F430908

General Info

Members Datasets Scaffolds Average Seq Length
387 256 774 150

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0274840|Ga0466958_0274840_507_1043
Length 178
Sequence MIVPTILRLDESQEVPMSPKADTQKRTNRTTAARKPSTGLTAEERAAMKDRVRELKAETRRGRGKKGKAEGERDVLAKIAEMPAPDRAMAKRIHAIVKESASELSPRTWYGMPAYAKDGNVVCFLQNASKFKARYATLGFNDRANLDEGNMWPTAFALKELTPAEEKRIAALVKKAVG

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
177 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 7.75
Rhizosphere 85.79
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0274840 3300045836 Bacteria 1079
2 Ga0055535_1001669 3300003761 Bacteria 10205
3 Ga0055542_1001618 3300003762 Bacteria 10232
4 Ga0065704_10229226 3300005289 Bacteria 1045
5 Ga0065715_10012495 3300005293 Bacteria 2542
6 Ga0065715_10093811 3300005293 Bacteria 4545
7 Ga0065707_10150606 3300005295 Bacteria 1658
8 Ga0070658_10543807 3300005327 Bacteria 1005
9 Ga0070683_100066525 3300005329 Bacteria 3357
10 Ga0070670_100315508 3300005331 Bacteria 1369
11 Ga0070670_100424930 3300005331 Archaea 1175
12 Ga0070666_10679184 3300005335 Archaea 754
13 Ga0070680_101135090 3300005336 Bacteria 676
14 Ga0070682_100834676 3300005337 Bacteria 752
15 Ga0070660_100195524 3300005339 Bacteria 1639
16 Ga0070689_100987018 3300005340 Bacteria 749
17 Ga0070687_100204447 3300005343 Bacteria 1199
18 Ga0070687_100305327 3300005343 Bacteria 1011
19 Ga0070692_10064705 3300005345 Bacteria 1934
20 Ga0070692_10122002 3300005345 Bacteria 1454
21 Ga0070671_100309331 3300005355 Bacteria 1346
22 Ga0070671_100346952 3300005355 Bacteria 1267
23 Ga0070659_100193443 3300005366 Bacteria 1672
24 Ga0070667_100271684 3300005367 Bacteria 1520
25 Ga0070703_10019631 3300005406 Bacteria 1960
26 Ga0070709_10028886 3300005434 Bacteria 3311
27 Ga0070714_100004304 3300005435 Bacteria 10732
28 Ga0070714_100031591 3300005435 Bacteria 4420
29 Ga0070714_100063643 3300005435 Bacteria 3173
30 Ga0070713_101527387 3300005436 Bacteria 648
31 Ga0070713_101861613 3300005436 Bacteria 584
32 Ga0070710_10009066 3300005437 Bacteria 4864
33 Ga0070710_10218917 3300005437 Bacteria 1210
34 Ga0070711_100195128 3300005439 Bacteria 1559
35 Ga0070705_100042655 3300005440 Bacteria 2594
36 Ga0070705_100587540 3300005440 Bacteria 859
37 Ga0070694_100080433 3300005444 Bacteria 2264
38 Ga0070708_100028679 3300005445 Bacteria 4793
39 Ga0070708_100587005 3300005445 Bacteria 1050
40 Ga0070708_100826160 3300005445 Bacteria 871
41 Ga0070663_100333793 3300005455 Bacteria 1223
42 Ga0070662_100449861 3300005457 Bacteria 1069
43 Ga0070681_10017365 3300005458 Bacteria 7190
44 Ga0070681_10173639 3300005458 Bacteria 2077
45 Ga0068867_100385011 3300005459 Bacteria 1179
46 Ga0070706_100085416 3300005467 Bacteria 2924
47 Ga0070707_101821198 3300005468 Bacteria 576
48 Ga0070698_100092014 3300005471 Bacteria 3014
49 Ga0070699_100306226 3300005518 Bacteria 1426
50 Ga0070699_100783325 3300005518 Bacteria 872
51 Ga0070679_100012685 3300005530 Bacteria 8059
52 Ga0070679_100138378 3300005530 Bacteria 2416
53 Ga0070679_100385012 3300005530 Bacteria 1349
54 Ga0070684_100010072 3300005535 Bacteria 7473
55 Ga0070684_100872125 3300005535 Bacteria 843
56 Ga0070697_100128625 3300005536 Bacteria 2123
57 Ga0070697_100520388 3300005536 Bacteria 1041
58 Ga0070672_100203075 3300005543 Bacteria 1658
59 Ga0070695_100050354 3300005545 Bacteria 2669
60 Ga0070695_100166357 3300005545 Bacteria 1552
61 Ga0070695_100301945 3300005545 Bacteria 1184
62 Ga0070696_100022104 3300005546 Bacteria 4319
63 Ga0070696_100062850 3300005546 Bacteria 2600
64 Ga0070696_100071217 3300005546 Bacteria 2446
65 Ga0070704_100385753 3300005549 Bacteria 1191
