F430672

General Info

Members Datasets Scaffolds Average Seq Length
386 239 773 150

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0104538|Ga0500651_0104538_923_1483
Length 167
Sequence MVLTIEFLDAKKLGIMLSHLRTMWLVFLHLFHKTETIEYPEEKVDLHPRYRGRIVLTKDPDGGERCVGCYLCAVACPVDCIALQATENEEGRRYPEFFRINFLIPDFEMAEYNRQNLVFEKEDLLIDSQGKYPGYNFYRVAGLDAGVKKKGEGVNEEPPVDVHSLLP

Samples

Sample ID Description Type Environment
1 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
160 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
161 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
162 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
163 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
185 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
186 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
187 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
189 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
192 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
193 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
194 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
195 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
196 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
197 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
216 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
217 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
236 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.52
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.92
Nodule 0
Rhizoplane 1.3
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500651_0104538 3300053093 Bacteria 1734
2 JGI25154J39366_1000012 3300002738 Bacteria 287601
3 JGI25153J46596_10020620 3300003215 Bacteria 2486
4 JGI25153J46596_10055758 3300003215 Bacteria 1104
5 rootH1_10001358 3300003316 Bacteria 7048
6 rootH1_10001358 3300003323 Bacteria 19131
7 rootH2_10026952 3300003320 Bacteria 10112
8 rootH2_10050527 3300003320 Bacteria 4458
9 rootH2_10071588 3300003320 Bacteria 2191
10 rootH2_10119664 3300003320 Bacteria 5311
11 rootH2_10131334 3300003320 Bacteria 8142
12 rootH2_10146174 3300003320 Bacteria 3403
13 rootL2_10004720 3300003322 Bacteria 8006
14 rootL2_10004727 3300003322 Bacteria 5982
15 rootL2_10112202 3300003322 Bacteria 2375
16 rootH1_10000733 3300003323 Bacteria 30372
17 rootH1_10020572 3300003323 Bacteria 27768
18 rootH1_10036441 3300003323 Bacteria 2226
19 rootH1_10084927 3300003323 Bacteria 4528
20 JGI25160J50197_1001111 3300003354 Bacteria 13736
21 JGI25160J50197_1011994 3300003354 Bacteria 3038
22 Ga0055526_1009150 3300003771 Bacteria 4814
23 Ga0055526_1033256 3300003771 Bacteria 1436
24 Ga0055536_1009384 3300003781 Bacteria 4047
25 Ga0055528_1000651 3300003790 Bacteria 25262
26 Ga0055530_10001819 3300003791 Bacteria 14745
27 Ga0055531_10032712 3300003794 Bacteria 1692
28 Ga0055543_1006346 3300004625 Bacteria 2867
29 Ga0065165_1000228 3300005262 Bacteria 98736
30 Ga0065165_1000314 3300005262 Bacteria 79288
31 Ga0065165_1018574 3300005262 Bacteria 2512
32 Ga0065714_10064566 3300005288 Bacteria 35252
33 Ga0065714_10295303 3300005288 Bacteria 702
34 Ga0065704_10216266 3300005289 Bacteria 1090
35 Ga0065715_10208549 3300005293 Bacteria 1325
36 Ga0065707_10096838 3300005295 Bacteria 3228
37 Ga0070676_10026535 3300005328 Bacteria 3280
38 Ga0070676_10476883 3300005328 Bacteria 882
39 Ga0070676_10591242 3300005328 Bacteria 799
40 Ga0070690_100154861 3300005330 Bacteria 1566
41 Ga0070690_100455457 3300005330 Bacteria 949
42 Ga0070670_100018623 3300005331 Bacteria 5949
43 Ga0068869_100056964 3300005334 Bacteria 2852
44 Ga0070666_10000065 3300005335 Bacteria 79454
