F431123

General Info

Members Datasets Scaffolds Average Seq Length
388 304 776 220

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10157710|Ga0157378_101577102
Length 248
Sequence MYTSSQLVSQLAINNRQTGRCCRLSHDEAMNAILFGATGMVGQGVLRECLLDPDVERVLSIVRAPTGRREPKLRELAHKDFFDFSPIEDELAGYDACFFCLGVSSAGMKEADYRSVTYDITLAAARALARLNPNMTFIYVSGTGTDSSEKGRSMLARVKGKTENDLLRLPFKAAYMFRPAAIIPLHGVRSKTELYQLFYTVLGPLLPAMYKFFPQYVTTTEQIGRAMLVVAKRGAPKLVIENADINKI

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
300 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.52
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.11
Nodule 0.26
Rhizoplane 4.12
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10157710 3300013297 Bacteria 2120
2 JGI25162J39368_1000271 3300002737 Bacteria 49990
3 JGI25164J39214_1003891 3300002772 Bacteria 1801
4 JGI25151J46595_10000877 3300003187 Bacteria 23734
5 JGI25165J46597_1000373 3300003214 Bacteria 49990
6 Ga0055538_1000144 3300003751 Bacteria 49990
7 Ga0055539_1000195 3300003752 Bacteria 49990
8 Ga0055533_1000196 3300003756 Bacteria 49990
9 Ga0055525_1000263 3300003759 Bacteria 49990
10 Ga0055542_1000372 3300003762 Bacteria 46237
11 Ga0055541_1000128 3300003841 Bacteria 49990
12 Ga0065707_10042227 3300005295 Bacteria 1086
13 Ga0070658_10512606 3300005327 Bacteria 1037
14 Ga0070690_100023821 3300005330 Bacteria 3759
15 Ga0070670_100114080 3300005331 Bacteria 2330
16 Ga0070670_100229861 3300005331 Bacteria 1614
17 Ga0070670_100367556 3300005331 Bacteria 1266
18 Ga0070689_100039021 3300005340 Bacteria 3635
19 Ga0070689_100098632 3300005340 Bacteria 2311
20 Ga0070689_100158768 3300005340 Bacteria 1827
21 Ga0070692_10003630 3300005345 Bacteria 6303
22 Ga0070668_100068576 3300005347 Bacteria 2757
23 Ga0070668_100209876 3300005347 Bacteria 1601
24 Ga0070675_100000004 3300005354 Bacteria 361974
25 Ga0070675_100236765 3300005354 Bacteria 1594
26 Ga0070671_100220612 3300005355 Bacteria 1608
27 Ga0070688_100332277 3300005365 Bacteria 1107
28 Ga0070714_100004988 3300005435 Bacteria 10088
29 Ga0070713_100012340 3300005436 Bacteria 6262
30 Ga0070713_100092024 3300005436 Bacteria 2610
31 Ga0070711_100004274 3300005439 Bacteria 8401
32 Ga0070711_100183839 3300005439 Bacteria 1602
33 Ga0070705_100625411 3300005440 Bacteria 836
34 Ga0070700_100000038 3300005441 Bacteria 109438
35 Ga0070700_100123918 3300005441 Bacteria 1735
36 Ga0070694_100364667 3300005444 Bacteria 1123
37 Ga0070678_100261359 3300005456 Unclassified 1456
38 Ga0070662_100042567 3300005457 Bacteria 3244
39 Ga0068867_100151940 3300005459 Bacteria 1819
40 Ga0070706_100530957 3300005467 Bacteria 1094
41 Ga0070707_100091501 3300005468 Bacteria 2945
42 Ga0070698_100066217 3300005471 Bacteria 3637
43 Ga0070699_100056042 3300005518 Bacteria 3413
44 Ga0070684_100329200 3300005535 Unclassified 1404
45 Ga0068853_100362526 3300005539 Bacteria 1350
46 Ga0070672_100091953 3300005543 Bacteria 2448
47 Ga0070693_100050011 3300005547 Bacteria 2387
48 Ga0070665_100050648 3300005548 Bacteria 4167
49 Ga0070665_100139892 3300005548 Bacteria 2424
50 Ga0070665_100455963 3300005548 Bacteria 1288
51 Ga0070665_100469853 3300005548 Bacteria 1268
52 Ga0070704_100176390 3300005549 Bacteria 1705
53 Ga0070704_100604994 3300005549 Bacteria 964
54 Ga0068855_100115924 3300005563 Bacteria 3070
55 Ga0068857_100086266 3300005577 Bacteria 2806
56 Ga0068856_100267663 3300005614 Bacteria 1725
57 Ga0070702_100179674 3300005615 Bacteria 1383
58 Ga0068852_101108773 3300005616 Bacteria 812
59 Ga0068859_100415103 3300005617 Bacteria 1442
60 Ga0068866_10145141 3300005718 Bacteria 1367
61 Ga0068861_100399262 3300005719 Bacteria 1219
62 Ga0068863_100025143 3300005841 Bacteria 5679
