F430551

General Info

Members Datasets Scaffolds Average Seq Length
386 252 772 107

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10879068|Ga0316576_108790681
Length 128
Sequence MADISKQDVIDFIANMTVLELSELIKELEEKFGVSAAAPVAMMAAGPXXEGGGAQAEEKTEFDVILVAHGDKKIQVIKEVRAITGLGLKDAKDLVDGAPKPVKEGVPKDEAEKIKAQLEEAGAQVEVK

Samples

Sample ID Description Type Environment
1 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
132 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
138 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
148 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2643221733 Bosea sp. Root381 Isolate Unclassified
242 2841760612 Bosea sp. Tri-49 Isolate Nodule
243 2844104063 Bosea sp. Tri-39 Isolate Nodule
244 2851182111 Bosea sp. Tri-44 Isolate Nodule
245 2851246043 Bosea sp. Tri-54 Isolate Nodule
246 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
247 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
248 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
249 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
250 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
251 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
252 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.01
Metatranscriptomes 10.88
Isolates 3.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.3
Nodule 2.85
Rhizoplane 2.33
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316576_10879068 3300031727 Bacteria 642
2 JGI24743J22301_10027554 3300001991 Bacteria 1109
3 JGI24738J21930_10116524 3300002075 Bacteria 578
4 Ga0007429J51699_1159255 3300003579 Bacteria 515
5 Ga0058859_11572071 3300004798 Bacteria 941
6 Ga0058861_10013642 3300004800 Bacteria 1307
7 Ga0058861_11647726 3300004800 Bacteria 602
8 Ga0058862_10000962 3300004803 Bacteria 2126
9 Ga0065712_10076319 3300005290 Bacteria 3683
10 Ga0065707_10215423 3300005295 Bacteria 1247
11 Ga0070683_101036335 3300005329 Bacteria 788
12 Ga0070690_100085576 3300005330 Bacteria 2068
13 Ga0070680_100109798 3300005336 Bacteria 2295
14 Ga0070682_100739464 3300005337 Bacteria 793
15 Ga0070660_100021355 3300005339 Bacteria 4773
16 Ga0070687_100875784 3300005343 Bacteria 642
17 Ga0070661_100248572 3300005344 Bacteria 1372
18 Ga0070661_100409376 3300005344 Bacteria 1073
19 Ga0070671_100403482 3300005355 Bacteria 1169
20 Ga0070673_100321189 3300005364 Bacteria 1367
21 Ga0070703_10000983 3300005406 Bacteria 9005
22 Ga0070714_100153600 3300005435 Bacteria 2076
23 Ga0070714_100795082 3300005435 Bacteria 916
24 Ga0070711_100607707 3300005439 Bacteria 913
25 Ga0070705_100603251 3300005440 Bacteria 849
26 Ga0070705_101101544 3300005440 Bacteria 650
27 Ga0070700_101795911 3300005441 Bacteria 528
28 Ga0070700_101875877 3300005441 Bacteria 518
29 Ga0070694_101718672 3300005444 Bacteria 534
30 Ga0070708_100051089 3300005445 Bacteria 3662
31 Ga0070678_101730461 3300005456 Bacteria 589
32 Ga0070662_100131259 3300005457 Bacteria 1932
33 Ga0070681_10036645 3300005458 Bacteria 4924
34 Ga0070706_100030317 3300005467 Bacteria 4983
35 Ga0070698_100274696 3300005471 Bacteria 1617
36 Ga0070699_100897701 3300005518 Bacteria 812
37 Ga0070679_100125047 3300005530 Bacteria 2554
38 Ga0070679_100218708 3300005530 Bacteria 1866
39 Ga0070697_100238639 3300005536 Bacteria 1552
40 Ga0068853_100501704 3300005539 Bacteria 1146
41 Ga0070672_101173163 3300005543 Bacteria 684
42 Ga0070695_100119969 3300005545 Bacteria 1798
43 Ga0070696_100045370 3300005546 Bacteria 3045
44 Ga0070696_100302915 3300005546 Bacteria 1225
45 Ga0070696_100702307 3300005546 Bacteria 824
46 Ga0070693_100358014 3300005547 Bacteria 1001
