Ga0501080_0329892_996_1262 85
374 3300049742 Ga0501080_0857527 Ga0501080_0857527_333_602 85
375 3300049742 Ga0501080_1299312 Ga0501080_1299312_290_556 85
376 3300049742 Ga0501080_1856247 Ga0501080_1856247_53_331 85
377 3300049743 Ga0501081_0067592 Ga0501081_0067592_381_653 85
378 3300049743 Ga0501081_0478472 Ga0501081_0478472_25_282 85
379 3300049744 Ga0501083_0001187 Ga0501083_0001187_4541_4807 85
380 3300049744 Ga0501083_0008005 Ga0501083_0008005_6864_7136 85
381 3300049744 Ga0501083_0452570 Ga0501083_0452570_16_288 85
382 3300049744 Ga0501083_1069163 Ga0501083_1069163_76_333 85
383 3300049823 Ga0501044_0526543 Ga0501044_0526543_688_954 85
384 3300049824 Ga0501045_0810817 Ga0501045_0810817_14_271 85
385 3300050494 nmdc:mga06z11_854524_c1 nmdc:mga06z11_854524_c1_112_369 85
386 3300054114 Ga0501084_0000003 Ga0501084_0000003_82730_82996 85
387 3300054114 Ga0501084_0288377 Ga0501084_0288377_956_1228 85
388 3300059506 Ga0587085_139526 Ga0587085_139526_263_523 85
389 3300059641 Ga0587068_091512 Ga0587068_091512_146_406 85
390 3300060353 Ga0501082_0000753 Ga0501082_0000753_15260_15526 85
391 3300060353 Ga0501082_0588487 Ga0501082_0588487_83_355 85
392 3300061734 Ga0530510_0126350 Ga0530510_0126350_332_604 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

21

98

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9668 21 84
6ywv-assembly1.cif.gz_R the structure of the atp25 bound assembly intermediate of the mitoribosome from neurospora crassa 0.9663 21 81
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.966 21 83
3j6b-assembly1.cif.gz_R structure of the yeast mitochondrial large ribosomal subunit 0.965 15 81
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9608 22 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9668 21 84 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9519 21 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9243 21 84 2.40.50.100
af_Q9NDU6_129_252_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9148 21 83 2.40.50.100
af_Q4DLT4_19_136_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9001 21 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A420Z9C1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9911 18 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0G0UDD9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9904 18 82 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-S8C416-F1-model_v4 Ribosomal protein L27 0.9898 22 82 GO:0003735
GO:0005840
GO:0006412
AF-A0A2S6T0A6-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9897 21 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A421K8E4-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9886 22 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
86.96 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map