45 Ga0070666_11153635 3300005335 Bacteria 577
46 Ga0070680_100123087 3300005336 Unclassified 2166
47 Ga0070680_100226329 3300005336 Bacteria 1579
48 Ga0068868_100047832 3300005338 Bacteria 3354
49 Ga0068868_100762669 3300005338 Bacteria 870
50 Ga0070668_100034515 3300005347 Bacteria 3855
51 Ga0070668_100250702 3300005347 Bacteria 1469
52 Ga0070669_100009015 3300005353 Bacteria 7116
53 Ga0070675_100009558 3300005354 Bacteria 7544
54 Ga0070675_100022985 3300005354 Bacteria 4981
55 Ga0070671_100349042 3300005355 Bacteria 1263
56 Ga0070673_100034505 3300005364 Bacteria 3829
57 Ga0070659_100035190 3300005366 Bacteria 3899
58 Ga0070667_100049859 3300005367 Bacteria 3527
59 Ga0070713_100000623 3300005436 Bacteria 22612
60 Ga0070710_10247160 3300005437 Bacteria 1145
61 Ga0070701_10063422 3300005438 Bacteria 1955
62 Ga0070711_100283704 3300005439 Bacteria 1311
63 Ga0070694_100282899 3300005444 Bacteria 1265
64 Ga0070662_100441169 3300005457 Bacteria 1079
65 Ga0070681_10006121 3300005458 Bacteria 11678
66 Ga0070681_10194533 3300005458 Bacteria 1947
67 Ga0070681_10221627 3300005458 Bacteria 1806
68 Ga0070681_10634960 3300005458 Bacteria 983
69 Ga0068867_100215625 3300005459 Bacteria 1544
70 Ga0070685_10171818 3300005466 Bacteria 1389
71 Ga0070685_10314483 3300005466 Bacteria 1059
72 Ga0070679_100130092 3300005530 Bacteria 2498
73 Ga0070679_100430910 3300005530 Bacteria 1264
74 Ga0070679_100627617 3300005530 Bacteria 1018
75 Ga0070684_100063593 3300005535 Unclassified 3235
76 Ga0068853_100000812 3300005539 Bacteria 21780
77 Ga0070672_100383302 3300005543 Bacteria 1203
78 Ga0070665_101034033 3300005548 Bacteria 833
79 Ga0068855_100001589 3300005563 Bacteria 28536
80 Ga0068855_100176529 3300005563 Bacteria 2417
81 Ga0068855_100439559 3300005563 Bacteria 1425
82 Ga0068855_100742730 3300005563 Unclassified 1047
83 Ga0068855_101493073 3300005563 Bacteria 694
84 Ga0070664_100089657 3300005564 Bacteria 2661
85 Ga0068857_100011885 3300005577 Bacteria 7573
86 Ga0068857_100658392 3300005577 Bacteria 993
87 Ga0068857_100853920 3300005577 Bacteria 871
88 Ga0068854_101106222 3300005578 Bacteria 706
89 Ga0068856_100001626 3300005614 Bacteria 23530
90 Ga0068852_100278436 3300005616 Bacteria 1612
91 Ga0068852_100814603 3300005616 Bacteria 948
92 Ga0068859_100000006 3300005617 Bacteria 421509
93 Ga0068859_100003188 3300005617 Bacteria 16689
94 Ga0068859_100479145 3300005617 Bacteria 1340
95 Ga0068864_100111516 3300005618 Bacteria 2437
96 Ga0068864_100252819 3300005618 Bacteria 1637
97 Ga0068861_100003290 3300005719 Bacteria 10697
98 Ga0068851_10158629 3300005834 Bacteria 1241
99 Ga0068851_10166890 3300005834 Unclassified 1212
100 Ga0068870_10036311 3300005840 Bacteria 2535
101 Ga0068863_100030615 3300005841 Bacteria 5138
102 Ga0068858_100004383 3300005842 Bacteria 13849
103 Ga0068860_100000892 3300005843 Bacteria 33124
104 Ga0068860_100073829 3300005843 Bacteria 3243
105 Ga0068860_101093956 3300005843 Unclassified 816
106 Ga0068862_100004985 3300005844 Bacteria 11178
107 Ga0081539_10002362 3300005985 Bacteria 27082
108 Ga0075366_10896890 3300006195 Bacteria 552
109 Ga0097621_100000388 3300006237 Bacteria 30619
110 Ga0068871_100000605 3300006358 Bacteria 24663
111 Ga0068871_100081968 3300006358 Bacteria 2674
112 Ga0068871_100568326 3300006358 Bacteria 1028
113 Ga0075428_100327405 3300006844 Bacteria 1646
114 Ga0075433_11060675 3300006852 Bacteria 705
115 Ga0075429_100479610 3300006880 Bacteria 1090
116 Ga0097620_100000006 3300006931 Bacteria 421509
117 Ga0097620_100003188 3300006931 Bacteria 16689
118 Ga0097620_100479167 3300006931 Bacteria 1340
119 Ga0105240_10000270 3300009093 Bacteria 102445