66 Ga0068855_100119095 3300005563 Bacteria 3023
67 Ga0070664_100012165 3300005564 Bacteria 6992
68 Ga0070664_100172851 3300005564 Bacteria 1917
69 Ga0068857_100007402 3300005577 Bacteria 9453
70 Ga0068857_100024622 3300005577 Bacteria 5301
71 Ga0068857_100191041 3300005577 Bacteria 1865
72 Ga0068854_101663558 3300005578 Bacteria 583
73 Ga0068852_100172798 3300005616 Bacteria 2027
74 Ga0068859_100429252 3300005617 Bacteria 1418
75 Ga0068859_101504991 3300005617 Bacteria 743
76 Ga0068864_100269009 3300005618 Archaea 1587
77 Ga0068870_10044981 3300005840 Bacteria 2309
78 Ga0068858_100010011 3300005842 Bacteria 9005
79 Ga0068860_100142117 3300005843 Bacteria 2307
80 Ga0068862_100503525 3300005844 Bacteria 1150
81 Ga0081455_10005492 3300005937 Bacteria 13897
82 Ga0081538_10005381 3300005981 Bacteria 11507
83 Ga0081538_10010307 3300005981 Bacteria 7672
84 Ga0081538_10080777 3300005981 Bacteria 1733
85 Ga0070715_10021641 3300006163 Bacteria 2497
86 Ga0097621_100008663 3300006237 Bacteria 7341
87 Ga0068871_100024662 3300006358 Bacteria 4666
88 Ga0075428_100053747 3300006844 Bacteria 4413
89 Ga0075428_100199283 3300006844 Bacteria 2165
90 Ga0075431_100013859 3300006847 Bacteria 8144
91 Ga0075433_10079645 3300006852 Bacteria 2887
92 Ga0075433_10609717 3300006852 Bacteria 958
93 Ga0075434_101760590 3300006871 Bacteria 627
94 Ga0075429_100001268 3300006880 Bacteria 20551
95 Ga0068865_100877466 3300006881 Bacteria 779
96 Ga0075436_100648562 3300006914 Bacteria 780
97 Ga0075436_100840602 3300006914 Bacteria 685
98 Ga0097620_100429230 3300006931 Bacteria 1418
99 Ga0097620_101505234 3300006931 Bacteria 743
100 Ga0075435_100260512 3300007076 Bacteria 1477
101 Ga0075435_100300151 3300007076 Bacteria 1374
102 Ga0075435_100328333 3300007076 Bacteria 1310
103 Ga0105240_10075246 3300009093 Bacteria 4165
104 Ga0105240_10496651 3300009093 Bacteria 1357
105 Ga0111539_10534072 3300009094 Bacteria 1366
106 Ga0111539_10959066 3300009094 Bacteria 994
107 Ga0105245_10138531 3300009098 Bacteria 2290
108 Ga0105245_10721835 3300009098 Unclassified 1031
109 Ga0105245_11383665 3300009098 Bacteria 753
110 Ga0114129_10002047 3300009147 Bacteria 27666
111 Ga0114129_10009524 3300009147 Bacteria 13855
112 Ga0105243_10178322 3300009148 Bacteria 1846
113 Ga0105243_10266279 3300009148 Bacteria 1537
114 Ga0105243_11191206 3300009148 Bacteria 774
115 Ga0105243_11518802 3300009148 Bacteria 694
116 Ga0105242_10165438 3300009176 Bacteria 1940
117 Ga0105242_10341375 3300009176 Bacteria 1380
118 Ga0105242_10987476 3300009176 Bacteria 849
119 Ga0105248_10526673 3300009177 Bacteria 1333
120 Ga0105237_10273164 3300009545 Bacteria 1693
121 Ga0105237_11414192 3300009545 Bacteria 702
122 Ga0105249_10703445 3300009553 Bacteria 1071
123 Ga0105239_10473789 3300010375 Bacteria 1422
124 Ga0105239_10513941 3300010375 Bacteria 1362
125 Ga0105239_10802255 3300010375 Bacteria 1079
126 Ga0105239_10956253 3300010375 Bacteria 984
127 Ga0105239_13035184 3300010375 Bacteria 547
128 Ga0157373_10763374 3300013100 Bacteria 711
129 Ga0157373_10785981 3300013100 Bacteria 701
130 Ga0157369_10030764 3300013105 Bacteria 5919
131 Ga0157369_10244792 3300013105 Bacteria 1872
132 Ga0157374_10209564 3300013296 Bacteria 1911
133 Ga0157378_10510552 3300013297 Bacteria 1202
134 Ga0157378_10567712 3300013297 Bacteria 1142
135 Ga0157378_10724695 3300013297 Bacteria 1015
136 Ga0163162_10030639 3300013306 Bacteria 5330
137 Ga0163162_11482996 3300013306 Bacteria 772
138 Ga0157372_10061239 3300013307 Bacteria 4213
139 Ga0157375_10424267 3300013308 Bacteria 1496
140 Ga0157375_11135336 3300013308 Bacteria 915
141 Ga0163163_10000117 3300014325 Bacteria 84938