47 Ga0070704_100969765 3300005549 Bacteria 768
48 Ga0068855_100986631 3300005563 Bacteria 886
49 Ga0068857_100095854 3300005577 Bacteria 2659
50 Ga0068854_100030421 3300005578 Bacteria 3745
51 Ga0070702_100554606 3300005615 Bacteria 854
52 Ga0068861_100157548 3300005719 Bacteria 1870
53 Ga0068863_100416499 3300005841 Bacteria 1316
54 Ga0068863_101775137 3300005841 Bacteria 627
55 Ga0068860_100417425 3300005843 Bacteria 1329
56 Ga0068860_100676822 3300005843 Bacteria 1041
57 Ga0068860_100856887 3300005843 Bacteria 923
58 Ga0068862_100136559 3300005844 Bacteria 2173
59 Ga0068862_100543376 3300005844 Bacteria 1109
60 Ga0081455_10007578 3300005937 Bacteria 11411
61 Ga0081455_10119788 3300005937 Bacteria 2075
62 Ga0081455_10310028 3300005937 Bacteria 1128
63 Ga0081540_1013649 3300005983 Bacteria 5268
64 Ga0081540_1020107 3300005983 Bacteria 4027
65 Ga0081539_10023998 3300005985 Bacteria 3973
66 Ga0075365_10159928 3300006038 Bacteria 1569
67 Ga0075363_100344322 3300006048 Bacteria 870
68 Ga0070712_100018041 3300006175 Bacteria 4577
69 Ga0097621_100552803 3300006237 Bacteria 1048
70 Ga0097621_101340649 3300006237 Bacteria 676
71 Ga0075370_10016361 3300006353 Bacteria 3991
72 Ga0075428_100112629 3300006844 Bacteria 2964
73 Ga0075428_100530061 3300006844 Bacteria 1259
74 Ga0075430_100328587 3300006846 Bacteria 1264
75 Ga0075431_100361996 3300006847 Bacteria 1457
76 Ga0075431_100378988 3300006847 Bacteria 1419
77 Ga0075431_101131522 3300006847 Bacteria 747
78 Ga0075433_10145322 3300006852 Bacteria 2108
79 Ga0075433_10240596 3300006852 Bacteria 1607
80 Ga0075434_100023274 3300006871 Bacteria 6034
81 Ga0075434_100097379 3300006871 Bacteria 2947
82 Ga0075434_100249725 3300006871 Bacteria 1793
83 Ga0075434_100318983 3300006871 Bacteria 1574
84 Ga0075434_101093592 3300006871 Bacteria 810
85 Ga0075429_100691095 3300006880 Bacteria 894
86 Ga0075436_100044949 3300006914 Bacteria 3046
87 Ga0075436_101427332 3300006914 Bacteria 525
88 Ga0099822_1078231 3300006943 Bacteria 839
89 Ga0075435_100013746 3300007076 Bacteria 6032
90 Ga0075435_100292698 3300007076 Bacteria 1392
91 Ga0075435_101203938 3300007076 Bacteria 663
92 Ga0075435_101321268 3300007076 Bacteria 632
93 Ga0099795_10004814 3300007788 Bacteria 3523
94 Ga0105240_10203833 3300009093 Bacteria 2316
95 Ga0111539_10070960 3300009094 Bacteria 4111
96 Ga0111539_10310168 3300009094 Bacteria 1836
97 Ga0114129_10099885 3300009147 Bacteria 4015
98 Ga0114129_12053119 3300009147 Bacteria 690
99 Ga0105243_10689822 3300009148 Bacteria 994
100 Ga0105243_13069707 3300009148 Bacteria 506
101 Ga0105242_10818579 3300009176 Bacteria 923
102 Ga0105248_10403957 3300009177 Bacteria 1538
103 Ga0105248_11896829 3300009177 Bacteria 676
104 Ga0105237_10250357 3300009545 Bacteria 1774
105 Ga0099796_10001444 3300010159 Bacteria 4787
106 Ga0099796_10306173 3300010159 Bacteria 675
107 Ga0105239_10756677 3300010375 Bacteria 1112
108 Ga0105239_11417574 3300010375 Bacteria 802
109 Ga0105239_11732781 3300010375 Bacteria 723
110 Ga0157370_10759319 3300013104 Bacteria 883
111 Ga0157369_10719293 3300013105 Bacteria 1028
112 Ga0157378_12426120 3300013297 Bacteria 576
113 Ga0157379_10910460 3300014968 Bacteria 835
114 Ga0157379_11722392 3300014968 Bacteria 614
115 Ga0157379_12398536 3300014968 Bacteria 526
116 Ga0184598_107479 3300019182 Bacteria 682
117 Ga0206356_11229238 3300020070 Bacteria 828
118 Ga0206351_10831597 3300020077 Bacteria 2140
119 Ga0206350_11179470 3300020080 Bacteria 1065
120 Ga0213872_10098344 3300021361 Bacteria 1306
121 Ga0213871_10077601 3300021441 Bacteria 947
122 Ga0207653_10000346 3300025885 Bacteria 23405