63 Ga0068863_100213346 3300005841 Bacteria 1859
64 Ga0068858_100001474 3300005842 Bacteria 24214
65 Ga0068860_100124471 3300005843 Bacteria 2471
66 Ga0081455_10006288 3300005937 Bacteria 12771
67 Ga0081540_1060163 3300005983 Bacteria 1819
68 Ga0075368_10021875 3300006042 Bacteria 2431
69 Ga0075364_10216990 3300006051 Bacteria 1297
70 Ga0070716_100091818 3300006173 Bacteria 1839
71 Ga0070716_100544298 3300006173 Bacteria 864
72 Ga0075362_10013889 3300006177 Bacteria 3236
73 Ga0075367_10330966 3300006178 Bacteria 960
74 Ga0075369_10028480 3300006186 Bacteria 2342
75 Ga0097621_100042370 3300006237 Bacteria 3666
76 Ga0075370_10249633 3300006353 Bacteria 1051
77 Ga0068871_100032258 3300006358 Bacteria 4136
78 Ga0068871_100292344 3300006358 Bacteria 1428
79 Ga0068871_100297133 3300006358 Bacteria 1417
80 Ga0068871_100818418 3300006358 Bacteria 859
81 Ga0075433_10293206 3300006852 Bacteria 1440
82 Ga0075429_100003605 3300006880 Bacteria 13196
83 Ga0097620_100415092 3300006931 Bacteria 1442
84 Ga0099826_10246103 3300006948 Bacteria 945
85 Ga0075435_100077105 3300007076 Bacteria 2732
86 Ga0099794_10071811 3300007265 Bacteria 1696
87 Ga0099794_10081637 3300007265 Bacteria 1595
88 Ga0099795_10113634 3300007788 Bacteria 1076
89 Ga0099795_10127307 3300007788 Bacteria 1024
90 Ga0105244_10015027 3300009036 Bacteria 4453
91 Ga0105240_10041109 3300009093 Bacteria 5905
92 Ga0111539_10081381 3300009094 Bacteria 3809
93 Ga0111539_10187929 3300009094 Bacteria 2412
94 Ga0105245_10007850 3300009098 Bacteria 9339
95 Ga0105245_10038524 3300009098 Bacteria 4254
96 Ga0105247_10194112 3300009101 Bacteria 1361
97 Ga0114129_10018645 3300009147 Bacteria 9879
98 Ga0114129_10021016 3300009147 Bacteria 9270
99 Ga0105243_10011642 3300009148 Bacteria 6654
100 Ga0105241_10125794 3300009174 Bacteria 2070
101 Ga0105241_10146440 3300009174 Bacteria 1928
102 Ga0105242_10248622 3300009176 Bacteria 1601
103 Ga0105248_10017298 3300009177 Bacteria 7944
104 Ga0105248_10025221 3300009177 Bacteria 6610
105 Ga0105248_10045795 3300009177 Bacteria 4904
106 Ga0105237_10100717 3300009545 Unclassified 2881
107 Ga0105237_10114406 3300009545 Bacteria 2691
108 Ga0105238_10012807 3300009551 Bacteria 8463
109 Ga0105238_10070458 3300009551 Unclassified 3495
110 Ga0105239_10041833 3300010375 Bacteria 5022
111 Ga0105239_10109365 3300010375 Bacteria 3063
112 Ga0105239_10736662 3300010375 Bacteria 1128
113 Ga0105246_10094599 3300011119 Bacteria 2161
114 Ga0157371_10051554 3300013102 Bacteria 2924
115 Ga0157370_10186749 3300013104 Bacteria 1924
116 Ga0157369_10106389 3300013105 Unclassified 2986
117 Ga0157374_10349368 3300013296 Bacteria 1469
118 Ga0157378_10170743 3300013297 Bacteria 2039
119 Ga0157378_10254235 3300013297 Bacteria 1683
120 Ga0157378_10757849 3300013297 Bacteria 994
121 Ga0163162_10118372 3300013306 Bacteria 2751
122 Ga0163162_10277486 3300013306 Bacteria 1808
123 Ga0157375_10175334 3300013308 Bacteria 2293
124 Ga0157375_10971738 3300013308 Bacteria 990
125 Ga0163163_10028066 3300014325 Bacteria 5400
126 Ga0157380_10103397 3300014326 Bacteria 2377
127 Ga0182008_10190617 3300014497 Bacteria 1040
128 Ga0157379_10062177 3300014968 Bacteria 3339
129 Ga0157376_10068942 3300014969 Bacteria 2997
130 Ga0182007_10003741 3300015262 Bacteria 7105
131 Ga0182005_1000693 3300015265 Bacteria 15698
132 Ga0209760_105136 3300025207 Bacteria 1089
133 Ga0209784_100010 3300025224 Bacteria 683664
134 Ga0209566_100008 3300025225 Bacteria 683664
135 Ga0209674_100019 3300025226 Bacteria 683664
136 Ga0209563_100021 3300025230 Bacteria 683764
137 Ga0207427_100222 3300025231 Bacteria 48738
138 Ga0207427_100786 3300025231 Bacteria 14454
139 Ga0209437_100019 3300025233 Bacteria 683764
