F429555

General Info

Members Datasets Scaffolds Average Seq Length
383 217 766 268

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100197065|Ga0075428_1001970652
Length 288
Sequence MTKISFDRGAGLAGSEHNMEYRRFGNTGLTVPVIGMGTWKTFDVRGAEADARQAVTDAAFEAGATFFDSSPMYGEAERILGRTLRGRRDQALVATKLWTADDREADRQADAALGYFGGIVDVYQVHNLVACGRRLEQLERLRSQGRVRVIGLTHYAASAFPELRRAMEDPRVGSIQVPYNPGDLAIEAEILPAAAELDLGVIVMRPLGAGHLVRRRVSTDALAPLRAFGVSTWAQALLKWILSDPRCHVVIPATSNPGHMRDCAAAGSPPWFGPDERAHVATLAESAG

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
136 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
137 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
140 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
141 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
142 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 2.35
Rhizosphere 96.61
Stem 0
Stem Tuber 0
Unclassified 10.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100197065 3300006844 Bacteria 2178
2 MBSR1b_contig_11361990 2162886012 Unclassified 1181
3 MBSR1b_contig_12318460 2162886012 Unclassified 1167
4 JGI25406J46586_10016371 3300003203 Bacteria 3092
5 JGI25407J50210_10011962 3300003373 Bacteria 2223
6 Ga0065715_10166104 3300005293 Bacteria 1585
7 Ga0065707_10002520 3300005295 Bacteria 5298
8 Ga0070690_100015546 3300005330 Bacteria 4544
9 Ga0070670_100010701 3300005331 Bacteria 7838
10 Ga0070670_100069270 3300005331 Bacteria 3028
11 Ga0068869_100002912 3300005334 Bacteria 10392
12 Ga0068868_100127890 3300005338 Bacteria 2077
13 Ga0070668_100521860 3300005347 Unclassified 1031
14 Ga0070669_100201796 3300005353 Bacteria 1565
15 Ga0070674_100003654 3300005356 Bacteria 8666
16 Ga0070674_100294104 3300005356 Bacteria 1292
17 Ga0070703_10022815 3300005406 Unclassified 1839
18 Ga0070703_10063122 3300005406 Unclassified 1217
19 Ga0070709_10000117 3300005434 Bacteria 54159
20 Ga0070709_10007362 3300005434 Bacteria 6031
21 Ga0070714_100102782 3300005435 Unclassified 2520
22 Ga0070714_100118357 3300005435 Bacteria 2354
23 Ga0070713_100002731 3300005436 Bacteria 11533
24 Ga0070710_10034504 3300005437 Unclassified 2753
25 Ga0070711_100105002 3300005439 Unclassified 2062
26 Ga0070705_100008356 3300005440 Bacteria 5127
27 Ga0070705_100036699 3300005440 Bacteria 2758
28 Ga0070700_100080931 3300005441 Unclassified 2097
29 Ga0070700_100256595 3300005441 Bacteria 1257
30 Ga0070694_100005520 3300005444 Bacteria 7658
31 Ga0070708_100078232 3300005445 Bacteria 2990
32 Ga0070663_100273538 3300005455 Bacteria 1344
33 Ga0070662_100006077 3300005457 Bacteria 7753
34 Ga0070662_100295250 3300005457 Unclassified 1315
35 Ga0070681_10108055 3300005458 Bacteria 2722
36 Ga0070706_100000467 3300005467 Bacteria 47925
37 Ga0070706_100106558 3300005467 Bacteria 2607
38 Ga0070707_100046479 3300005468 Bacteria 4155
39 Ga0070698_100031471 3300005471 Bacteria 5501
40 Ga0070698_100052502 3300005471 Bacteria 4147
41 Ga0070698_100236883 3300005471 Unclassified 1758
42 Ga0070698_100360645 3300005471 Bacteria 1385
43 Ga0070699_100009514 3300005518 Bacteria 8421
44 Ga0070684_100019196 3300005535 Bacteria 5652
45 Ga0070672_100002011 3300005543 Bacteria 12779
46 Ga0070695_100008385 3300005545 Bacteria 6134
47 Ga0070696_100015967 3300005546 Bacteria 5049
48 Ga0070696_100127672 3300005546 Bacteria 1847
49 Ga0070696_100246223 3300005546 Unclassified 1350