123 Ga0207692_10052122 3300025898 Bacteria 2078
124 Ga0207680_10625631 3300025903 Bacteria 770
125 Ga0207684_10041822 3300025910 Bacteria 3884
126 Ga0207707_10283280 3300025912 Bacteria 1435
127 Ga0207707_10915763 3300025912 Bacteria 724
128 Ga0207695_10179947 3300025913 Bacteria 2035
129 Ga0207671_10242395 3300025914 Bacteria 1416
130 Ga0207693_10019562 3300025915 Bacteria 5384
131 Ga0207693_10302453 3300025915 Bacteria 1253
132 Ga0207663_10056802 3300025916 Bacteria 2464
133 Ga0207663_10087084 3300025916 Bacteria 2062
134 Ga0207663_11304560 3300025916 Bacteria 585
135 Ga0207660_10330255 3300025917 Bacteria 1219
136 Ga0207657_10173609 3300025919 Bacteria 1745
137 Ga0207649_10715925 3300025920 Bacteria 777
138 Ga0207652_10429338 3300025921 Bacteria 1191
139 Ga0207646_10092622 3300025922 Bacteria 2705
140 Ga0207664_11177205 3300025929 Bacteria 684
141 Ga0207644_10395432 3300025931 Bacteria 1129
142 Ga0207644_10396231 3300025931 Bacteria 1128
143 Ga0207690_10131415 3300025932 Bacteria 1833
144 Ga0207706_10228036 3300025933 Bacteria 1630
145 Ga0207704_11941788 3300025938 Bacteria 506
146 Ga0207665_10410839 3300025939 Bacteria 1032
147 Ga0207711_10140160 3300025941 Bacteria 2175
148 Ga0207689_10910666 3300025942 Bacteria 742
149 Ga0207667_10551678 3300025949 Bacteria 1166
150 Ga0207640_10021255 3300025981 Bacteria 3866
151 Ga0207677_12147277 3300026023 Bacteria 519
152 Ga0207639_10420582 3300026041 Bacteria 1208
153 Ga0207678_10166036 3300026067 Bacteria 1885
154 Ga0207678_10738927 3300026067 Bacteria 867
155 Ga0207708_11822743 3300026075 Bacteria 534
156 Ga0207641_11091783 3300026088 Bacteria 796
157 Ga0207648_10387593 3300026089 Bacteria 1264
158 Ga0207648_10627150 3300026089 Bacteria 992
159 Ga0207674_10101649 3300026116 Bacteria 2855
160 Ga0207675_100031657 3300026118 Bacteria 4928
161 Ga0207675_100213036 3300026118 Bacteria 1859
162 Ga0209971_1051613 3300027682 Bacteria 994
163 Ga0207428_10021152 3300027907 Bacteria 5510
164 Ga0207428_10890492 3300027907 Bacteria 629
165 Ga0268265_11376251 3300028380 Bacteria 707
166 Ga0268264_10343631 3300028381 Bacteria 1418
167 Ga0268264_11015505 3300028381 Bacteria 836
168 Ga0268264_11398259 3300028381 Bacteria 710
169 Ga0307515_10095780 3300028794 Bacteria 3648
170 Ga0265328_10000053 3300031239 Bacteria 75262
171 Ga0265328_10002767 3300031239 Bacteria 7856
172 Ga0265329_10066048 3300031242 Bacteria 1144
173 Ga0265331_10000090 3300031250 Bacteria 123628
174 Ga0265331_10013225 3300031250 Bacteria 4445
175 Ga0265327_10008142 3300031251 Bacteria 7884
176 Ga0265327_10066759 3300031251 Bacteria 1814
177 Ga0265316_10000877 3300031344 Bacteria 32971
178 Ga0265316_10393915 3300031344 Bacteria 998
179 Ga0265316_10668673 3300031344 Bacteria 733
180 Ga0307408_101249881 3300031548 Unclassified 694
181 Ga0316575_10034583 3300031665 Bacteria 1985
182 Ga0316579_10018388 3300031691 Bacteria 3076
183 Ga0316579_10018503 3300031691 Bacteria 3067
184 Ga0265342_10110498 3300031712 Bacteria 1556
185 Ga0316576_10006754 3300031727 Bacteria 7171
186 Ga0316578_10013967 3300031728 Bacteria 4272
187 Ga0316578_10020696 3300031728 Bacteria 3639
188 Ga0316578_10064050 3300031728 Bacteria 2169
189 Ga0316578_10214912 3300031728 Bacteria 1156
190 Ga0316577_10001953 3300031733 Bacteria 10000
191 Ga0316577_10241413 3300031733 Bacteria 1022
192 Ga0316577_10263319 3300031733 Bacteria 975
193 Ga0307416_102682008 3300032002 Bacteria 595
194 Ga0316053_113431 3300032120 Bacteria 594
195 Ga0307415_100534382 3300032126 Bacteria 1032
196 Ga0316583_10051201 3300032133 Bacteria 1453
197 Ga0316580_10005944 3300032139 Bacteria 3581