140 Ga0209437_100151 3300025233 Bacteria 156418
141 Ga0209258_103281 3300025242 Bacteria 3577
142 Ga0209677_100011 3300025253 Bacteria 683664
143 Ga0209148_1000005 3300025254 Bacteria 1806504
144 Ga0209233_1000025 3300025261 Bacteria 683764
145 Ga0209025_1000676 3300025294 Bacteria 58541
146 Ga0209758_1005841 3300025297 Bacteria 9191
147 Ga0207655_1014291 3300025728 Bacteria 4497
148 Ga0207642_10006366 3300025899 Bacteria 3920
149 Ga0207688_10091755 3300025901 Bacteria 1745
150 Ga0207647_10121991 3300025904 Bacteria 1536
151 Ga0207645_10175197 3300025907 Bacteria 1407
152 Ga0207705_10414847 3300025909 Bacteria 1042
153 Ga0207684_10446682 3300025910 Bacteria 1110
154 Ga0207654_10005457 3300025911 Bacteria 6431
155 Ga0207654_10257294 3300025911 Unclassified 1172
156 Ga0207707_10198939 3300025912 Unclassified 1747
157 Ga0207695_10075432 3300025913 Bacteria 3431
158 Ga0207671_10292697 3300025914 Unclassified 1286
159 Ga0207693_10082082 3300025915 Bacteria 2524
160 Ga0207663_10007792 3300025916 Bacteria 5579
161 Ga0207663_10076693 3300025916 Bacteria 2173
162 Ga0207652_10123021 3300025921 Bacteria 2309
163 Ga0207694_10101893 3300025924 Bacteria 2276
164 Ga0207694_10249751 3300025924 Bacteria 1451
165 Ga0207650_10152151 3300025925 Bacteria 1826
166 Ga0207659_10000002 3300025926 Bacteria 619441
167 Ga0207687_10114424 3300025927 Bacteria 2008
168 Ga0207700_10075748 3300025928 Bacteria 2608
169 Ga0207664_10041808 3300025929 Bacteria 3573
170 Ga0207644_10175966 3300025931 Bacteria 1674
171 Ga0207706_10006105 3300025933 Bacteria 11187
172 Ga0207709_10048582 3300025935 Bacteria 2586
173 Ga0207670_10007202 3300025936 Bacteria 6198
174 Ga0207670_10117323 3300025936 Bacteria 1929
175 Ga0207669_10036627 3300025937 Bacteria 2806
176 Ga0207665_10055929 3300025939 Bacteria 2663
177 Ga0207665_10126004 3300025939 Bacteria 1813
178 Ga0207691_10084660 3300025940 Bacteria 2846
179 Ga0207711_10016737 3300025941 Bacteria 6090
180 Ga0207711_10093610 3300025941 Bacteria 2647
181 Ga0207689_10043719 3300025942 Bacteria 3703
182 Ga0207679_10053773 3300025945 Bacteria 2961
183 Ga0207667_10129150 3300025949 Bacteria 2603
184 Ga0207667_10504280 3300025949 Bacteria 1227
185 Ga0207668_10152529 3300025972 Bacteria 1790
186 Ga0207677_10090278 3300026023 Bacteria 2226
187 Ga0207703_10006838 3300026035 Bacteria 9082
188 Ga0207639_10158813 3300026041 Bacteria 1903
189 Ga0207678_10078656 3300026067 Bacteria 2824
190 Ga0207708_10000001 3300026075 Bacteria 467100
191 Ga0207648_10030825 3300026089 Bacteria 4746
192 Ga0207674_10063301 3300026116 Bacteria 3733
193 Ga0207675_100079575 3300026118 Bacteria 3071
194 Ga0207683_10070661 3300026121 Bacteria 3085
195 Ga0207683_10305727 3300026121 Unclassified 1455
196 Ga0207698_10191696 3300026142 Bacteria 1821
197 Ga0207698_10666879 3300026142 Bacteria 1032
198 Ga0209179_1038017 3300027512 Bacteria 1006
199 Ga0209813_10033325 3300027866 Bacteria 1531
200 Ga0207428_10266579 3300027907 Bacteria 1274
201 Ga0268266_10008136 3300028379 Bacteria 9365
202 Ga0268266_10104433 3300028379 Bacteria 2502
203 Ga0268266_10399716 3300028379 Bacteria 1299
204 Ga0268264_10592851 3300028381 Bacteria 1091
205 Ga0265334_10008245 3300028573 Bacteria 4436
206 Ga0265336_10005773 3300028666 Bacteria 4530
207 Ga0307515_10019798 3300028794 Bacteria 12074
208 Ga0265338_10022638 3300028800 Bacteria 6494
209 Ga0265338_10071452 3300028800 Bacteria 2969
210 Ga0265324_10003044 3300029957 Bacteria 8187
211 Ga0265760_10004556 3300031090 Bacteria 3971
212 Ga0265760_10067513 3300031090 Bacteria 1093
213 Ga0265328_10027772 3300031239 Bacteria 2120
214 Ga0265325_10043584 3300031241 Bacteria 2341
215 Ga0265325_10207484 3300031241 Bacteria 901