142 Ga0163163_10178146 3300014325 Bacteria 2173
143 Ga0157380_10719345 3300014326 Bacteria 1006
144 Ga0157380_10966071 3300014326 Bacteria 883
145 Ga0157377_10329311 3300014745 Unclassified 1018
146 Ga0157379_10362599 3300014968 Unclassified 1328
147 Ga0157376_10164691 3300014969 Bacteria 2013
148 Ga0157376_10184113 3300014969 Bacteria 1911
149 Ga0163161_10434101 3300017792 Bacteria 1059
150 Ga0206351_10103036 3300020077 Bacteria 794
151 Ga0213876_10102342 3300021384 Bacteria 1518
152 Ga0213875_10040182 3300021388 Bacteria 2203
153 Ga0224712_10057024 3300022467 Bacteria 1542
154 Ga0209672_101212 3300025228 Bacteria 10412
155 Ga0209258_101181 3300025242 Bacteria 10543
156 Ga0209148_1001605 3300025254 Bacteria 10543
157 Ga0209455_1015655 3300025272 Bacteria 1659
158 Ga0207653_10000386 3300025885 Bacteria 20016
159 Ga0207692_10067057 3300025898 Bacteria 1878
160 Ga0207685_10519862 3300025905 Bacteria 629
161 Ga0207699_10230523 3300025906 Bacteria 1268
162 Ga0207645_10190138 3300025907 Bacteria 1349
163 Ga0207643_10040139 3300025908 Bacteria 2634
164 Ga0207684_10000062 3300025910 Bacteria 202863
165 Ga0207684_10030748 3300025910 Bacteria 4570
166 Ga0207707_10013194 3300025912 Bacteria 7204
167 Ga0207695_10080034 3300025913 Bacteria 3310
168 Ga0207695_10126366 3300025913 Bacteria 2518
169 Ga0207693_10002631 3300025915 Bacteria 15592
170 Ga0207663_10112884 3300025916 Bacteria 1847
171 Ga0207660_10001691 3300025917 Bacteria 14787
172 Ga0207660_10023992 3300025917 Bacteria 4125
173 Ga0207660_10131994 3300025917 Bacteria 1902
174 Ga0207662_10115937 3300025918 Bacteria 1675
175 Ga0207657_10191506 3300025919 Bacteria 1650
176 Ga0207649_10008639 3300025920 Bacteria 5562
177 Ga0207652_10013741 3300025921 Bacteria 6548
178 Ga0207652_10166939 3300025921 Bacteria 1974
179 Ga0207646_11347845 3300025922 Bacteria 622
180 Ga0207646_11376472 3300025922 Bacteria 614
181 Ga0207650_10802452 3300025925 Archaea 798
182 Ga0207659_11396076 3300025926 Bacteria 600
183 Ga0207687_10308182 3300025927 Bacteria 1277
184 Ga0207687_10342783 3300025927 Bacteria 1215
185 Ga0207687_10488175 3300025927 Unclassified 1026
186 Ga0207664_10002315 3300025929 Bacteria 12577
187 Ga0207664_10013315 3300025929 Bacteria 5900
188 Ga0207664_10022587 3300025929 Bacteria 4701
189 Ga0207644_10335322 3300025931 Bacteria 1225
190 Ga0207690_11202316 3300025932 Bacteria 633
191 Ga0207706_10450847 3300025933 Bacteria 1113
192 Ga0207709_10122895 3300025935 Bacteria 1756
193 Ga0207704_11377485 3300025938 Bacteria 604
194 Ga0207665_10154743 3300025939 Bacteria 1645
195 Ga0207711_11012226 3300025941 Bacteria 770
196 Ga0207689_10048609 3300025942 Bacteria 3499
197 Ga0207661_10001159 3300025944 Bacteria 17606
198 Ga0207679_10017849 3300025945 Bacteria 4743
199 Ga0207679_10131179 3300025945 Bacteria 2011
200 Ga0207667_10103616 3300025949 Bacteria 2934
201 Ga0207640_10667624 3300025981 Bacteria 887
202 Ga0207658_10207819 3300025986 Bacteria 1639
203 Ga0207677_11089617 3300026023 Bacteria 728
204 Ga0207703_10037266 3300026035 Bacteria 3873
205 Ga0207678_10030042 3300026067 Bacteria 4744
206 Ga0207708_10170213 3300026075 Bacteria 1725
207 Ga0207708_10867429 3300026075 Bacteria 780
208 Ga0207641_10123631 3300026088 Bacteria 2313
209 Ga0207648_11023239 3300026089 Bacteria 774
210 Ga0207676_10484101 3300026095 Archaea 1172
211 Ga0207674_10003850 3300026116 Bacteria 18292
212 Ga0207674_10012740 3300026116 Bacteria 9394
213 Ga0207674_10587173 3300026116 Bacteria 1076
214 Ga0207675_100204642 3300026118 Bacteria 1897
215 Ga0207675_100839757 3300026118 Bacteria 933
216 Ga0209981_1020138 3300027378 Bacteria 950
217 Ga0209996_1008972 3300027395 Bacteria 1315