198 Ga0316580_10108489 3300032139 Bacteria 850
199 Ga0316593_10001812 3300032168 Bacteria 4877
200 Ga0316593_10036342 3300032168 Bacteria 1624
201 Ga0316593_10065551 3300032168 Bacteria 1248
202 Ga0316593_10079386 3300032168 Bacteria 1144
203 Ga0316593_10110839 3300032168 Unclassified 980
204 Ga0316593_10123139 3300032168 Bacteria 932
205 Ga0316593_10216434 3300032168 Bacteria 711
206 Ga0316593_10354274 3300032168 Bacteria 562
207 Ga0316593_10430038 3300032168 Bacteria 513
208 Ga0316592_1000462 3300033524 Bacteria 5603
209 Ga0316592_1002285 3300033524 Bacteria 3285
210 Ga0316592_1006044 3300033524 Unclassified 2320
211 Ga0316592_1023888 3300033524 Bacteria 1314
212 Ga0316592_1054170 3300033524 Bacteria 897
213 Ga0316586_1002726 3300033527 Bacteria 2238
214 Ga0316586_1065050 3300033527 Bacteria 666
215 Ga0316586_1097776 3300033527 Bacteria 559
216 Ga0316588_1002017 3300033528 Bacteria 3471
217 Ga0316588_1005805 3300033528 Bacteria 2431
218 Ga0316588_1007442 3300033528 Bacteria 2223
219 Ga0316588_1018713 3300033528 Unclassified 1554
220 Ga0316588_1092044 3300033528 Bacteria 756
221 Ga0316596_1001814 3300033541 Bacteria 4440
222 Ga0316596_1003948 3300033541 Bacteria 3287
223 Ga0316596_1005115 3300033541 Bacteria 2982
224 Ga0316596_1009511 3300033541 Bacteria 2333
225 Ga0316596_1034302 3300033541 Bacteria 1325
226 Ga0373930_0005072 3300034816 Bacteria 2172
227 Ga0373948_0001160 3300034817 Bacteria 3569
228 Ga0373950_0002587 3300034818 Bacteria 2504
229 Ga0373958_0012058 3300034819 Bacteria 1473
230 Ga0373959_0005588 3300034820 Bacteria 2064
231 Ga0373938_0000588 3300034957 Bacteria 5871
232 Ga0373928_0007331 3300035084 Bacteria 2126
233 Ga0373929_0000498 3300035085 Bacteria 7492
234 Ga0373940_0001234 3300035088 Bacteria 4527
235 Ga0373949_0001772 3300035090 Bacteria 5943
236 Ga0373951_0000520 3300035091 Bacteria 10956
237 Ga0373932_0000492 3300035112 Bacteria 12172
238 Ga0373939_0000428 3300035114 Bacteria 10567
239 Ga0373941_0000851 3300035115 Bacteria 6291
240 Ga0373945_0167730 3300035116 Bacteria 898
241 Ga0373960_0000207 3300035121 Bacteria 10770
242 Ga0373943_0176080 3300035170 Bacteria 1173
243 Ga0373942_0001108 3300035207 Bacteria 7173
244 Ga0373942_0367291 3300035207 Bacteria 511
245 Ga0373961_0006147 3300035241 Bacteria 2885
246 Ga0373962_0003292 3300035242 Bacteria 3884
247 Ga0316574_0088816 3300035398 Bacteria 1969
248 Ga0316574_0324908 3300035398 Bacteria 976
249 Ga0316574_0435779 3300035398 Bacteria 822
250 Ga0373931_0001798 3300035691 Bacteria 9321
251 Ga0373935_0274163 3300035692 Bacteria 1186
252 Ga0373927_1094880 3300035695 Bacteria 525
253 Ga0373937_1162289 3300036401 Bacteria 720
254 Ga0316582_0009123 3300036647 Bacteria 5370
255 Ga0316582_0120671 3300036647 Bacteria 1754
256 Ga0316582_0667096 3300036647 Unclassified 715
257 Ga0316582_1243075 3300036647 Bacteria 507
258 Ga0316584_0005410 3300036712 Bacteria 8567
259 Ga0316584_0025940 3300036712 Bacteria 4302
260 Ga0316584_0262733 3300036712 Bacteria 1258
261 Ga0373925_0403350 3300037068 Bacteria 1115
262 Ga0395899_0000073 3300037312 Bacteria 181387
263 Ga0395900_0000027 3300037418 Bacteria 285957
264 Ga0395900_0403410 3300037418 Unclassified 1331
265 Ga0395898_0000255 3300037466 Bacteria 131017
266 Ga0395905_0000032 3300037471 Bacteria 285932
267 Ga0316581_0095384 3300037588 Bacteria 916
268 Ga0395901_0002750 3300038443 Bacteria 17751
269 Ga0436365_0103346 3300039437 Bacteria 530
270 Ga0436360_0112752 3300039438 Bacteria 1671
271 Ga0436360_0191253 3300039438 Bacteria 965
272 Ga0436360_0363446 3300039438 Bacteria 876
273 Ga0436360_0432946 3300039438 Bacteria 886