216 Ga0265340_10010028 3300031247 Bacteria 5074
217 Ga0265327_10002493 3300031251 Bacteria 19292
218 Ga0265316_10013101 3300031344 Bacteria 7392
219 Ga0265316_10118582 3300031344 Bacteria 2000
220 Ga0265313_10000351 3300031595 Bacteria 50142
221 Ga0265313_10006444 3300031595 Bacteria 8309
222 Ga0265314_10021032 3300031711 Bacteria 5028
223 Ga0265342_10085214 3300031712 Bacteria 1819
224 Ga0307415_100298731 3300032126 Bacteria 1333
225 Ga0307510_10087733 3300033180 Bacteria 2975
226 Ga0373934_0000755 3300035086 Bacteria 11591
227 Ga0373923_0000165 3300035111 Bacteria 13011
228 Ga0373954_0000260 3300035118 Bacteria 19074
229 Ga0373956_0007860 3300035119 Bacteria 4302
230 Ga0373957_0000577 3300035120 Bacteria 9298
231 Ga0373946_0154021 3300035171 Bacteria 1074
232 Ga0373955_0004905 3300035172 Bacteria 5968
233 Ga0373961_0000234 3300035241 Bacteria 25697
234 Ga0373924_0067865 3300035410 Bacteria 1501
235 Ga0373935_0697881 3300035692 Bacteria 746
236 Ga0373927_0220924 3300035695 Bacteria 1245
237 Ga0373927_0513428 3300035695 Bacteria 792
238 Ga0373937_0006861 3300036401 Bacteria 9827
239 Ga0373937_0117110 3300036401 Unclassified 2481
240 Ga0373937_0509895 3300036401 Bacteria 1143
241 Ga0373925_0001825 3300037068 Bacteria 17769
242 Ga0373925_0219257 3300037068 Bacteria 1518
243 Ga0395899_0104320 3300037312 Bacteria 2043
244 Ga0395900_0584726 3300037418 Bacteria 1058
245 Ga0395905_0005544 3300037471 Bacteria 12873
246 Ga0395901_0074252 3300038443 Bacteria 3547
247 Ga0436365_1443623 3300039437 Bacteria 1134
248 Ga0453684_1316953 3300044712 Unclassified 753
249 Ga0451576_0214811 3300045051 Bacteria 2009
250 Ga0495592_0003370 3300046454 Bacteria 11446
251 Ga0495592_0014035 3300046454 Bacteria 6086
252 Ga0495638_0047081 3300046460 Bacteria 2706
253 Ga0495638_0087909 3300046460 Bacteria 1877
254 Ga0495641_0003337 3300046461 Bacteria 12077
255 Ga0495651_0004290 3300046462 Bacteria 10932
256 Ga0495651_0023435 3300046462 Bacteria 4798
257 Ga0495653_0099078 3300046463 Bacteria 2115
258 Ga0495650_0058525 3300046471 Bacteria 1555
259 Ga0495650_0091544 3300046471 Bacteria 1156
260 Ga0495580_0085917 3300046472 Bacteria 2191
261 Ga0495582_0147451 3300046473 Bacteria 1335
262 Ga0495639_0175765 3300046475 Bacteria 1041
263 Ga0495662_0034826 3300046476 Bacteria 2430
264 Ga0495664_0088723 3300046477 Bacteria 1859
265 Ga0495585_0085247 3300046492 Bacteria 1707
266 Ga0495594_0303787 3300046499 Bacteria 909
267 Ga0495608_0023930 3300046511 Bacteria 4178
268 Ga0495618_0012686 3300046514 Bacteria 5121
269 Ga0495618_0033707 3300046514 Bacteria 3211
270 Ga0495628_0014338 3300046516 Bacteria 6644
271 Ga0495630_0003128 3300046517 Bacteria 11478
272 Ga0495631_0067469 3300046518 Bacteria 1547
273 Ga0495666_0003294 3300046526 Bacteria 8154
274 Ga0495652_0084730 3300046529 Bacteria 2606
275 Ga0495665_0155676 3300046531 Bacteria 1192
276 Ga0495640_0026003 3300046533 Bacteria 4237
277 Ga0495586_0293844 3300046535 Bacteria 930
278 Ga0495609_0060459 3300046538 Bacteria 1675
279 Ga0495621_0034880 3300046539 Bacteria 1740
280 Ga0495621_0332275 3300046539 Bacteria 635
281 Ga0495645_0018983 3300046543 Bacteria 4948
282 Ga0495645_0052868 3300046543 Bacteria 2954
283 Ga0495622_0065527 3300046557 Bacteria 1679
284 Ga0495633_0256065 3300046558 Bacteria 798
285 Ga0495668_0173481 3300046616 Bacteria 1181
286 Ga0495634_0079731 3300046642 Bacteria 2143
287 Ga0495625_0329061 3300046660 Bacteria 971
288 Ga0495635_0031075 3300046663 Bacteria 3710
289 Ga0495661_0118563 3300046665 Bacteria 1465
290 Ga0495657_0030435 3300046675 Bacteria 3780
291 Ga0495599_0003325 3300046678 Bacteria 9387
292 Ga0495623_0020029 3300046679 Bacteria 4325
293 Ga0495646_0004377 3300046680 Bacteria 8896