218 Ga0207428_10936372 3300027907 Bacteria 611
219 Ga0268265_10649278 3300028380 Bacteria 1014
220 Ga0265334_10173244 3300028573 Bacteria 755
221 Ga0307511_10000440 3300030521 Bacteria 44474
222 Ga0307408_100498043 3300031548 Bacteria 1066
223 Ga0307508_10303174 3300031616 Bacteria 1190
224 Ga0265342_10399935 3300031712 Bacteria 709
225 Ga0316576_10008070 3300031727 Bacteria 6679
226 Ga0307407_10221045 3300031903 Bacteria 1281
227 Ga0307416_100019140 3300032002 Bacteria 4847
228 Ga0316585_10189014 3300032137 Bacteria 680
229 Ga0316212_1016776 3300033547 Bacteria 1032
230 Ga0373929_0000001 3300035085 Bacteria 956023
231 Ga0373941_0067753 3300035115 Bacteria 1178
232 Ga0316574_0895548 3300035398 Unclassified 537
233 Ga0373931_0038219 3300035691 Bacteria 2510
234 Ga0373935_0342103 3300035692 Bacteria 1065
235 Ga0373947_0128490 3300035725 Bacteria 1616
236 Ga0316582_0065283 3300036647 Bacteria 2343
237 Ga0316584_0023446 3300036712 Bacteria 4509
238 Ga0395899_0090904 3300037312 Bacteria 2213
239 Ga0395899_0515024 3300037312 Bacteria 774
240 Ga0395900_0083623 3300037418 Bacteria 3279
241 Ga0395900_1064121 3300037418 Bacteria 727
242 Ga0395898_0010795 3300037466 Bacteria 9542
243 Ga0395898_0165257 3300037466 Bacteria 2117
244 Ga0395898_0394569 3300037466 Bacteria 1319
245 Ga0395905_0007907 3300037471 Bacteria 10518
246 Ga0316581_0165128 3300037588 Bacteria 682
247 Ga0436364_0327167 3300037853 Bacteria 2712
248 Ga0436364_0439489 3300037853 Bacteria 3921
249 Ga0436364_0788202 3300037853 Bacteria 847
250 Ga0436364_1465076 3300037853 Bacteria 3000
251 Ga0395901_0005652 3300038443 Bacteria 12654
252 Ga0395901_0081298 3300038443 Bacteria 3384
253 Ga0395901_0839042 3300038443 Bacteria 905
254 Ga0242420_030284 3300038996 Bacteria 1001
255 Ga0436365_0055010 3300039437 Bacteria 3434
256 Ga0436365_1758140 3300039437 Bacteria 2142
257 Ga0436365_1921928 3300039437 Bacteria 695
258 Ga0436363_0435580 3300039450 Bacteria 675
259 Ga0436363_0781341 3300039450 Bacteria 1023
260 Ga0436363_1188746 3300039450 Bacteria 2036
261 Ga0436363_1470498 3300039450 Bacteria 1874
262 Ga0436362_0870736 3300039453 Bacteria 3945
263 Ga0436362_1275053 3300039453 Bacteria 1063
264 Ga0451839_0854109 3300041496 Bacteria 568
265 Ga0451849_1345845 3300041505 Bacteria 934
266 Ga0439441_106210 3300042001 Bacteria 633
267 Ga0439464_0111766 3300042439 Bacteria 837
268 Ga0453683_0000188 3300044673 Bacteria 85615
269 Ga0453683_0303115 3300044673 Bacteria 1022
270 Ga0466965_0313012 3300044683 Bacteria 854
271 Ga0466961_0001874 3300044693 Bacteria 13062
272 Ga0453684_0003138 3300044712 Bacteria 38044
273 Ga0453684_0006052 3300044712 Bacteria 23377
274 Ga0453684_0027052 3300044712 Bacteria 8246
275 Ga0453684_0067515 3300044712 Bacteria 4547
276 Ga0453684_0188153 3300044712 Bacteria 2417
277 Ga0453684_0291908 3300044712 Bacteria 1856
278 Ga0453684_1304651 3300044712 Bacteria 757
279 Ga0466968_0047362 3300044735 Bacteria 1828
280 Ga0466968_0061872 3300044735 Bacteria 1615
281 Ga0466959_0139862 3300045049 Bacteria 1712
282 Ga0451576_0000782 3300045051 Bacteria 62589
283 Ga0451576_0020041 3300045051 Bacteria 7290
284 Ga0451576_0076460 3300045051 Bacteria 3484
285 Ga0451576_0565129 3300045051 Bacteria 1195
286 Ga0451576_0918337 3300045051 Bacteria 918
287 Ga0451576_0973044 3300045051 Bacteria 890
288 Ga0466967_0450032 3300045976 Bacteria 1258
289 Ga0495603_0032874 3300046455 Bacteria 3121
290 Ga0495653_0178840 3300046463 Bacteria 1458
291 Ga0495608_0446178 3300046511 Bacteria 788
292 Ga0495618_0175969 3300046514 Bacteria 1361
293 Ga0495644_0026862 3300046523 Bacteria 2183
294 Ga0495663_0009496 3300046525 Bacteria 2700