120 Ga0105240_10005642 3300009093 Bacteria 18581
121 Ga0105240_10079091 3300009093 Bacteria 4047
122 Ga0105240_10839754 3300009093 Bacteria 992
123 Ga0111539_10007482 3300009094 Bacteria 13985
124 Ga0111539_10440532 3300009094 Bacteria 1517
125 Ga0111539_10477375 3300009094 Bacteria 1452
126 Ga0111539_10526532 3300009094 Unclassified 1377
127 Ga0105247_10064535 3300009101 Bacteria 2275
128 Ga0105247_10261397 3300009101 Unclassified 1187
129 Ga0114129_10009523 3300009147 Bacteria 13857
130 Ga0105243_10037236 3300009148 Bacteria 3779
131 Ga0105243_10183614 3300009148 Bacteria 1821
132 Ga0105241_10000243 3300009174 Bacteria 41390
133 Ga0105241_10193456 3300009174 Bacteria 1694
134 Ga0105241_10301523 3300009174 Unclassified 1375
135 Ga0105241_10663731 3300009174 Bacteria 948
136 Ga0105242_10025150 3300009176 Bacteria 4708
137 Ga0105248_11352028 3300009177 Bacteria 806
138 Ga0105237_10000028 3300009545 Bacteria 201366
139 Ga0105237_10034086 3300009545 Bacteria 5157
140 Ga0105237_10049708 3300009545 Bacteria 4214
141 Ga0105237_10106146 3300009545 Bacteria 2800
142 Ga0105237_10146370 3300009545 Unclassified 2357
143 Ga0105238_10001178 3300009551 Bacteria 26295
144 Ga0105249_10011570 3300009553 Bacteria 7754
145 Ga0105249_10019620 3300009553 Bacteria 6034
146 Ga0105249_10059763 3300009553 Bacteria 3496
147 Ga0105249_11412344 3300009553 Bacteria 768
148 Ga0105239_10054730 3300010375 Bacteria 4377
149 Ga0105239_10107855 3300010375 Bacteria 3085
150 Ga0105239_10148970 3300010375 Unclassified 2611
151 Ga0105239_11080266 3300010375 Bacteria 923
152 Ga0105239_11248999 3300010375 Bacteria 856
153 Ga0105246_10012495 3300011119 Bacteria 5302
154 Ga0157373_10142514 3300013100 Bacteria 1685
155 Ga0157371_10020956 3300013102 Bacteria 4807
156 Ga0157371_10626196 3300013102 Bacteria 802
157 Ga0157370_10380560 3300013104 Bacteria 1300
158 Ga0157369_10000576 3300013105 Bacteria 48006
159 Ga0157374_10002933 3300013296 Bacteria 14293
160 Ga0157374_10090740 3300013296 Bacteria 2913
161 Ga0157374_10613889 3300013296 Bacteria 1098
162 Ga0157378_10000559 3300013297 Bacteria 35439
163 Ga0157378_10022035 3300013297 Bacteria 5605
164 Ga0163162_10001384 3300013306 Bacteria 22574
165 Ga0163162_10005503 3300013306 Bacteria 12240
166 Ga0157372_10189994 3300013307 Bacteria 2379
167 Ga0157372_10998167 3300013307 Bacteria 970
168 Ga0157372_11154416 3300013307 Bacteria 896
169 Ga0157375_10022462 3300013308 Bacteria 5806
170 Ga0157375_10027402 3300013308 Bacteria 5325
171 Ga0157375_10077518 3300013308 Bacteria 3354
172 Ga0163163_10052142 3300014325 Bacteria 4035
173 Ga0157380_10005194 3300014326 Bacteria 9098
174 Ga0157380_11922971 3300014326 Bacteria 652
175 Ga0182008_10081662 3300014497 Bacteria 1591
176 Ga0157377_10003373 3300014745 Bacteria 7225
177 Ga0157379_10023670 3300014968 Bacteria 5452
178 Ga0157379_10231320 3300014968 Bacteria 1675
179 Ga0157376_10109996 3300014969 Bacteria 2423
180 Ga0157376_10135306 3300014969 Bacteria 2204
181 Ga0182007_10018834 3300015262 Bacteria 2495
182 Ga0182007_10187757 3300015262 Unclassified 717
183 Ga0209436_105857 3300025208 Bacteria 2765
184 Ga0209646_1000009 3300025246 Bacteria 652154
185 Ga0209646_1012298 3300025246 Bacteria 1315
186 Ga0209026_1000197 3300025250 Bacteria 84123
187 Ga0209673_1000016 3300025273 Bacteria 506202
188 Ga0209130_1002680 3300025284 Bacteria 8488
189 Ga0209676_1001661 3300025292 Bacteria 19377
190 Ga0209564_1002601 3300025295 Bacteria 13834
191 Ga0209564_1004678 3300025295 Bacteria 8214
192 Ga0209758_1031044 3300025297 Bacteria 2200
193 Ga0209050_1000124 3300025298 Bacteria 194022
194 Ga0207426_1000139 3300025302 Bacteria 195835