294 Ga0495658_0033892 3300046683 Bacteria 2799
295 Ga0495669_0008837 3300046684 Bacteria 4244
296 Ga0495669_0087480 3300046684 Bacteria 1436
297 Ga0495613_0064582 3300046689 Bacteria 2676
298 Ga0495624_0023027 3300046690 Bacteria 4110
299 Ga0495624_0042149 3300046690 Bacteria 2917
300 Ga0495600_0000515 3300046809 Bacteria 20044
301 Ga0495600_0003062 3300046809 Bacteria 9768
302 Ga0495604_0003755 3300047317 Bacteria 12091
303 Ga0495604_0028840 3300047317 Bacteria 4416
304 Ga0495636_0031938 3300047318 Bacteria 2159
305 Ga0495636_0085257 3300047318 Bacteria 1365
306 Ga0495674_0001491 3300047319 Bacteria 22945
307 Ga0495680_0019339 3300047322 Bacteria 5751
308 Ga0495675_0004242 3300047444 Bacteria 8666
309 Ga0495677_0080784 3300047445 Bacteria 1218
310 Ga0495602_0065749 3300048088 Bacteria 3127
311 Ga0495602_0133387 3300048088 Bacteria 1977
312 Ga0496100_0021161 3300048903 Bacteria 3913
313 Ga0496102_0131132 3300048905 Bacteria 2346
314 Ga0496103_0388569 3300048906 Bacteria 896
315 Ga0496104_0435592 3300048907 Bacteria 1223
316 Ga0496106_0031484 3300048909 Bacteria 3953
317 Ga0496106_0162568 3300048909 Bacteria 1766
318 Ga0496106_0199134 3300048909 Bacteria 1594
319 Ga0496106_0220895 3300048909 Bacteria 1511
320 Ga0496107_0059724 3300048910 Bacteria 2760
321 Ga0496108_0566072 3300048911 Unclassified 991
322 Ga0496109_0079916 3300048912 Bacteria 3013
323 Ga0496109_0142162 3300048912 Bacteria 2244
324 Ga0496110_0075155 3300048913 Bacteria 3002
325 Ga0496112_0000127 3300048915 Bacteria 47440
326 Ga0496112_0053332 3300048915 Bacteria 3971
327 Ga0496113_0173838 3300048916 Bacteria 1706
328 Ga0496118_0274699 3300048921 Bacteria 942
329 Ga0496125_0052445 3300048928 Bacteria 3354
330 Ga0496126_0010610 3300048929 Bacteria 9633
331 Ga0501031_0000072 3300049568 Bacteria 53648
332 Ga0501032_0000110 3300049569 Bacteria 70189
333 Ga0501033_0000562 3300049570 Bacteria 34520
334 Ga0501034_0000181 3300049571 Bacteria 117767
335 Ga0501036_0003302 3300049572 Bacteria 12872
336 Ga0501037_0000059 3300049573 Bacteria 101459
337 Ga0501038_0000143 3300049574 Bacteria 61292
338 Ga0501039_0000400 3300049575 Bacteria 31170
339 Ga0501043_0001060 3300049579 Bacteria 24164
340 Ga0501046_0000153 3300049580 Bacteria 71187
341 Ga0501047_0000149 3300049581 Bacteria 85138
342 Ga0501048_0000328 3300049582 Bacteria 32753
343 Ga0501067_0000706 3300049583 Bacteria 17982
344 Ga0501068_0004523 3300049584 Bacteria 7565
345 Ga0501069_0012363 3300049585 Bacteria 4538
346 Ga0501070_0001602 3300049586 Bacteria 20078
347 Ga0501071_0442731 3300049587 Bacteria 994
348 Ga0501072_0020666 3300049588 Bacteria 5101
349 Ga0501073_0000436 3300049589 Bacteria 28732
350 Ga0501074_0000156 3300049590 Bacteria 35744
351 Ga0501076_0575743 3300049592 Bacteria 929
352 Ga0501080_0003222 3300049742 Bacteria 14400
353 Ga0501083_0000244 3300049744 Bacteria 34784
354 Ga0501035_0000383 3300049822 Bacteria 50837
355 Ga0501035_0028630 3300049822 Bacteria 5085
356 Ga0501044_0003412 3300049823 Bacteria 17902
357 Ga0501044_0317937 3300049823 Bacteria 1482
358 Ga0501045_0003126 3300049824 Bacteria 11323
359 nmdc:mga03683_33454_c1 3300050489 Bacteria 2074
360 nmdc:mga03n38_21844_c1 3300050490 Bacteria 2581
361 nmdc:mga00v17_7364_c1 3300050491 Bacteria 5868
362 nmdc:mga0k408_37977_c1 3300050493 Bacteria 2765
363 nmdc:mga05p37_123189_c1 3300050507 Bacteria 3185
364 nmdc:mga05p37_14767_c1 3300050507 Bacteria 9378
365 nmdc:mga05p37_226561_c1 3300050507 Bacteria 2254
366 nmdc:mga05p37_890782_c1 3300050507 Bacteria 961
367 nmdc:mga09592_212157_c1 3300050508 Bacteria 1677
368 nmdc:mga09592_37615_c1 3300050508 Bacteria 4060
369 nmdc:mga0qj67_147514_c1 3300050509 Bacteria 1907