274 Ga0436360_1230432 3300039438 Bacteria 680
275 Ga0436361_0013018 3300039447 Bacteria 1930
276 Ga0436361_0662621 3300039447 Bacteria 1202
277 Ga0436361_1180367 3300039447 Bacteria 703
278 Ga0436363_0796168 3300039450 Bacteria 6993
279 Ga0436363_1160724 3300039450 Bacteria 517
280 Ga0436362_0219406 3300039453 Bacteria 1023
281 Ga0436362_0555848 3300039453 Bacteria 1194
282 Ga0436362_1007047 3300039453 Bacteria 785
283 Ga0436362_1297826 3300039453 Bacteria 583
284 Ga0451833_0069611 3300041491 Bacteria 556
285 Ga0451577_0257042 3300042876 Bacteria 1581
286 Ga0451577_0786241 3300042876 Bacteria 860
287 Ga0453684_0040696 3300044712 Bacteria 6305
288 Ga0451576_0009891 3300045051 Bacteria 11016
289 Ga0451576_0106426 3300045051 Bacteria 2918
290 Ga0495592_0468158 3300046454 Bacteria 787
291 Ga0495603_0411277 3300046455 Bacteria 775
292 Ga0495641_0042541 3300046461 Bacteria 2104
293 Ga0495584_0329110 3300046491 Bacteria 776
294 Ga0495640_0765894 3300046533 Bacteria 577
295 Ga0495667_0578123 3300046559 Bacteria 701
296 Ga0495672_0004402 3300047320 Bacteria 11549
297 Ga0495672_0147504 3300047320 Bacteria 1223
298 Ga0496101_0235259 3300048904 Bacteria 1425
299 Ga0496103_0184031 3300048906 Bacteria 1343
300 Ga0496107_0163707 3300048910 Bacteria 1649
301 Ga0496109_0616312 3300048912 Bacteria 1022
302 Ga0496109_1899352 3300048912 Bacteria 528
303 Ga0496110_0636262 3300048913 Bacteria 966
304 Ga0496110_0654394 3300048913 Bacteria 951
305 Ga0496112_0221336 3300048915 Bacteria 1849
306 Ga0496114_0783078 3300048917 Bacteria 832
307 Ga0496116_0000092 3300048919 Bacteria 206620
308 Ga0496117_0010168 3300048920 Bacteria 8633
309 Ga0496124_0084864 3300048927 Bacteria 2596
310 Ga0496126_1389759 3300048929 Bacteria 507
311 Ga0501306_028465 3300049127 Bacteria 819
312 Ga0501305_110619 3300049161 Bacteria 519
313 Ga0501318_036409 3300049534 Bacteria 688
314 Ga0501031_1056047 3300049568 Bacteria 519
315 Ga0501033_0566723 3300049570 Bacteria 781
316 Ga0501036_0280638 3300049572 Bacteria 1394
317 Ga0501036_0389131 3300049572 Bacteria 1163
318 Ga0501040_0010254 3300049576 Bacteria 6128
319 Ga0501040_1197737 3300049576 Bacteria 551
320 Ga0501041_0925523 3300049577 Bacteria 560
321 Ga0501046_0019102 3300049580 Bacteria 5685
322 Ga0501046_0336820 3300049580 Bacteria 1097
323 Ga0501048_0173479 3300049582 Bacteria 1528
324 Ga0501048_0333061 3300049582 Bacteria 1082
325 Ga0501071_0766460 3300049587 Bacteria 743
326 Ga0501072_0151118 3300049588 Bacteria 1851
327 Ga0501074_0168054 3300049590 Bacteria 1566
328 Ga0501074_0380045 3300049590 Bacteria 1002
329 Ga0501075_0002781 3300049591 Bacteria 11715
330 Ga0501075_0605348 3300049591 Bacteria 836
331 Ga0501076_0017618 3300049592 Bacteria 5430
332 Ga0501077_0001666 3300049593 Bacteria 13360
333 Ga0501077_0052563 3300049593 Bacteria 2587
334 Ga0501077_0335289 3300049593 Bacteria 964
335 Ga0501079_0624375 3300049741 Bacteria 848
336 Ga0501079_1132566 3300049741 Bacteria 616
337 Ga0501080_0010253 3300049742 Bacteria 8569
338 Ga0501080_0051184 3300049742 Bacteria 3843
339 Ga0501080_1382042 3300049742 Bacteria 601
340 Ga0501081_0010212 3300049743 Bacteria 6127
341 Ga0501083_0005237 3300049744 Bacteria 9171
342 Ga0501045_0003891 3300049824 Bacteria 10279
343 Ga0501045_0099207 3300049824 Bacteria 2155
344 nmdc:mga0yw44_588545_c1 3300050492 Bacteria 756
345 nmdc:mga07m45_43501_c1 3300050496 Bacteria 2518
346 nmdc:mga05p37_105964_c1 3300050507 Bacteria 3458
347 nmdc:mga05p37_214312_c1 3300050507 Bacteria 2326
348 nmdc:mga05p37_813850_c1 3300050507 Bacteria 1020
349 nmdc:mga09592_1112531_c1 3300050508 Bacteria 656
350 nmdc:mga0qj67_324118_c1 3300050509 Bacteria 1247