295 Ga0495654_0172332 3300046530 Bacteria 942
296 Ga0495640_0553506 3300046533 Bacteria 697
297 Ga0495588_0079329 3300046674 Bacteria 1713
298 Ga0495657_0640034 3300046675 Bacteria 614
299 Ga0495599_0116242 3300046678 Bacteria 1664
300 Ga0495646_0115661 3300046680 Bacteria 1523
301 Ga0495604_0699491 3300047317 Bacteria 644
302 Ga0495684_0350285 3300047471 Bacteria 1048
303 Ga0496100_0070653 3300048903 Bacteria 2328
304 Ga0496101_0003856 3300048904 Bacteria 9375
305 Ga0496101_0109689 3300048904 Bacteria 2076
306 Ga0496101_0323769 3300048904 Bacteria 1209
307 Ga0496101_0951122 3300048904 Archaea 676
308 Ga0496102_0026074 3300048905 Bacteria 5209
309 Ga0496102_0712909 3300048905 Bacteria 926
310 Ga0496103_0054873 3300048906 Bacteria 2470
311 Ga0496104_0060222 3300048907 Bacteria 3596
312 Ga0496104_0258459 3300048907 Bacteria 1654
313 Ga0496105_0009593 3300048908 Bacteria 7575
314 Ga0496105_0056697 3300048908 Bacteria 3234
315 Ga0496106_0844293 3300048909 Unclassified 725
316 Ga0496107_0146036 3300048910 Bacteria 1749
317 Ga0496107_0469988 3300048910 Bacteria 933
318 Ga0496108_0513267 3300048911 Bacteria 1046
319 Ga0496109_0093935 3300048912 Bacteria 2776
320 Ga0496110_0021396 3300048913 Bacteria 5475
321 Ga0496110_0647885 3300048913 Bacteria 956
322 Ga0496111_0006116 3300048914 Bacteria 7788
323 Ga0496111_0048976 3300048914 Bacteria 3046
324 Ga0496112_0318966 3300048915 Bacteria 1498
325 Ga0496112_1411170 3300048915 Bacteria 611
326 Ga0496113_0013610 3300048916 Bacteria 5520
327 Ga0496113_0071578 3300048916 Bacteria 2637
328 Ga0496113_0078936 3300048916 Bacteria 2519
329 Ga0496114_0043327 3300048917 Bacteria 3731
330 Ga0496114_0259234 3300048917 Bacteria 1531
331 Ga0496114_0715259 3300048917 Bacteria 877
332 Ga0496115_0074369 3300048918 Bacteria 2758
333 Ga0501032_0010329 3300049569 Bacteria 6735
334 Ga0501033_0031886 3300049570 Bacteria 3956
335 Ga0501034_0055268 3300049571 Bacteria 3995
336 Ga0501036_0016656 3300049572 Bacteria 6137
337 Ga0501036_0250974 3300049572 Bacteria 1483
338 Ga0501037_0005595 3300049573 Bacteria 9158
339 Ga0501038_0011979 3300049574 Bacteria 7917
340 Ga0501038_0264948 3300049574 Bacteria 1357
341 Ga0501039_0064452 3300049575 Bacteria 2840
342 Ga0501039_0152763 3300049575 Bacteria 1814
343 Ga0501040_0161516 3300049576 Bacteria 1584
344 Ga0501041_0121426 3300049577 Bacteria 1624
345 Ga0501042_0241215 3300049578 Bacteria 1304
346 Ga0501042_0260349 3300049578 Bacteria 1252
347 Ga0501046_0004534 3300049580 Bacteria 12584
348 Ga0501046_0294526 3300049580 Bacteria 1186
349 Ga0501047_0093591 3300049581 Bacteria 2884
350 Ga0501048_0046410 3300049582 Bacteria 3101
351 Ga0501048_0124405 3300049582 Bacteria 1823
352 Ga0501069_0452128 3300049585 Bacteria 763
353 Ga0501070_0017289 3300049586 Bacteria 6056
354 Ga0501070_0031749 3300049586 Bacteria 4425
355 Ga0501071_0084401 3300049587 Bacteria 2328
356 Ga0501072_0154415 3300049588 Bacteria 1830
357 Ga0501073_0279602 3300049589 Bacteria 1152
358 Ga0501075_0096944 3300049591 Bacteria 2238
359 Ga0501076_0048211 3300049592 Bacteria 3368
360 Ga0501077_0325183 3300049593 Bacteria 980
361 Ga0501079_0071289 3300049741 Bacteria 2684
362 Ga0501080_0207190 3300049742 Bacteria 1798
363 Ga0501080_0379844 3300049742 Bacteria 1273
364 Ga0501035_0125979 3300049822 Bacteria 2236
365 Ga0501035_0872942 3300049822 Bacteria 714
366 Ga0501045_0289750 3300049824 Archaea 1218
367 nmdc:mga05p37_60173_c1 3300050507 Bacteria 4677
368 nmdc:mga05p37_7633_c1 3300050507 Bacteria 12764
369 nmdc:mga05p37_8190_c1 3300050507 Bacteria 12357
370 nmdc:mga09592_1589_c1 3300050508 Bacteria 18292
371 nmdc:mga0qj67_587237_c1 3300050509 Bacteria 892