195 Ga0207426_1000477 3300025302 Bacteria 61236
196 Ga0207426_1002062 3300025302 Bacteria 13971
197 Ga0207426_1060581 3300025302 Bacteria 1090
198 Ga0209051_1026812 3300025303 Bacteria 2312
199 Ga0209257_1000064 3300025304 Bacteria 356803
200 Ga0209257_1008236 3300025304 Bacteria 6004
201 Ga0207697_10117805 3300025315 Bacteria 1141
202 Ga0207656_10100943 3300025321 Bacteria 1323
203 Ga0207710_10089539 3300025900 Bacteria 1438
204 Ga0207680_10000111 3300025903 Bacteria 37377
205 Ga0207647_10399962 3300025904 Bacteria 774
206 Ga0207645_10064719 3300025907 Bacteria 2336
207 Ga0207645_10473468 3300025907 Bacteria 846
208 Ga0207643_10135718 3300025908 Bacteria 1467
209 Ga0207654_10011788 3300025911 Bacteria 4464
210 Ga0207654_10096933 3300025911 Bacteria 1810
211 Ga0207707_10000209 3300025912 Bacteria 62333
212 Ga0207695_10000280 3300025913 Bacteria 126470
213 Ga0207695_10061785 3300025913 Bacteria 3871
214 Ga0207695_10312336 3300025913 Unclassified 1462
215 Ga0207671_10003133 3300025914 Bacteria 16799
216 Ga0207671_10007278 3300025914 Bacteria 9628
217 Ga0207671_10624040 3300025914 Bacteria 859
218 Ga0207660_10100964 3300025917 Unclassified 2155
219 Ga0207657_10696464 3300025919 Bacteria 789
220 Ga0207681_10015529 3300025923 Bacteria 4750
221 Ga0207694_10003386 3300025924 Bacteria 12699
222 Ga0207650_10281839 3300025925 Bacteria 1353
223 Ga0207659_10015075 3300025926 Bacteria 4999
224 Ga0207659_10102324 3300025926 Bacteria 2162
225 Ga0207700_10106376 3300025928 Unclassified 2249
226 Ga0207664_10010337 3300025929 Bacteria 6592
227 Ga0207706_10041505 3300025933 Bacteria 4079
228 Ga0207686_10136483 3300025934 Bacteria 1690
229 Ga0207691_10141694 3300025940 Bacteria 2118
230 Ga0207689_10002127 3300025942 Bacteria 18634
231 Ga0207689_10018902 3300025942 Bacteria 5811
232 Ga0207661_10106075 3300025944 Unclassified 2368
233 Ga0207679_10018350 3300025945 Bacteria 4685
234 Ga0207667_10000649 3300025949 Bacteria 45035
235 Ga0207667_10129037 3300025949 Bacteria 2604
236 Ga0207667_10138786 3300025949 Bacteria 2503
237 Ga0207667_10447413 3300025949 Unclassified 1313
238 Ga0207667_10684321 3300025949 Bacteria 1029
239 Ga0207651_10007998 3300025960 Bacteria 5676
240 Ga0207651_11201313 3300025960 Bacteria 681
241 Ga0207651_11280291 3300025960 Bacteria 659
242 Ga0207712_10162542 3300025961 Bacteria 1737
243 Ga0207712_10294959 3300025961 Bacteria 1328
244 Ga0207668_10050016 3300025972 Bacteria 2877
245 Ga0207668_10366832 3300025972 Bacteria 1208
246 Ga0207658_10241233 3300025986 Bacteria 1531
247 Ga0207658_11563267 3300025986 Bacteria 603
248 Ga0207677_10022080 3300026023 Bacteria 3904
249 Ga0207677_10727928 3300026023 Bacteria 882
250 Ga0207703_10001345 3300026035 Bacteria 22504
251 Ga0207639_10033307 3300026041 Bacteria 3800
252 Ga0207639_10377931 3300026041 Bacteria 1272
253 Ga0207708_10260725 3300026075 Bacteria 1399
254 Ga0207702_10001485 3300026078 Bacteria 23209
255 Ga0207702_10631559 3300026078 Bacteria 1052
256 Ga0207641_10000122 3300026088 Bacteria 113915
257 Ga0207648_10055688 3300026089 Unclassified 3452
258 Ga0207648_10378877 3300026089 Bacteria 1279
259 Ga0207648_10587484 3300026089 Bacteria 1026
260 Ga0207648_10879187 3300026089 Bacteria 836
261 Ga0207676_10264180 3300026095 Bacteria 1555
262 Ga0207674_10035926 3300026116 Bacteria 5168
263 Ga0207674_10125239 3300026116 Bacteria 2535
264 Ga0207674_10962949 3300026116 Bacteria 822
265 Ga0207674_11104432 3300026116 Bacteria 762
266 Ga0207675_100001778 3300026118 Bacteria 21552
267 Ga0207675_100728787 3300026118 Unclassified 1002
268 Ga0207698_10012022 3300026142 Bacteria 5642
269 Ga0207698_10797311 3300026142 Bacteria 946