370 nmdc:mga08y16_422072_c1 3300050511 Bacteria 1363
371 nmdc:mga0n895_1014886_c1 3300050512 Bacteria 810
372 nmdc:mga0rr50_43291_c1 3300050513 Bacteria 3293
373 nmdc:mga0a205_170756_c1 3300050515 Bacteria 2071
374 Ga0495601_0009973 3300053077 Bacteria 5632
375 Ga0495619_0252979 3300053085 Bacteria 1221
376 Ga0500644_0001128 3300053088 Bacteria 7834
377 Ga0500651_0011558 3300053093 Bacteria 5327
378 Ga0500651_0093629 3300053093 Bacteria 1847
379 Ga0500595_000156 3300053119 Bacteria 44885
380 Ga0500595_001841 3300053119 Bacteria 10976
381 Ga0500595_011431 3300053119 Bacteria 3477
382 Ga0500642_0101928 3300053130 Bacteria 1336
383 Ga0500574_000183 3300053141 Bacteria 7361
384 Ga0500577_0000089 3300053142 Bacteria 21573
385 Ga0500616_0134699 3300053153 Unclassified 1162
386 Ga0500619_000236 3300053154 Bacteria 12302
387 Ga0501084_0000558 3300054114 Bacteria 28461
388 2585264452 2582581306 Bacteria 6450535
389 Ga0157378_10157710
390 JGI25162J39368_1000271
391 JGI25164J39214_1003891
392 JGI25151J46595_10000877
393 JGI25165J46597_1000373
394 Ga0055538_1000144
395 Ga0055539_1000195
396 Ga0055533_1000196
397 Ga0055525_1000263
398 Ga0055542_1000372
399 Ga0055541_1000128
400 Ga0065707_10042227
401 Ga0070658_10512606
402 Ga0070690_100023821
403 Ga0070670_100114080
404 Ga0070670_100229861
405 Ga0070670_100367556
406 Ga0070689_100039021
407 Ga0070689_100098632
408 Ga0070689_100158768
409 Ga0070692_10003630
410 Ga0070668_100068576
411 Ga0070668_100209876
412 Ga0070675_100000004
413 Ga0070675_100236765
414 Ga0070671_100220612
415 Ga0070688_100332277
416 Ga0070714_100004988
417 Ga0070713_100012340
418 Ga0070713_100092024
419 Ga0070711_100004274
420 Ga0070711_100183839
421 Ga0070705_100625411
422 Ga0070700_100000038
423 Ga0070700_100123918
424 Ga0070694_100364667
425 Ga0070678_100261359
426 Ga0070662_100042567
427 Ga0068867_100151940
428 Ga0070706_100530957
429 Ga0070707_100091501
430 Ga0070698_100066217
431 Ga0070699_100056042
432 Ga0070684_100329200
433 Ga0068853_100362526
434 Ga0070672_100091953
435 Ga0070693_100050011
436 Ga0070665_100050648
437 Ga0070665_100139892
438 Ga0070665_100455963
439 Ga0070665_100469853
440 Ga0070704_100176390
441 Ga0070704_100604994
442 Ga0068855_100115924
443 Ga0068857_100086266
444 Ga0068856_100267663
445 Ga0070702_100179674
446 Ga0068852_101108773
447 Ga0068859_100415103
448 Ga0068866_10145141
449 Ga0068861_100399262
450 Ga0068863_100025143
451 Ga0068863_100213346
452 Ga0068858_100001474
453 Ga0068860_100124471
454 Ga0081455_10006288
455 Ga0081540_1060163
456 Ga0075368_10021875
457 Ga0075364_10216990
458 Ga0070716_100091818
459 Ga0070716_100544298
460 Ga0075362_10013889
461 Ga0075367_10330966
462 Ga0075369_10028480
463 Ga0097621_100042370
464 Ga0075370_10249633
465 Ga0068871_100032258
466 Ga0068871_100292344
467 Ga0068871_100297133
468 Ga0068871_100818418
469 Ga0075433_10293206
470 Ga0075429_100003605
471 Ga0097620_100415092
472 Ga0099826_10246103
473 Ga0075435_100077105
474 Ga0099794_10071811
475 Ga0099794_10081637
476 Ga0099795_10113634
477 Ga0099795_10127307
478 Ga0105244_10015027
479 Ga0105240_10041109
480 Ga0111539_10081381
481 Ga0111539_10187929
482 Ga0105245_10007850
483 Ga0105245_10038524
484 Ga0105247_10194112
485 Ga0114129_10018645
486 Ga0114129_10021016
487 Ga0105243_10011642
488 Ga0105241_10125794
489 Ga0105241_10146440
490 Ga0105242_10248622
491 Ga0105248_10017298
492 Ga0105248_10025221
493 Ga0105248_10045795
494 Ga0105237_10100717
495 Ga0105237_10114406
496 Ga0105238_10012807
497 Ga0105238_10070458
498 Ga0105239_10041833
499 Ga0105239_10109365
500 Ga0105239_10736662
501 Ga0105246_10094599
502 Ga0157371_10051554
503 Ga0157370_10186749
504 Ga0157369_10106389
505 Ga0157374_10349368