372 nmdc:mga06r32_15399_c1 3300050510 Bacteria 6945
373 nmdc:mga08y16_431227_c1 3300050511 Bacteria 1346
374 nmdc:mga08y16_701221_c1 3300050511 Bacteria 1012
375 nmdc:mga0n895_1393374_c1 3300050512 Bacteria 670
376 nmdc:mga0rr50_109249_c1 3300050513 Bacteria 1023
377 nmdc:mga0rr50_309489_c1 3300050513 Bacteria 1323
378 nmdc:mga0rr50_462807_c1 3300050513 Bacteria 1076
379 nmdc:mga08x19_217378_c1 3300050514 Bacteria 1313
380 nmdc:mga08x19_33814_c1 3300050514 Bacteria 3228
381 nmdc:mga0a205_106101_c1 3300050515 Bacteria 1650
382 nmdc:mga0a205_1102477_c1 3300050515 Unclassified 641
383 Ga0495612_0172384 3300053078 Bacteria 948
384 Ga0500642_0005252 3300053130 Bacteria 4163
385 Ga0501082_0176590 3300060353 Bacteria 1857
386 Ga0466962_0304087 3300061719 Unclassified 789
387 Ga0530510_0094895 3300061734 Bacteria 2179
388 Ga0466958_0274840
389 Ga0055535_1001669
390 Ga0055542_1001618
391 Ga0065704_10229226
392 Ga0065715_10012495
393 Ga0065715_10093811
394 Ga0065707_10150606
395 Ga0070658_10543807
396 Ga0070683_100066525
397 Ga0070670_100315508
398 Ga0070670_100424930
399 Ga0070666_10679184
400 Ga0070680_101135090
401 Ga0070682_100834676
402 Ga0070660_100195524
403 Ga0070689_100987018
404 Ga0070687_100204447
405 Ga0070687_100305327
406 Ga0070692_10064705
407 Ga0070692_10122002
408 Ga0070671_100309331
409 Ga0070671_100346952
410 Ga0070659_100193443
411 Ga0070667_100271684
412 Ga0070703_10019631
413 Ga0070709_10028886
414 Ga0070714_100004304
415 Ga0070714_100031591
416 Ga0070714_100063643
417 Ga0070713_101527387
418 Ga0070713_101861613
419 Ga0070710_10009066
420 Ga0070710_10218917
421 Ga0070711_100195128
422 Ga0070705_100042655
423 Ga0070705_100587540
424 Ga0070694_100080433
425 Ga0070708_100028679
426 Ga0070708_100587005
427 Ga0070708_100826160
428 Ga0070663_100333793
429 Ga0070662_100449861
430 Ga0070681_10017365
431 Ga0070681_10173639
432 Ga0068867_100385011
433 Ga0070706_100085416
434 Ga0070707_101821198
435 Ga0070698_100092014
436 Ga0070699_100306226
437 Ga0070699_100783325
438 Ga0070679_100012685
439 Ga0070679_100138378
440 Ga0070679_100385012
441 Ga0070684_100010072
442 Ga0070684_100872125
443 Ga0070697_100128625
444 Ga0070697_100520388
445 Ga0070672_100203075
446 Ga0070695_100050354
447 Ga0070695_100166357
448 Ga0070695_100301945
449 Ga0070696_100022104
450 Ga0070696_100062850
451 Ga0070696_100071217
452 Ga0070704_100385753
453 Ga0068855_100119095
454 Ga0070664_100012165
455 Ga0070664_100172851
456 Ga0068857_100007402
457 Ga0068857_100024622
458 Ga0068857_100191041
459 Ga0068854_101663558
460 Ga0068852_100172798
461 Ga0068859_100429252
462 Ga0068859_101504991
463 Ga0068864_100269009
464 Ga0068870_10044981
465 Ga0068858_100010011
466 Ga0068860_100142117
467 Ga0068862_100503525
468 Ga0081455_10005492
469 Ga0081538_10005381
470 Ga0081538_10010307
471 Ga0081538_10080777
472 Ga0070715_10021641
473 Ga0097621_100008663
474 Ga0068871_100024662
475 Ga0075428_100053747
476 Ga0075428_100199283
477 Ga0075431_100013859
478 Ga0075433_10079645
479 Ga0075433_10609717
480 Ga0075434_101760590
481 Ga0075429_100001268
482 Ga0068865_100877466
483 Ga0075436_100648562
484 Ga0075436_100840602
485 Ga0097620_100429230
486 Ga0097620_101505234
487 Ga0075435_100260512
488 Ga0075435_100300151
489 Ga0075435_100328333
490 Ga0105240_10075246
491 Ga0105240_10496651
492 Ga0111539_10534072
493 Ga0111539_10959066
494 Ga0105245_10138531
495 Ga0105245_10721835
496 Ga0105245_11383665
497 Ga0114129_10002047
498 Ga0114129_10009524
499 Ga0105243_10178322
500 Ga0105243_10266279
501 Ga0105243_11191206
502 Ga0105243_11518802
503 Ga0105242_10165438
504 Ga0105242_10341375
505 Ga0105242_10987476
506 Ga0105248_10526673
507 Ga0105237_10273164