351 nmdc:mga06r32_121732_c2 3300050510 Bacteria 1392
352 nmdc:mga06r32_767345_c1 3300050510 Bacteria 926
353 nmdc:mga08y16_803483_c1 3300050511 Bacteria 933
354 nmdc:mga08y16_8354_c1 3300050511 Bacteria 10833
355 nmdc:mga0n895_182909_c1 3300050512 Bacteria 2128
356 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
357 nmdc:mga0n895_695748_c1 3300050512 Bacteria 1013
358 nmdc:mga0n895_696926_c1 3300050512 Bacteria 1012
359 nmdc:mga0rr50_1044798_c1 3300050513 Bacteria 696
360 nmdc:mga0rr50_706301_c1 3300050513 Bacteria 860
361 nmdc:mga0rr50_9834_c1 3300050513 Bacteria 6041
362 nmdc:mga08x19_1177_c1 3300050514 Bacteria 16391
363 nmdc:mga08x19_160275_c1 3300050514 Bacteria 1528
364 nmdc:mga08x19_564219_c1 3300050514 Bacteria 806
365 nmdc:mga08x19_586444_c1 3300050514 Bacteria 790
366 nmdc:mga0a205_35256_c1 3300050515 Bacteria 4804
367 Ga0501084_0045179 3300054114 Bacteria 3688
368 Ga0501084_1194944 3300054114 Bacteria 638
369 Ga0587084_076320 3300059477 Bacteria 642
370 Ga0587079_195592 3300059647 Bacteria 549
371 Ga0501082_0036474 3300060353 Bacteria 4236
372 Ga0501082_0042456 3300060353 Bacteria 3921
373 Ga0501082_0849572 3300060353 Bacteria 798
374 Ga0530510_0006003 3300061734 Bacteria 8429
375 2644731519 2643221733 Bacteria 5690728
376 2841761367 2841760612 Bacteria 6454112
377 2844104392 2844104063 Bacteria 6440972
378 2851184439 2851182111 Bacteria 6047226
379 2851247380 2851246043 Bacteria 6439203
380 2881671552 2881665667 Bacteria 8175609
381 2932800418 2932794094 Bacteria 7915132
382 2932804591 2932801729 Bacteria 7987968
383 2935889785 2935883170 Bacteria 7964738
384 2935966972 2935959822 Bacteria 7869783
385 8016536089 8016530956 Bacteria 8155261
386 8057530451 8057529695 Bacteria 6306553
387 Ga0316576_10879068
388 JGI24743J22301_10027554
389 JGI24738J21930_10116524
390 Ga0007429J51699_1159255
391 Ga0058859_11572071
392 Ga0058861_10013642
393 Ga0058861_11647726
394 Ga0058862_10000962
395 Ga0065712_10076319
396 Ga0065707_10215423
397 Ga0070683_101036335
398 Ga0070690_100085576
399 Ga0070680_100109798
400 Ga0070682_100739464
401 Ga0070660_100021355
402 Ga0070687_100875784
403 Ga0070661_100248572
404 Ga0070661_100409376
405 Ga0070671_100403482
406 Ga0070673_100321189
407 Ga0070703_10000983
408 Ga0070714_100153600
409 Ga0070714_100795082
410 Ga0070711_100607707
411 Ga0070705_100603251
412 Ga0070705_101101544
413 Ga0070700_101795911
414 Ga0070700_101875877
415 Ga0070694_101718672
416 Ga0070708_100051089
417 Ga0070678_101730461
418 Ga0070662_100131259
419 Ga0070681_10036645
420 Ga0070706_100030317
421 Ga0070698_100274696
422 Ga0070699_100897701
423 Ga0070679_100125047
424 Ga0070679_100218708
425 Ga0070697_100238639
426 Ga0068853_100501704
427 Ga0070672_101173163
428 Ga0070695_100119969
429 Ga0070696_100045370
430 Ga0070696_100302915
431 Ga0070696_100702307
432 Ga0070693_100358014
433 Ga0070704_100969765
434 Ga0068855_100986631
435 Ga0068857_100095854
436 Ga0068854_100030421
437 Ga0070702_100554606
438 Ga0068861_100157548
439 Ga0068863_100416499
440 Ga0068863_101775137
441 Ga0068860_100417425
442 Ga0068860_100676822
443 Ga0068860_100856887
444 Ga0068862_100136559
445 Ga0068862_100543376
446 Ga0081455_10007578
447 Ga0081455_10119788
448 Ga0081455_10310028
449 Ga0081540_1013649
450 Ga0081540_1020107
451 Ga0081539_10023998
452 Ga0075365_10159928
453 Ga0075363_100344322
454 Ga0070712_100018041
455 Ga0097621_100552803
456 Ga0097621_101340649
457 Ga0075370_10016361
458 Ga0075428_100112629
459 Ga0075428_100530061
460 Ga0075430_100328587
461 Ga0075431_100361996
462 Ga0075431_100378988
463 Ga0075431_101131522