270 Ga0209974_10059322 3300027876 Bacteria 1294
271 Ga0207428_10102352 3300027907 Bacteria 2212
272 Ga0268265_10005911 3300028380 Bacteria 8338
273 Ga0268264_10009662 3300028381 Bacteria 7991
274 Ga0268264_10059668 3300028381 Bacteria 3196
275 Ga0268264_10253187 3300028381 Unclassified 1637
276 Ga0265323_10040094 3300028653 Bacteria 1705
277 Ga0265338_10491233 3300028800 Bacteria 865
278 Ga0316177_1193673 3300030731 Bacteria 7210
279 Ga0316176_1077249 3300030732 Bacteria 11944
280 Ga0316183_1002573 3300030742 Bacteria 2938
281 Ga0316181_1171993 3300030744 Bacteria 10696
282 Ga0316181_1191616 3300030744 Bacteria 1343
283 Ga0316182_1021745 3300030745 Bacteria 1975
284 Ga0265339_10003152 3300031249 Bacteria 11611
285 Ga0265316_10000401 3300031344 Bacteria 49342
286 Ga0307513_10076983 3300031456 Bacteria 3457
287 Ga0307513_10443975 3300031456 Bacteria 1023
288 Ga0307509_10026152 3300031507 Bacteria 6511
289 Ga0307509_10034973 3300031507 Bacteria 5518
290 Ga0307408_100000955 3300031548 Bacteria 22424
291 Ga0307408_100016438 3300031548 Bacteria 4940
292 Ga0316579_10211989 3300031691 Bacteria 937
293 Ga0265342_10309636 3300031712 Bacteria 830
294 Ga0316576_10369937 3300031727 Unclassified 1065
295 Ga0307516_10068666 3300031730 Bacteria 3412
296 Ga0307405_11037366 3300031731 Unclassified 702
297 Ga0307412_10014958 3300031911 Bacteria 4588
298 Ga0307412_10468689 3300031911 Bacteria 1042
299 Ga0307416_100101985 3300032002 Bacteria 2501
300 Ga0307414_10003392 3300032004 Bacteria 8510
301 Ga0307414_10209436 3300032004 Unclassified 1592
302 Ga0307414_10281361 3300032004 Bacteria 1398
303 Ga0307414_10395805 3300032004 Bacteria 1198
304 Ga0307411_10244874 3300032005 Bacteria 1406
305 Ga0307411_10394169 3300032005 Bacteria 1143
306 Ga0307411_11718631 3300032005 Bacteria 581
307 Ga0307415_100006510 3300032126 Bacteria 6310
308 Ga0307415_101103181 3300032126 Bacteria 743
309 Ga0316584_0621191 3300036712 Unclassified 747
310 Ga0373925_0284537 3300037068 Bacteria 1332
311 Ga0395905_0240179 3300037471 Bacteria 1693
312 Ga0395901_0584832 3300038443 Unclassified 1128
313 Ga0436361_0241996 3300039447 Bacteria 2214
314 Ga0439436_0026316 3300041404 Bacteria 1706
315 Ga0439439_0021630 3300041406 Bacteria 1603
316 Ga0439439_0031370 3300041406 Bacteria 1354
317 Ga0451797_0805797 3300041453 Bacteria 1042
318 Ga0451802_0602217 3300041460 Bacteria 768
319 Ga0451849_0356432 3300041505 Bacteria 665
320 Ga0451843_1534770 3300041509 Bacteria 702
321 Ga0451853_0354502 3300041512 Bacteria 1848
322 Ga0439431_0023892 3300041997 Bacteria 1483
323 Ga0439442_002020 3300042002 Bacteria 3987
324 Ga0439445_0026882 3300042004 Bacteria 1476
325 Ga0439449_0000533 3300042007 Bacteria 14186
326 Ga0439449_0051529 3300042007 Bacteria 1522
327 Ga0439449_0080281 3300042007 Bacteria 1203
328 Ga0439457_000605 3300042014 Bacteria 10582
329 Ga0439457_030331 3300042014 Bacteria 1198
330 Ga0439462_0103610 3300042015 Bacteria 785
331 Ga0450899_009076 3300042135 Bacteria 1093
332 Ga0439434_0018093 3300042435 Bacteria 2108
333 Ga0466972_0000464 3300044658 Bacteria 20631
334 Ga0466972_0153233 3300044658 Bacteria 1083
335 Ga0453683_0037403 3300044673 Bacteria 3054
336 Ga0466965_0078995 3300044683 Bacteria 1662
337 Ga0453684_0000671 3300044712 Bacteria 122605
338 Ga0453684_0572507 3300044712 Bacteria 1241
339 Ga0466960_0523472 3300044901 Bacteria 697
340 Ga0495598_0003414 3300046537 Bacteria 3373
341 Ga0495668_0264001 3300046616 Bacteria 943
342 Ga0495660_0173617 3300046810 Bacteria 1048
343 Ga0496101_0635461 3300048904 Bacteria 844
344 Ga0496104_0383423 3300048907 Unclassified 1318