508 Ga0105237_11414192
509 Ga0105249_10703445
510 Ga0105239_10473789
511 Ga0105239_10513941
512 Ga0105239_10802255
513 Ga0105239_10956253
514 Ga0105239_13035184
515 Ga0157373_10763374
516 Ga0157373_10785981
517 Ga0157369_10030764
518 Ga0157369_10244792
519 Ga0157374_10209564
520 Ga0157378_10510552
521 Ga0157378_10567712
522 Ga0157378_10724695
523 Ga0163162_10030639
524 Ga0163162_11482996
525 Ga0157372_10061239
526 Ga0157375_10424267
527 Ga0157375_11135336
528 Ga0163163_10000117
529 Ga0163163_10178146
530 Ga0157380_10719345
531 Ga0157380_10966071
532 Ga0157377_10329311
533 Ga0157379_10362599
534 Ga0157376_10164691
535 Ga0157376_10184113
536 Ga0163161_10434101
537 Ga0206351_10103036
538 Ga0213876_10102342
539 Ga0213875_10040182
540 Ga0224712_10057024
541 Ga0209672_101212
542 Ga0209258_101181
543 Ga0209148_1001605
544 Ga0209455_1015655
545 Ga0207653_10000386
546 Ga0207692_10067057
547 Ga0207685_10519862
548 Ga0207699_10230523
549 Ga0207645_10190138
550 Ga0207643_10040139
551 Ga0207684_10000062
552 Ga0207684_10030748
553 Ga0207707_10013194
554 Ga0207695_10080034
555 Ga0207695_10126366
556 Ga0207693_10002631
557 Ga0207663_10112884
558 Ga0207660_10001691
559 Ga0207660_10023992
560 Ga0207660_10131994
561 Ga0207662_10115937
562 Ga0207657_10191506
563 Ga0207649_10008639
564 Ga0207652_10013741
565 Ga0207652_10166939
566 Ga0207646_11347845
567 Ga0207646_11376472
568 Ga0207650_10802452
569 Ga0207659_11396076
570 Ga0207687_10308182
571 Ga0207687_10342783
572 Ga0207687_10488175
573 Ga0207664_10002315
574 Ga0207664_10013315
575 Ga0207664_10022587
576 Ga0207644_10335322
577 Ga0207690_11202316
578 Ga0207706_10450847
579 Ga0207709_10122895
580 Ga0207704_11377485
581 Ga0207665_10154743
582 Ga0207711_11012226
583 Ga0207689_10048609
584 Ga0207661_10001159
585 Ga0207679_10017849
586 Ga0207679_10131179
587 Ga0207667_10103616
588 Ga0207640_10667624
589 Ga0207658_10207819
590 Ga0207677_11089617
591 Ga0207703_10037266
592 Ga0207678_10030042
593 Ga0207708_10170213
594 Ga0207708_10867429
595 Ga0207641_10123631
596 Ga0207648_11023239
597 Ga0207676_10484101
598 Ga0207674_10003850
599 Ga0207674_10012740
600 Ga0207674_10587173
601 Ga0207675_100204642
602 Ga0207675_100839757
603 Ga0209981_1020138
604 Ga0209996_1008972
605 Ga0207428_10936372
606 Ga0268265_10649278
607 Ga0265334_10173244
608 Ga0307511_10000440
609 Ga0307408_100498043
610 Ga0307508_10303174
611 Ga0265342_10399935
612 Ga0316576_10008070
613 Ga0307407_10221045
614 Ga0307416_100019140
615 Ga0316585_10189014
616 Ga0316212_1016776
617 Ga0373929_0000001
618 Ga0373941_0067753
619 Ga0316574_0895548
620 Ga0373931_0038219
621 Ga0373935_0342103
622 Ga0373947_0128490
623 Ga0316582_0065283
624 Ga0316584_0023446
625 Ga0395899_0090904
626 Ga0395899_0515024
627 Ga0395900_0083623
628 Ga0395900_1064121
629 Ga0395898_0010795
630 Ga0395898_0165257
631 Ga0395898_0394569
632 Ga0395905_0007907
633 Ga0316581_0165128
634 Ga0436364_0327167
635 Ga0436364_0439489
636 Ga0436364_0788202
637 Ga0436364_1465076
638 Ga0395901_0005652
639 Ga0395901_0081298
640 Ga0395901_0839042
641 Ga0242420_030284
642 Ga0436365_0055010
643 Ga0436365_1758140
644 Ga0436365_1921928
645 Ga0436363_0435580
646 Ga0436363_0781341
647 Ga0436363_1188746
648 Ga0436363_1470498
649 Ga0436362_0870736
650 Ga0436362_1275053
651 Ga0451839_0854109
652 Ga0451849_1345845
653 Ga0439441_106210
654 Ga0439464_0111766
655 Ga0453683_0000188
656 Ga0453683_0303115
657 Ga0466965_0313012
658 Ga0466961_0001874
659 Ga0453684_0003138
660 Ga0453684_0006052
661 Ga0453684_0027052
662 Ga0453684_0067515
663 Ga0453684_0188153
664 Ga0453684_0291908
665 Ga0453684_1304651
666 Ga0466968_0047362
667 Ga0466968_0061872