464 Ga0075433_10145322
465 Ga0075433_10240596
466 Ga0075434_100023274
467 Ga0075434_100097379
468 Ga0075434_100249725
469 Ga0075434_100318983
470 Ga0075434_101093592
471 Ga0075429_100691095
472 Ga0075436_100044949
473 Ga0075436_101427332
474 Ga0099822_1078231
475 Ga0075435_100013746
476 Ga0075435_100292698
477 Ga0075435_101203938
478 Ga0075435_101321268
479 Ga0099795_10004814
480 Ga0105240_10203833
481 Ga0111539_10070960
482 Ga0111539_10310168
483 Ga0114129_10099885
484 Ga0114129_12053119
485 Ga0105243_10689822
486 Ga0105243_13069707
487 Ga0105242_10818579
488 Ga0105248_10403957
489 Ga0105248_11896829
490 Ga0105237_10250357
491 Ga0099796_10001444
492 Ga0099796_10306173
493 Ga0105239_10756677
494 Ga0105239_11417574
495 Ga0105239_11732781
496 Ga0157370_10759319
497 Ga0157369_10719293
498 Ga0157378_12426120
499 Ga0157379_10910460
500 Ga0157379_11722392
501 Ga0157379_12398536
502 Ga0184598_107479
503 Ga0206356_11229238
504 Ga0206351_10831597
505 Ga0206350_11179470
506 Ga0213872_10098344
507 Ga0213871_10077601
508 Ga0207653_10000346
509 Ga0207692_10052122
510 Ga0207680_10625631
511 Ga0207684_10041822
512 Ga0207707_10283280
513 Ga0207707_10915763
514 Ga0207695_10179947
515 Ga0207671_10242395
516 Ga0207693_10019562
517 Ga0207693_10302453
518 Ga0207663_10056802
519 Ga0207663_10087084
520 Ga0207663_11304560
521 Ga0207660_10330255
522 Ga0207657_10173609
523 Ga0207649_10715925
524 Ga0207652_10429338
525 Ga0207646_10092622
526 Ga0207664_11177205
527 Ga0207644_10395432
528 Ga0207644_10396231
529 Ga0207690_10131415
530 Ga0207706_10228036
531 Ga0207704_11941788
532 Ga0207665_10410839
533 Ga0207711_10140160
534 Ga0207689_10910666
535 Ga0207667_10551678
536 Ga0207640_10021255
537 Ga0207677_12147277
538 Ga0207639_10420582
539 Ga0207678_10166036
540 Ga0207678_10738927
541 Ga0207708_11822743
542 Ga0207641_11091783
543 Ga0207648_10387593
544 Ga0207648_10627150
545 Ga0207674_10101649
546 Ga0207675_100031657
547 Ga0207675_100213036
548 Ga0209971_1051613
549 Ga0207428_10021152
550 Ga0207428_10890492
551 Ga0268265_11376251
552 Ga0268264_10343631
553 Ga0268264_11015505
554 Ga0268264_11398259
555 Ga0307515_10095780
556 Ga0265328_10000053
557 Ga0265328_10002767
558 Ga0265329_10066048
559 Ga0265331_10000090
560 Ga0265331_10013225
561 Ga0265327_10008142
562 Ga0265327_10066759
563 Ga0265316_10000877
564 Ga0265316_10393915
565 Ga0265316_10668673
566 Ga0307408_101249881
567 Ga0316575_10034583
568 Ga0316579_10018388
569 Ga0316579_10018503
570 Ga0265342_10110498
571 Ga0316576_10006754
572 Ga0316578_10013967
573 Ga0316578_10020696
574 Ga0316578_10064050
575 Ga0316578_10214912
576 Ga0316577_10001953
577 Ga0316577_10241413
578 Ga0316577_10263319
579 Ga0307416_102682008
580 Ga0316053_113431
581 Ga0307415_100534382
582 Ga0316583_10051201
583 Ga0316580_10005944
584 Ga0316580_10108489
585 Ga0316593_10001812
586 Ga0316593_10036342
587 Ga0316593_10065551
588 Ga0316593_10079386
589 Ga0316593_10110839
590 Ga0316593_10123139
591 Ga0316593_10216434
592 Ga0316593_10354274
593 Ga0316593_10430038
594 Ga0316592_1000462
595 Ga0316592_1002285
596 Ga0316592_1006044
597 Ga0316592_1023888
598 Ga0316592_1054170
599 Ga0316586_1002726
600 Ga0316586_1065050
601 Ga0316586_1097776
602 Ga0316588_1002017
603 Ga0316588_1005805
604 Ga0316588_1007442
605 Ga0316588_1018713
606 Ga0316588_1092044
607 Ga0316596_1001814
608 Ga0316596_1003948
609 Ga0316596_1005115
610 Ga0316596_1009511
611 Ga0316596_1034302
612 Ga0373930_0005072
613 Ga0373948_0001160
614 Ga0373950_0002587
615 Ga0373958_0012058
616 Ga0373959_0005588
617 Ga0373938_0000588
618 Ga0373928_0007331
619 Ga0373929_0000498
620 Ga0373940_0001234