50 Ga0070693_100109083 3300005547 Bacteria 1699
51 Ga0070704_100016142 3300005549 Bacteria 4712
52 Ga0070704_100058747 3300005549 Bacteria 2740
53 Ga0070704_100142047 3300005549 Unclassified 1876
54 Ga0068855_100230128 3300005563 Bacteria 2076
55 Ga0068857_100102207 3300005577 Bacteria 2572
56 Ga0068854_100046333 3300005578 Bacteria 3095
57 Ga0068856_100623825 3300005614 Bacteria 1099
58 Ga0068856_100650465 3300005614 Bacteria 1075
59 Ga0070702_100100458 3300005615 Unclassified 1773
60 Ga0070702_100140196 3300005615 Bacteria 1539
61 Ga0068852_100254835 3300005616 Unclassified 1682
62 Ga0068859_100061870 3300005617 Bacteria 3773
63 Ga0068861_100114294 3300005719 Bacteria 2167
64 Ga0068863_100107242 3300005841 Bacteria 2658
65 Ga0068858_100045628 3300005842 Bacteria 4062
66 Ga0068862_100017416 3300005844 Bacteria 5985
67 Ga0068862_100024059 3300005844 Bacteria 5107
68 Ga0081455_10204524 3300005937 Bacteria 1476
69 Ga0081538_10003857 3300005981 Bacteria 14000
70 Ga0081538_10008958 3300005981 Bacteria 8409
71 Ga0081538_10022494 3300005981 Bacteria 4566
72 Ga0081538_10025467 3300005981 Bacteria 4169
73 Ga0081538_10031679 3300005981 Bacteria 3560
74 Ga0081538_10057092 3300005981 Bacteria 2280
75 Ga0081540_1023436 3300005983 Bacteria 3610
76 Ga0081539_10001879 3300005985 Bacteria 32879
77 Ga0081539_10047454 3300005985 Bacteria 2452
78 Ga0075363_100018542 3300006048 Bacteria 3470
79 Ga0075364_10127269 3300006051 Bacteria 1708
80 Ga0075432_10015000 3300006058 Bacteria 2641
81 Ga0070716_100025214 3300006173 Bacteria 3171
82 Ga0075428_100148896 3300006844 Bacteria 2543
83 Ga0075428_100501952 3300006844 Bacteria 1298
84 Ga0075430_100004355 3300006846 Bacteria 11951
85 Ga0075431_100059984 3300006847 Bacteria 3926
86 Ga0075431_100173491 3300006847 Bacteria 2215
87 Ga0075433_10014496 3300006852 Bacteria 6442
88 Ga0075433_10067386 3300006852 Bacteria 3142
89 Ga0075433_10089198 3300006852 Bacteria 2725
90 Ga0075433_10089536 3300006852 Bacteria 2720
91 Ga0075434_100057436 3300006871 Bacteria 3867
92 Ga0075434_100072036 3300006871 Bacteria 3448
93 Ga0075434_100085878 3300006871 Bacteria 3146
94 Ga0075434_100279029 3300006871 Unclassified 1690
95 Ga0075434_100486877 3300006871 Unclassified 1254
96 Ga0075429_100006777 3300006880 Bacteria 9936
97 Ga0068865_100183489 3300006881 Unclassified 1613
98 Ga0097620_100061870 3300006931 Bacteria 3773
99 Ga0075435_100000746 3300007076 Bacteria 20146
100 Ga0105240_10120725 3300009093 Bacteria 3156
101 Ga0111539_10008054 3300009094 Bacteria 13435
102 Ga0111539_10010586 3300009094 Bacteria 11616
103 Ga0111539_10272798 3300009094 Bacteria 1969
104 Ga0105245_10062017 3300009098 Bacteria 3372
105 Ga0105245_10141013 3300009098 Unclassified 2270
106 Ga0114129_10026251 3300009147 Bacteria 8249
107 Ga0114129_10112647 3300009147 Bacteria 3752
108 Ga0114129_10268360 3300009147 Bacteria 2284
109 Ga0114129_10278512 3300009147 Bacteria 2235
110 Ga0114129_10298558 3300009147 Unclassified 2148
111 Ga0105243_10006283 3300009148 Bacteria 9183
112 Ga0105243_10027496 3300009148 Bacteria 4359
113 Ga0105243_10096518 3300009148 Bacteria 2445
114 Ga0105243_10166858 3300009148 Bacteria 1903
115 Ga0105243_10456183 3300009148 Bacteria 1201
116 Ga0105241_10060690 3300009174 Bacteria 2909
117 Ga0105242_10052732 3300009176 Bacteria 3320