506 Ga0157378_10170743
507 Ga0157378_10254235
508 Ga0157378_10757849
509 Ga0163162_10118372
510 Ga0163162_10277486
511 Ga0157375_10175334
512 Ga0157375_10971738
513 Ga0163163_10028066
514 Ga0157380_10103397
515 Ga0182008_10190617
516 Ga0157379_10062177
517 Ga0157376_10068942
518 Ga0182007_10003741
519 Ga0182005_1000693
520 Ga0209760_105136
521 Ga0209784_100010
522 Ga0209566_100008
523 Ga0209674_100019
524 Ga0209563_100021
525 Ga0207427_100222
526 Ga0207427_100786
527 Ga0209437_100019
528 Ga0209437_100151
529 Ga0209258_103281
530 Ga0209677_100011
531 Ga0209148_1000005
532 Ga0209233_1000025
533 Ga0209025_1000676
534 Ga0209758_1005841
535 Ga0207655_1014291
536 Ga0207642_10006366
537 Ga0207688_10091755
538 Ga0207647_10121991
539 Ga0207645_10175197
540 Ga0207705_10414847
541 Ga0207684_10446682
542 Ga0207654_10005457
543 Ga0207654_10257294
544 Ga0207707_10198939
545 Ga0207695_10075432
546 Ga0207671_10292697
547 Ga0207693_10082082
548 Ga0207663_10007792
549 Ga0207663_10076693
550 Ga0207652_10123021
551 Ga0207694_10101893
552 Ga0207694_10249751
553 Ga0207650_10152151
554 Ga0207659_10000002
555 Ga0207687_10114424
556 Ga0207700_10075748
557 Ga0207664_10041808
558 Ga0207644_10175966
559 Ga0207706_10006105
560 Ga0207709_10048582
561 Ga0207670_10007202
562 Ga0207670_10117323
563 Ga0207669_10036627
564 Ga0207665_10055929
565 Ga0207665_10126004
566 Ga0207691_10084660
567 Ga0207711_10016737
568 Ga0207711_10093610
569 Ga0207689_10043719
570 Ga0207679_10053773
571 Ga0207667_10129150
572 Ga0207667_10504280
573 Ga0207668_10152529
574 Ga0207677_10090278
575 Ga0207703_10006838
576 Ga0207639_10158813
577 Ga0207678_10078656
578 Ga0207708_10000001
579 Ga0207648_10030825
580 Ga0207674_10063301
581 Ga0207675_100079575
582 Ga0207683_10070661
583 Ga0207683_10305727
584 Ga0207698_10191696
585 Ga0207698_10666879
586 Ga0209179_1038017
587 Ga0209813_10033325
588 Ga0207428_10266579
589 Ga0268266_10008136
590 Ga0268266_10104433
591 Ga0268266_10399716
592 Ga0268264_10592851
593 Ga0265334_10008245
594 Ga0265336_10005773
595 Ga0307515_10019798
596 Ga0265338_10022638
597 Ga0265338_10071452
598 Ga0265324_10003044
599 Ga0265760_10004556
600 Ga0265760_10067513
601 Ga0265328_10027772
602 Ga0265325_10043584
603 Ga0265325_10207484
604 Ga0265340_10010028
605 Ga0265327_10002493
606 Ga0265316_10013101
607 Ga0265316_10118582
608 Ga0265313_10000351
609 Ga0265313_10006444
610 Ga0265314_10021032
611 Ga0265342_10085214
612 Ga0307415_100298731
613 Ga0307510_10087733
614 Ga0373934_0000755
615 Ga0373923_0000165
616 Ga0373954_0000260
617 Ga0373956_0007860
618 Ga0373957_0000577
619 Ga0373946_0154021
620 Ga0373955_0004905
621 Ga0373961_0000234
622 Ga0373924_0067865
623 Ga0373935_0697881
624 Ga0373927_0220924
625 Ga0373927_0513428
626 Ga0373937_0006861
627 Ga0373937_0117110
628 Ga0373937_0509895
629 Ga0373925_0001825
630 Ga0373925_0219257
631 Ga0395899_0104320
632 Ga0395900_0584726
633 Ga0395905_0005544
634 Ga0395901_0074252
635 Ga0436365_1443623
636 Ga0453684_1316953
637 Ga0451576_0214811
638 Ga0495592_0003370
639 Ga0495592_0014035
640 Ga0495638_0047081
641 Ga0495638_0087909
642 Ga0495641_0003337
643 Ga0495651_0004290
644 Ga0495651_0023435
645 Ga0495653_0099078
646 Ga0495650_0058525
647 Ga0495650_0091544
648 Ga0495580_0085917
649 Ga0495582_0147451
650 Ga0495639_0175765
651 Ga0495662_0034826
652 Ga0495664_0088723
653 Ga0495585_0085247
654 Ga0495594_0303787
655 Ga0495608_0023930
656 Ga0495618_0012686
657 Ga0495618_0033707
658 Ga0495628_0014338
659 Ga0495630_0003128
660 Ga0495631_0067469
661 Ga0495666_0003294
662 Ga0495652_0084730
663 Ga0495665_0155676
664 Ga0495640_0026003
665 Ga0495586_0293844
666 Ga0495609_0060459
667 Ga0495621_0034880
668 Ga0495621_0332275