621 Ga0373949_0001772
622 Ga0373951_0000520
623 Ga0373932_0000492
624 Ga0373939_0000428
625 Ga0373941_0000851
626 Ga0373945_0167730
627 Ga0373960_0000207
628 Ga0373943_0176080
629 Ga0373942_0001108
630 Ga0373942_0367291
631 Ga0373961_0006147
632 Ga0373962_0003292
633 Ga0316574_0088816
634 Ga0316574_0324908
635 Ga0316574_0435779
636 Ga0373931_0001798
637 Ga0373935_0274163
638 Ga0373927_1094880
639 Ga0373937_1162289
640 Ga0316582_0009123
641 Ga0316582_0120671
642 Ga0316582_0667096
643 Ga0316582_1243075
644 Ga0316584_0005410
645 Ga0316584_0025940
646 Ga0316584_0262733
647 Ga0373925_0403350
648 Ga0395899_0000073
649 Ga0395900_0000027
650 Ga0395900_0403410
651 Ga0395898_0000255
652 Ga0395905_0000032
653 Ga0316581_0095384
654 Ga0395901_0002750
655 Ga0436365_0103346
656 Ga0436360_0112752
657 Ga0436360_0191253
658 Ga0436360_0363446
659 Ga0436360_0432946
660 Ga0436360_1230432
661 Ga0436361_0013018
662 Ga0436361_0662621
663 Ga0436361_1180367
664 Ga0436363_0796168
665 Ga0436363_1160724
666 Ga0436362_0219406
667 Ga0436362_0555848
668 Ga0436362_1007047
669 Ga0436362_1297826
670 Ga0451833_0069611
671 Ga0451577_0257042
672 Ga0451577_0786241
673 Ga0453684_0040696
674 Ga0451576_0009891
675 Ga0451576_0106426
676 Ga0495592_0468158
677 Ga0495603_0411277
678 Ga0495641_0042541
679 Ga0495584_0329110
680 Ga0495640_0765894
681 Ga0495667_0578123
682 Ga0495672_0004402
683 Ga0495672_0147504
684 Ga0496101_0235259
685 Ga0496103_0184031
686 Ga0496107_0163707
687 Ga0496109_0616312
688 Ga0496109_1899352
689 Ga0496110_0636262
690 Ga0496110_0654394
691 Ga0496112_0221336
692 Ga0496114_0783078
693 Ga0496116_0000092
694 Ga0496117_0010168
695 Ga0496124_0084864
696 Ga0496126_1389759
697 Ga0501306_028465
698 Ga0501305_110619
699 Ga0501318_036409
700 Ga0501031_1056047
701 Ga0501033_0566723
702 Ga0501036_0280638
703 Ga0501036_0389131
704 Ga0501040_0010254
705 Ga0501040_1197737
706 Ga0501041_0925523
707 Ga0501046_0019102
708 Ga0501046_0336820
709 Ga0501048_0173479
710 Ga0501048_0333061
711 Ga0501071_0766460
712 Ga0501072_0151118
713 Ga0501074_0168054
714 Ga0501074_0380045
715 Ga0501075_0002781
716 Ga0501075_0605348
717 Ga0501076_0017618
718 Ga0501077_0001666
719 Ga0501077_0052563
720 Ga0501077_0335289
721 Ga0501079_0624375
722 Ga0501079_1132566
723 Ga0501080_0010253
724 Ga0501080_0051184
725 Ga0501080_1382042
726 Ga0501081_0010212
727 Ga0501083_0005237
728 Ga0501045_0003891
729 Ga0501045_0099207
730 nmdc:mga0yw44_588545_c1
731 nmdc:mga07m45_43501_c1
732 nmdc:mga05p37_105964_c1
733 nmdc:mga05p37_214312_c1
734 nmdc:mga05p37_813850_c1
735 nmdc:mga09592_1112531_c1
736 nmdc:mga0qj67_324118_c1
737 nmdc:mga06r32_121732_c2
738 nmdc:mga06r32_767345_c1
739 nmdc:mga08y16_803483_c1
740 nmdc:mga08y16_8354_c1
741 nmdc:mga0n895_182909_c1
742 nmdc:mga0n895_227_c1
743 nmdc:mga0n895_695748_c1
744 nmdc:mga0n895_696926_c1
745 nmdc:mga0rr50_1044798_c1
746 nmdc:mga0rr50_706301_c1
747 nmdc:mga0rr50_9834_c1
748 nmdc:mga08x19_1177_c1
749 nmdc:mga08x19_160275_c1
750 nmdc:mga08x19_564219_c1
751 nmdc:mga08x19_586444_c1
752 nmdc:mga0a205_35256_c1
753 Ga0501084_0045179
754 Ga0501084_1194944
755 Ga0587084_076320
756 Ga0587079_195592
757 Ga0501082_0036474
758 Ga0501082_0042456
759 Ga0501082_0849572
760 Ga0530510_0006003
761 2644731519
762 2841761367
763 2844104392
764 2851184439
765 2851247380
766 2881671552
767 2932800418
768 2932804591
769 2935889785
770 2935966972
771 8016536089
772 8057530451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00542

Ribosomal_L12

Ribosomal protein L7/L12 C-terminal domain

62

128

0.99

PF16320

Ribosomal_L12_N

Ribosomal protein L7/L12 dimerisation domain

5

56

0.87

Map