668 Ga0466959_0139862
669 Ga0451576_0000782
670 Ga0451576_0020041
671 Ga0451576_0076460
672 Ga0451576_0565129
673 Ga0451576_0918337
674 Ga0451576_0973044
675 Ga0466967_0450032
676 Ga0495603_0032874
677 Ga0495653_0178840
678 Ga0495608_0446178
679 Ga0495618_0175969
680 Ga0495644_0026862
681 Ga0495663_0009496
682 Ga0495654_0172332
683 Ga0495640_0553506
684 Ga0495588_0079329
685 Ga0495657_0640034
686 Ga0495599_0116242
687 Ga0495646_0115661
688 Ga0495604_0699491
689 Ga0495684_0350285
690 Ga0496100_0070653
691 Ga0496101_0003856
692 Ga0496101_0109689
693 Ga0496101_0323769
694 Ga0496101_0951122
695 Ga0496102_0026074
696 Ga0496102_0712909
697 Ga0496103_0054873
698 Ga0496104_0060222
699 Ga0496104_0258459
700 Ga0496105_0009593
701 Ga0496105_0056697
702 Ga0496106_0844293
703 Ga0496107_0146036
704 Ga0496107_0469988
705 Ga0496108_0513267
706 Ga0496109_0093935
707 Ga0496110_0021396
708 Ga0496110_0647885
709 Ga0496111_0006116
710 Ga0496111_0048976
711 Ga0496112_0318966
712 Ga0496112_1411170
713 Ga0496113_0013610
714 Ga0496113_0071578
715 Ga0496113_0078936
716 Ga0496114_0043327
717 Ga0496114_0259234
718 Ga0496114_0715259
719 Ga0496115_0074369
720 Ga0501032_0010329
721 Ga0501033_0031886
722 Ga0501034_0055268
723 Ga0501036_0016656
724 Ga0501036_0250974
725 Ga0501037_0005595
726 Ga0501038_0011979
727 Ga0501038_0264948
728 Ga0501039_0064452
729 Ga0501039_0152763
730 Ga0501040_0161516
731 Ga0501041_0121426
732 Ga0501042_0241215
733 Ga0501042_0260349
734 Ga0501046_0004534
735 Ga0501046_0294526
736 Ga0501047_0093591
737 Ga0501048_0046410
738 Ga0501048_0124405
739 Ga0501069_0452128
740 Ga0501070_0017289
741 Ga0501070_0031749
742 Ga0501071_0084401
743 Ga0501072_0154415
744 Ga0501073_0279602
745 Ga0501075_0096944
746 Ga0501076_0048211
747 Ga0501077_0325183
748 Ga0501079_0071289
749 Ga0501080_0207190
750 Ga0501080_0379844
751 Ga0501035_0125979
752 Ga0501035_0872942
753 Ga0501045_0289750
754 nmdc:mga05p37_60173_c1
755 nmdc:mga05p37_7633_c1
756 nmdc:mga05p37_8190_c1
757 nmdc:mga09592_1589_c1
758 nmdc:mga0qj67_587237_c1
759 nmdc:mga06r32_15399_c1
760 nmdc:mga08y16_431227_c1
761 nmdc:mga08y16_701221_c1
762 nmdc:mga0n895_1393374_c1
763 nmdc:mga0rr50_109249_c1
764 nmdc:mga0rr50_309489_c1
765 nmdc:mga0rr50_462807_c1
766 nmdc:mga08x19_217378_c1
767 nmdc:mga08x19_33814_c1
768 nmdc:mga0a205_106101_c1
769 nmdc:mga0a205_1102477_c1
770 Ga0495612_0172384
771 Ga0500642_0005252
772 Ga0501082_0176590
773 Ga0466962_0304087
774 Ga0530510_0094895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyc-assembly4.cif.gz_A glycosylation associate protein (gap123) complex from streptococcus agalactiae 0.6676 82 120
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.656 54 149
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6191 56 153
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6139 68 156
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.567 58 147
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7483 52 157 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.695 52 157 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6436 54 150 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6409 65 155 3.90.1150.30
af_Q9VUW4_2_152_3.30.540.10 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.6386 91 136 3.30.540.10
ID Description Score Start End GO Terms
AF-F0T5S3-F1-model_v4 Uncharacterized protein 0.9934 50 157
AF-A0A7W1IU15-F1-model_v4 DUF1801 domain-containing protein 0.9921 46 157
AF-K7QUU8-F1-model_v4 Uncharacterized protein 0.9902 51 155
AF-A0A352B0M9-F1-model_v4 DUF1801 domain-containing protein 0.9857 99 157
AF-A0A4V0XH56-F1-model_v4 YdhG-like domain-containing protein 0.9827 83 157

Map