118 Ga0105242_10058146 3300009176 Bacteria 3168
119 Ga0105242_10175756 3300009176 Bacteria 1885
120 Ga0105248_10495273 3300009177 Bacteria 1378
121 Ga0105249_10017490 3300009553 Bacteria 6366
122 Ga0105249_10172284 3300009553 Bacteria 2100
123 Ga0105246_10404681 3300011119 Bacteria 1134
124 Ga0157372_10988125 3300013307 Bacteria 975
125 Ga0157375_10051385 3300013308 Bacteria 4047
126 Ga0163163_10395906 3300014325 Unclassified 1439
127 Ga0163163_10491248 3300014325 Bacteria 1289
128 Ga0206353_11853663 3300020082 Bacteria 6010
129 Ga0213876_10002286 3300021384 Bacteria 11307
130 Ga0207697_10000243 3300025315 Bacteria 29799
131 Ga0207697_10009406 3300025315 Bacteria 4224
132 Ga0207688_10001364 3300025901 Bacteria 12684
133 Ga0207647_10009107 3300025904 Bacteria 7069
134 Ga0207699_10000035 3300025906 Bacteria 129523
135 Ga0207705_10052703 3300025909 Bacteria 2930
136 Ga0207684_10000728 3300025910 Bacteria 38624
137 Ga0207684_10089113 3300025910 Bacteria 2629
138 Ga0207654_10028124 3300025911 Bacteria 3063
139 Ga0207707_10014782 3300025912 Bacteria 6801
140 Ga0207693_10034340 3300025915 Unclassified 4001
141 Ga0207660_10138884 3300025917 Bacteria 1856
142 Ga0207662_10002273 3300025918 Bacteria 9615
143 Ga0207662_10024194 3300025918 Bacteria 3494
144 Ga0207652_10014602 3300025921 Bacteria 6368
145 Ga0207652_10343425 3300025921 Bacteria 1348
146 Ga0207681_10145791 3300025923 Bacteria 1769
147 Ga0207650_10024609 3300025925 Bacteria 4282
148 Ga0207659_10562069 3300025926 Bacteria 970
149 Ga0207700_10000769 3300025928 Bacteria 18532
150 Ga0207700_10318473 3300025928 Unclassified 1347
151 Ga0207644_10241190 3300025931 Bacteria 1439
152 Ga0207706_10030126 3300025933 Bacteria 4841
153 Ga0207706_10100365 3300025933 Bacteria 2546
154 Ga0207686_10025264 3300025934 Bacteria 3453
155 Ga0207686_10055387 3300025934 Bacteria 2488
156 Ga0207709_10225607 3300025935 Bacteria 1354
157 Ga0207670_10059141 3300025936 Bacteria 2606
158 Ga0207669_10019533 3300025937 Bacteria 3531
159 Ga0207704_10024588 3300025938 Bacteria 3270
160 Ga0207691_10023285 3300025940 Bacteria 5830
161 Ga0207711_10009777 3300025941 Bacteria 7976
162 Ga0207689_10028271 3300025942 Bacteria 4691
163 Ga0207651_10001500 3300025960 Bacteria 10632
164 Ga0207712_10376634 3300025961 Bacteria 1187
165 Ga0207668_10355518 3300025972 Bacteria 1226
166 Ga0207640_10062427 3300025981 Bacteria 2472
167 Ga0207703_10024191 3300026035 Bacteria 4778
168 Ga0207678_10297490 3300026067 Bacteria 1387
169 Ga0207708_10043804 3300026075 Bacteria 3411
170 Ga0207708_10069745 3300026075 Bacteria 2691
171 Ga0207708_10287341 3300026075 Bacteria 1334
172 Ga0207641_10215208 3300026088 Bacteria 1779
173 Ga0207648_10024306 3300026089 Bacteria 5411
174 Ga0207648_10295087 3300026089 Bacteria 1452
175 Ga0207675_100026380 3300026118 Bacteria 5408
176 Ga0207675_100300395 3300026118 Unclassified 1563
177 Ga0207675_100411420 3300026118 Unclassified 1334
178 Ga0207698_10213041 3300026142 Unclassified 1740
179 Ga0207428_10001039 3300027907 Bacteria 30611
180 Ga0207428_10001084 3300027907 Bacteria 29659
181 Ga0268265_10037406 3300028380 Bacteria 3562
182 Ga0307405_10021857 3300031731 Bacteria 3604
183 Ga0307405_10063989 3300031731 Bacteria 2335
184 Ga0307405_10181229 3300031731 Bacteria 1512
185 Ga0307413_10020182 3300031824 Bacteria 3538