345 Ga0496112_0038828 3300048915 Bacteria 4651
346 Ga0496126_0031425 3300048929 Bacteria 5017
347 Ga0501303_029469 3300049526 Bacteria 633
348 Ga0501047_0048295 3300049581 Bacteria 4110
349 Ga0501047_0077277 3300049581 Bacteria 3203
350 Ga0501047_0101664 3300049581 Bacteria 2754
351 Ga0501047_0929680 3300049581 Bacteria 683
352 Ga0501072_0946023 3300049588 Bacteria 672
353 Ga0501202_005914 3300049652 Bacteria 2176
354 Ga0501217_065093 3300049661 Unclassified 981
355 Ga0501242_001362 3300049674 Bacteria 2438
356 Ga0501257_000175 3300049686 Bacteria 12998
357 Ga0501257_056896 3300049686 Bacteria 983
358 Ga0501225_0000775 3300049705 Bacteria 10012
359 Ga0501225_0040716 3300049705 Bacteria 1281
360 Ga0501079_0990500 3300049741 Bacteria 662
361 Ga0501083_0176114 3300049744 Bacteria 1397
362 Ga0501241_000202 3300049758 Bacteria 13386
363 Ga0501044_0008129 3300049823 Bacteria 11513
364 Ga0501044_0236496 3300049823 Bacteria 1772
365 nmdc:mga05p37_6383_c1 3300050507 Bacteria 13892
366 nmdc:mga08y16_96921_c1 3300050511 Bacteria 3071
367 nmdc:mga08y16_97425_c1 3300050511 Bacteria 3063
368 nmdc:mga0a205_722973_c1 3300050515 Bacteria 845
369 Ga0500578_0171762 3300053086 Bacteria 1340
370 Ga0500578_0353494 3300053086 Bacteria 858
371 Ga0500644_0000386 3300053088 Bacteria 21443
372 Ga0500644_0182705 3300053088 Bacteria 859
373 Ga0500646_0031389 3300053090 Bacteria 1462
374 Ga0500583_0000015 3300053092 Bacteria 147804
375 Ga0500583_0002395 3300053092 Bacteria 5624
376 Ga0500651_0505391 3300053093 Bacteria 666
377 Ga0500650_0033876 3300053098 Bacteria 2332
378 Ga0500572_052666 3300053111 Bacteria 1217
379 Ga0500652_174806 3300053131 Bacteria 882
380 Ga0500616_0024582 3300053153 Bacteria 3345
381 Ga0500616_0203368 3300053153 Bacteria 876
382 Ga0500622_0343056 3300053156 Bacteria 622
383 Ga0500611_104127 3300053727 Bacteria 739
384 Ga0587062_004314 3300059639 Bacteria 1502
385 Ga0587079_037563 3300059647 Bacteria 963
386 Ga0501082_1352576 3300060353 Bacteria 622
387 8003155355 8003151029 Bacteria 8187759
388 Ga0500651_0104538
389 JGI25154J39366_1000012
390 JGI25153J46596_10020620
391 JGI25153J46596_10055758
392 rootH1_10001358
393 rootH2_10026952
394 rootH2_10050527
395 rootH2_10071588
396 rootH2_10119664
397 rootH2_10131334
398 rootH2_10146174
399 rootL2_10004720
400 rootL2_10004727
401 rootL2_10112202
402 rootH1_10000733
403 rootH1_10020572
404 rootH1_10036441
405 rootH1_10084927
406 JGI25160J50197_1001111
407 JGI25160J50197_1011994
408 Ga0055526_1009150
409 Ga0055526_1033256
410 Ga0055536_1009384
411 Ga0055528_1000651
412 Ga0055530_10001819
413 Ga0055531_10032712
414 Ga0055543_1006346
415 Ga0065165_1000228
416 Ga0065165_1000314
417 Ga0065165_1018574
418 Ga0065714_10064566
419 Ga0065714_10295303
420 Ga0065704_10216266
421 Ga0065715_10208549
422 Ga0065707_10096838
423 Ga0070676_10026535
424 Ga0070676_10476883
425 Ga0070676_10591242
426 Ga0070690_100154861
427 Ga0070690_100455457
428 Ga0070670_100018623
429 Ga0068869_100056964
430 Ga0070666_10000065
431 Ga0070666_11153635
432 Ga0070680_100123087
433 Ga0070680_100226329
434 Ga0068868_100047832
435 Ga0068868_100762669
436 Ga0070668_100034515
437 Ga0070668_100250702
438 Ga0070669_100009015
439 Ga0070675_100009558
440 Ga0070675_100022985
441 Ga0070671_100349042
442 Ga0070673_100034505
443 Ga0070659_100035190
444 Ga0070667_100049859
445 Ga0070713_100000623
446 Ga0070710_10247160
447 Ga0070701_10063422
448 Ga0070711_100283704
449 Ga0070694_100282899
450 Ga0070662_100441169
451 Ga0070681_10006121
452 Ga0070681_10194533
453 Ga0070681_10221627
454 Ga0070681_10634960
455 Ga0068867_100215625
456 Ga0070685_10171818
457 Ga0070685_10314483
458 Ga0070679_100130092