669 Ga0495645_0018983
670 Ga0495645_0052868
671 Ga0495622_0065527
672 Ga0495633_0256065
673 Ga0495668_0173481
674 Ga0495634_0079731
675 Ga0495625_0329061
676 Ga0495635_0031075
677 Ga0495661_0118563
678 Ga0495657_0030435
679 Ga0495599_0003325
680 Ga0495623_0020029
681 Ga0495646_0004377
682 Ga0495658_0033892
683 Ga0495669_0008837
684 Ga0495669_0087480
685 Ga0495613_0064582
686 Ga0495624_0023027
687 Ga0495624_0042149
688 Ga0495600_0000515
689 Ga0495600_0003062
690 Ga0495604_0003755
691 Ga0495604_0028840
692 Ga0495636_0031938
693 Ga0495636_0085257
694 Ga0495674_0001491
695 Ga0495680_0019339
696 Ga0495675_0004242
697 Ga0495677_0080784
698 Ga0495602_0065749
699 Ga0495602_0133387
700 Ga0496100_0021161
701 Ga0496102_0131132
702 Ga0496103_0388569
703 Ga0496104_0435592
704 Ga0496106_0031484
705 Ga0496106_0162568
706 Ga0496106_0199134
707 Ga0496106_0220895
708 Ga0496107_0059724
709 Ga0496108_0566072
710 Ga0496109_0079916
711 Ga0496109_0142162
712 Ga0496110_0075155
713 Ga0496112_0000127
714 Ga0496112_0053332
715 Ga0496113_0173838
716 Ga0496118_0274699
717 Ga0496125_0052445
718 Ga0496126_0010610
719 Ga0501031_0000072
720 Ga0501032_0000110
721 Ga0501033_0000562
722 Ga0501034_0000181
723 Ga0501036_0003302
724 Ga0501037_0000059
725 Ga0501038_0000143
726 Ga0501039_0000400
727 Ga0501043_0001060
728 Ga0501046_0000153
729 Ga0501047_0000149
730 Ga0501048_0000328
731 Ga0501067_0000706
732 Ga0501068_0004523
733 Ga0501069_0012363
734 Ga0501070_0001602
735 Ga0501071_0442731
736 Ga0501072_0020666
737 Ga0501073_0000436
738 Ga0501074_0000156
739 Ga0501076_0575743
740 Ga0501080_0003222
741 Ga0501083_0000244
742 Ga0501035_0000383
743 Ga0501035_0028630
744 Ga0501044_0003412
745 Ga0501044_0317937
746 Ga0501045_0003126
747 nmdc:mga03683_33454_c1
748 nmdc:mga03n38_21844_c1
749 nmdc:mga00v17_7364_c1
750 nmdc:mga0k408_37977_c1
751 nmdc:mga05p37_123189_c1
752 nmdc:mga05p37_14767_c1
753 nmdc:mga05p37_226561_c1
754 nmdc:mga05p37_890782_c1
755 nmdc:mga09592_212157_c1
756 nmdc:mga09592_37615_c1
757 nmdc:mga0qj67_147514_c1
758 nmdc:mga08y16_422072_c1
759 nmdc:mga0n895_1014886_c1
760 nmdc:mga0rr50_43291_c1
761 nmdc:mga0a205_170756_c1
762 Ga0495601_0009973
763 Ga0495619_0252979
764 Ga0500644_0001128
765 Ga0500651_0011558
766 Ga0500651_0093629
767 Ga0500595_000156
768 Ga0500595_001841
769 Ga0500595_011431
770 Ga0500642_0101928
771 Ga0500574_000183
772 Ga0500577_0000089
773 Ga0500616_0134699
774 Ga0500619_000236
775 Ga0501084_0000558
776 2585264452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.8495 2 218
6y79-assembly1.cif.gz_E cryo-em structure of a respiratory complex i f89a mutant 0.7924 2 153
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.7901 2 218
2gvc-assembly1.cif.gz_B crystal structure of flavin-containing monooxygenase (fmo)from s.pombe and substrate (methimazole) complex 0.7703 2 39
2bka-assembly1.cif.gz_A-2 cc3(tip30)crystal structure 0.7667 2 218
ID Description Score Start End Superfamily
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9234 1 218 3.40.50.720
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9153 1 218 3.40.50.720
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8495 2 218 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8206 1 216 3.40.50.720
af_P40008_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8126 1 216 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3R7E973-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.9881 1 218
AF-Q027L9-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9874 1 219
AF-A0A7W8J3W1-F1-model_v4 Uncharacterized protein YbjT (DUF2867 family) 0.987 1 219
AF-A0A2T2Q737-F1-model_v4 Epimerase 0.9859 1 219
AF-A0A328UCN3-F1-model_v4 Epimerase 0.9843 1 218

Map