186 Ga0307413_10292023 3300031824 Bacteria 1232
187 Ga0307413_10325742 3300031824 Bacteria 1175
188 Ga0307410_10024014 3300031852 Bacteria 3802
189 Ga0307410_10037295 3300031852 Bacteria 3174
190 Ga0307410_10160225 3300031852 Bacteria 1685
191 Ga0307410_10172623 3300031852 Bacteria 1630
192 Ga0307406_10015308 3300031901 Bacteria 4435
193 Ga0307406_10026709 3300031901 Bacteria 3470
194 Ga0307406_10076055 3300031901 Bacteria 2217
195 Ga0307406_10576077 3300031901 Bacteria 925
196 Ga0307407_10004229 3300031903 Bacteria 6057
197 Ga0307407_10006093 3300031903 Bacteria 5316
198 Ga0307412_10024138 3300031911 Bacteria 3751
199 Ga0307412_10059536 3300031911 Unclassified 2560
200 Ga0307412_10105360 3300031911 Bacteria 2003
201 Ga0307409_100001286 3300031995 Bacteria 12149
202 Ga0307409_100019727 3300031995 Bacteria 4574
203 Ga0307409_100022782 3300031995 Bacteria 4323
204 Ga0307409_100025941 3300031995 Bacteria 4122
205 Ga0307409_100164008 3300031995 Bacteria 1947
206 Ga0307409_100572578 3300031995 Bacteria 1112
207 Ga0307416_100009836 3300032002 Bacteria 6286
208 Ga0307416_100018433 3300032002 Bacteria 4916
209 Ga0307416_100018596 3300032002 Bacteria 4901
210 Ga0307416_100021464 3300032002 Bacteria 4636
211 Ga0307416_100079663 3300032002 Bacteria 2761
212 Ga0307416_100087605 3300032002 Bacteria 2659
213 Ga0307416_100246518 3300032002 Bacteria 1735
214 Ga0307416_100352782 3300032002 Bacteria 1489
215 Ga0307416_100640041 3300032002 Unclassified 1147
216 Ga0307416_100657141 3300032002 Bacteria 1134
217 Ga0307416_100794558 3300032002 Unclassified 1042
218 Ga0307414_10160497 3300032004 Bacteria 1785
219 Ga0307414_10277841 3300032004 Unclassified 1406
220 Ga0307414_10653059 3300032004 Bacteria 948
221 Ga0307411_10056701 3300032005 Bacteria 2584
222 Ga0307411_10124568 3300032005 Bacteria 1871
223 Ga0307411_10179932 3300032005 Bacteria 1604
224 Ga0307411_10306941 3300032005 Bacteria 1275
225 Ga0307415_100002525 3300032126 Bacteria 9144
226 Ga0307415_100012108 3300032126 Bacteria 4974
227 Ga0307415_100023135 3300032126 Bacteria 3851
228 Ga0307415_100040294 3300032126 Bacteria 3093
229 Ga0307415_100157016 3300032126 Bacteria 1758
230 Ga0307415_100199183 3300032126 Bacteria 1587
231 Ga0373937_0537944 3300036401 Bacteria 1110
232 Ga0395905_0051061 3300037471 Bacteria 3873
233 Ga0242420_008233 3300038996 Bacteria 1687
234 Ga0436365_0694916 3300039437 Bacteria 145094
235 Ga0439441_000969 3300042001 Bacteria 3513
236 Ga0439448_0000290 3300042005 Bacteria 11045
237 Ga0439448_0040957 3300042005 Unclassified 1497
238 Ga0439450_000149 3300042008 Bacteria 7701
239 Ga0439451_012106 3300042009 Bacteria 1740
240 Ga0439454_003832 3300042011 Bacteria 1699
241 Ga0439454_005740 3300042011 Bacteria 1496
242 Ga0439455_0003471 3300042012 Bacteria 3016
243 Ga0439455_0007313 3300042012 Unclassified 2332
244 Ga0439456_025813 3300042013 Bacteria 1248
245 Ga0439463_000109 3300042016 Bacteria 20195
246 Ga0450888_002216 3300042126 Bacteria 1909
247 Ga0450900_017278 3300042136 Bacteria 983
248 Ga0439444_0000212 3300042437 Bacteria 5574
249 Ga0439444_0013346 3300042437 Unclassified 1359
250 Ga0439464_0001676 3300042439 Bacteria 5299
251 Ga0439464_0029696 3300042439 Unclassified 1528
252 Ga0439460_0000309 3300042461 Bacteria 10228
253 Ga0451577_0000727 3300042876 Bacteria 51041
254 Ga0439440_0000123 3300042993 Bacteria 10786