459 Ga0070679_100430910
460 Ga0070679_100627617
461 Ga0070684_100063593
462 Ga0068853_100000812
463 Ga0070672_100383302
464 Ga0070665_101034033
465 Ga0068855_100001589
466 Ga0068855_100176529
467 Ga0068855_100439559
468 Ga0068855_100742730
469 Ga0068855_101493073
470 Ga0070664_100089657
471 Ga0068857_100011885
472 Ga0068857_100658392
473 Ga0068857_100853920
474 Ga0068854_101106222
475 Ga0068856_100001626
476 Ga0068852_100278436
477 Ga0068852_100814603
478 Ga0068859_100000006
479 Ga0068859_100003188
480 Ga0068859_100479145
481 Ga0068864_100111516
482 Ga0068864_100252819
483 Ga0068861_100003290
484 Ga0068851_10158629
485 Ga0068851_10166890
486 Ga0068870_10036311
487 Ga0068863_100030615
488 Ga0068858_100004383
489 Ga0068860_100000892
490 Ga0068860_100073829
491 Ga0068860_101093956
492 Ga0068862_100004985
493 Ga0081539_10002362
494 Ga0075366_10896890
495 Ga0097621_100000388
496 Ga0068871_100000605
497 Ga0068871_100081968
498 Ga0068871_100568326
499 Ga0075428_100327405
500 Ga0075433_11060675
501 Ga0075429_100479610
502 Ga0097620_100000006
503 Ga0097620_100003188
504 Ga0097620_100479167
505 Ga0105240_10000270
506 Ga0105240_10005642
507 Ga0105240_10079091
508 Ga0105240_10839754
509 Ga0111539_10007482
510 Ga0111539_10440532
511 Ga0111539_10477375
512 Ga0111539_10526532
513 Ga0105247_10064535
514 Ga0105247_10261397
515 Ga0114129_10009523
516 Ga0105243_10037236
517 Ga0105243_10183614
518 Ga0105241_10000243
519 Ga0105241_10193456
520 Ga0105241_10301523
521 Ga0105241_10663731
522 Ga0105242_10025150
523 Ga0105248_11352028
524 Ga0105237_10000028
525 Ga0105237_10034086
526 Ga0105237_10049708
527 Ga0105237_10106146
528 Ga0105237_10146370
529 Ga0105238_10001178
530 Ga0105249_10011570
531 Ga0105249_10019620
532 Ga0105249_10059763
533 Ga0105249_11412344
534 Ga0105239_10054730
535 Ga0105239_10107855
536 Ga0105239_10148970
537 Ga0105239_11080266
538 Ga0105239_11248999
539 Ga0105246_10012495
540 Ga0157373_10142514
541 Ga0157371_10020956
542 Ga0157371_10626196
543 Ga0157370_10380560
544 Ga0157369_10000576
545 Ga0157374_10002933
546 Ga0157374_10090740
547 Ga0157374_10613889
548 Ga0157378_10000559
549 Ga0157378_10022035
550 Ga0163162_10001384
551 Ga0163162_10005503
552 Ga0157372_10189994
553 Ga0157372_10998167
554 Ga0157372_11154416
555 Ga0157375_10022462
556 Ga0157375_10027402
557 Ga0157375_10077518
558 Ga0163163_10052142
559 Ga0157380_10005194
560 Ga0157380_11922971
561 Ga0182008_10081662
562 Ga0157377_10003373
563 Ga0157379_10023670
564 Ga0157379_10231320
565 Ga0157376_10109996
566 Ga0157376_10135306
567 Ga0182007_10018834
568 Ga0182007_10187757
569 Ga0209436_105857
570 Ga0209646_1000009
571 Ga0209646_1012298
572 Ga0209026_1000197
573 Ga0209673_1000016
574 Ga0209130_1002680
575 Ga0209676_1001661
576 Ga0209564_1002601
577 Ga0209564_1004678
578 Ga0209758_1031044
579 Ga0209050_1000124
580 Ga0207426_1000139
581 Ga0207426_1000477
582 Ga0207426_1002062
583 Ga0207426_1060581
584 Ga0209051_1026812
585 Ga0209257_1000064
586 Ga0209257_1008236
587 Ga0207697_10117805
588 Ga0207656_10100943
589 Ga0207710_10089539
590 Ga0207680_10000111
591 Ga0207647_10399962
592 Ga0207645_10064719
593 Ga0207645_10473468
594 Ga0207643_10135718
595 Ga0207654_10011788
596 Ga0207654_10096933
597 Ga0207707_10000209
598 Ga0207695_10000280
599 Ga0207695_10061785
600 Ga0207695_10312336
601 Ga0207671_10003133
602 Ga0207671_10007278
603 Ga0207671_10624040
604 Ga0207660_10100964
605 Ga0207657_10696464
606 Ga0207681_10015529
607 Ga0207694_10003386
608 Ga0207650_10281839
609 Ga0207659_10015075
610 Ga0207659_10102324
611 Ga0207700_10106376
612 Ga0207664_10010337
613 Ga0207706_10041505
614 Ga0207686_10136483
615 Ga0207691_10141694
616 Ga0207689_10002127
617 Ga0207689_10018902
618 Ga0207661_10106075
619 Ga0207679_10018350
620 Ga0207667_10000649
621 Ga0207667_10129037
622 Ga0207667_10138786
623 Ga0207667_10447413
624 Ga0207667_10684321
625 Ga0207651_10007998
626 Ga0207651_11201313
627 Ga0207651_11280291
628 Ga0207712_10162542
629 Ga0207712_10294959
630 Ga0207668_10050016
631 Ga0207668_10366832
632 Ga0207658_10241233
633 Ga0207658_11563267
634 Ga0207677_10022080
635 Ga0207677_10727928
636 Ga0207703_10001345
637 Ga0207639_10033307
638 Ga0207639_10377931
639 Ga0207708_10260725
640 Ga0207702_10001485
641 Ga0207702_10631559
642 Ga0207641_10000122
643 Ga0207648_10055688
644 Ga0207648_10378877
645 Ga0207648_10587484
646 Ga0207648_10879187
647 Ga0207676_10264180
648 Ga0207674_10035926
649 Ga0207674_10125239
650 Ga0207674_10962949
651 Ga0207674_11104432
652 Ga0207675_100001778
653 Ga0207675_100728787
654 Ga0207698_10012022
655 Ga0207698_10797311
656 Ga0209974_10059322
657 Ga0207428_10102352
658 Ga0268265_10005911
659 Ga0268264_10009662
660 Ga0268264_10059668
661 Ga0268264_10253187
662 Ga0265323_10040094
663 Ga0265338_10491233
664 Ga0316177_1193673
665 Ga0316176_1077249
666 Ga0316183_1002573
667 Ga0316181_1171993
668 Ga0316181_1191616
669 Ga0316182_1021745
670 Ga0265339_10003152
671 Ga0265316_10000401
672 Ga0307513_10076983
673 Ga0307513_10443975
674 Ga0307509_10026152
675 Ga0307509_10034973
676 Ga0307408_100000955
677 Ga0307408_100016438
678 Ga0316579_10211989
679 Ga0265342_10309636
680 Ga0316576_10369937
681 Ga0307516_10068666
682 Ga0307405_11037366
683 Ga0307412_10014958
684 Ga0307412_10468689
685 Ga0307416_100101985
686 Ga0307414_10003392
687 Ga0307414_10209436
688 Ga0307414_10281361
689 Ga0307414_10395805
690 Ga0307411_10244874
691 Ga0307411_10394169
692 Ga0307411_11718631
693 Ga0307415_100006510
694 Ga0307415_101103181
695 Ga0316584_0621191
696 Ga0373925_0284537
697 Ga0395905_0240179
698 Ga0395901_0584832
699 Ga0436361_0241996
700 Ga0439436_0026316
701 Ga0439439_0021630
702 Ga0439439_0031370
703 Ga0451797_0805797
704 Ga0451802_0602217
705 Ga0451849_0356432
706 Ga0451843_1534770
707 Ga0451853_0354502
708 Ga0439431_0023892
709 Ga0439442_002020
710 Ga0439445_0026882
711 Ga0439449_0000533
712 Ga0439449_0051529
713 Ga0439449_0080281
714 Ga0439457_000605
715 Ga0439457_030331
716 Ga0439462_0103610
717 Ga0450899_009076
718 Ga0439434_0018093
719 Ga0466972_0000464
720 Ga0466972_0153233
721 Ga0453683_0037403
722 Ga0466965_0078995
723 Ga0453684_0000671
724 Ga0453684_0572507
725 Ga0466960_0523472
726 Ga0495598_0003414
727 Ga0495668_0264001
728 Ga0495660_0173617
729 Ga0496101_0635461
730 Ga0496104_0383423
731 Ga0496112_0038828
732 Ga0496126_0031425
733 Ga0501303_029469
734 Ga0501047_0048295
735 Ga0501047_0077277
736 Ga0501047_0101664
737 Ga0501047_0929680
738 Ga0501072_0946023
739 Ga0501202_005914
740 Ga0501217_065093
741 Ga0501242_001362
742 Ga0501257_000175
743 Ga0501257_056896
744 Ga0501225_0000775
745 Ga0501225_0040716
746 Ga0501079_0990500
747 Ga0501083_0176114
748 Ga0501241_000202
749 Ga0501044_0008129
750 Ga0501044_0236496
751 nmdc:mga05p37_6383_c1
752 nmdc:mga08y16_96921_c1
753 nmdc:mga08y16_97425_c1
754 nmdc:mga0a205_722973_c1
755 Ga0500578_0171762
756 Ga0500578_0353494
757 Ga0500644_0000386
758 Ga0500644_0182705
759 Ga0500646_0031389
760 Ga0500583_0000015
761 Ga0500583_0002395
762 Ga0500651_0505391
763 Ga0500650_0033876
764 Ga0500572_052666
765 Ga0500652_174806
766 Ga0500616_0024582
767 Ga0500616_0203368
768 Ga0500622_0343056
769 Ga0500611_104127
770 Ga0587062_004314
771 Ga0587079_037563
772 Ga0501082_1352576
773 8003155355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map