255 Ga0453683_0019341 3300044673 Bacteria 4364
256 Ga0466965_0120236 3300044683 Bacteria 1356
257 Ga0466965_0269533 3300044683 Bacteria 917
258 Ga0466963_0045268 3300044694 Bacteria 2898
259 Ga0453684_0024934 3300044712 Bacteria 8707
260 Ga0466970_0342042 3300044765 Bacteria 848
261 Ga0466959_0373932 3300045049 Unclassified 970
262 Ga0451576_0098413 3300045051 Bacteria 3042
263 Ga0466958_0299363 3300045836 Bacteria 1032
264 Ga0466967_0231580 3300045976 Bacteria 1759
265 Ga0495603_0045340 3300046455 Bacteria 2622
266 Ga0495629_0004335 3300046459 Bacteria 10638
267 Ga0495594_0314480 3300046499 Bacteria 892
268 Ga0495621_0007243 3300046539 Bacteria 3278
269 Ga0495621_0026639 3300046539 Bacteria 1953
270 Ga0495621_0043114 3300046539 Bacteria 1591
271 Ga0495645_0195674 3300046543 Bacteria 1375
272 Ga0495622_0119571 3300046557 Bacteria 1203
273 Ga0495599_0209014 3300046678 Bacteria 1197
274 Ga0495670_0085619 3300046691 Bacteria 1609
275 Ga0495600_0096193 3300046809 Bacteria 1931
276 Ga0495581_0200417 3300047315 Bacteria 1168
277 Ga0495680_0013295 3300047322 Bacteria 7189
278 Ga0495614_0108918 3300048089 Bacteria 1215
279 Ga0496106_0597473 3300048909 Bacteria 884
280 Ga0496108_0000060 3300048911 Bacteria 123058
281 Ga0496108_0226795 3300048911 Bacteria 1624
282 Ga0496109_0024472 3300048912 Bacteria 5369
283 Ga0496109_0324513 3300048912 Bacteria 1453
284 Ga0496110_0013240 3300048913 Bacteria 6812
285 Ga0496110_0261587 3300048913 Unclassified 1575
286 Ga0496112_0268711 3300048915 Bacteria 1654
287 Ga0496115_0000289 3300048918 Bacteria 43479
288 Ga0501031_0003924 3300049568 Bacteria 9574
289 Ga0501031_0014740 3300049568 Bacteria 5080
290 Ga0501032_0089065 3300049569 Bacteria 2049
291 Ga0501032_0093828 3300049569 Bacteria 1990
292 Ga0501032_0119496 3300049569 Bacteria 1743
293 Ga0501036_0001001 3300049572 Bacteria 21361
294 Ga0501036_0003356 3300049572 Bacteria 12788
295 Ga0501036_0063914 3300049572 Bacteria 3116
296 Ga0501037_0023856 3300049573 Bacteria 4524
297 Ga0501037_0123108 3300049573 Bacteria 1863
298 Ga0501038_0003890 3300049574 Bacteria 13883
299 Ga0501038_0017058 3300049574 Bacteria 6568
300 Ga0501039_0014552 3300049575 Bacteria 6024
301 Ga0501039_0014762 3300049575 Bacteria 5974
302 Ga0501040_0000074 3300049576 Bacteria 48006
303 Ga0501040_0000876 3300049576 Bacteria 18900
304 Ga0501040_0050089 3300049576 Bacteria 2856
305 Ga0501041_0000805 3300049577 Bacteria 16788
306 Ga0501041_0001699 3300049577 Bacteria 12328
307 Ga0501042_0001070 3300049578 Bacteria 15679
308 Ga0501042_0040066 3300049578 Bacteria 3330
309 Ga0501042_0231693 3300049578 Bacteria 1332
310 Ga0501043_0013243 3300049579 Bacteria 6449
311 Ga0501043_0018877 3300049579 Bacteria 5412
312 Ga0501046_0001562 3300049580 Bacteria 21884
313 Ga0501046_0010673 3300049580 Bacteria 7877
314 Ga0501048_0000599 3300049582 Bacteria 25555
315 Ga0501048_0001484 3300049582 Bacteria 17800
316 Ga0501048_0029384 3300049582 Bacteria 3987
317 Ga0501048_0332193 3300049582 Bacteria 1083
318 Ga0501068_0102766 3300049584 Bacteria 1772
319 Ga0501069_0041344 3300049585 Bacteria 2548
320 Ga0501069_0105803 3300049585 Bacteria 1599
321 Ga0501070_0317545 3300049586 Bacteria 1267
322 Ga0501071_0026097 3300049587 Bacteria 4098
323 Ga0501071_0031133 3300049587 Bacteria 3779
324 Ga0501071_0124999 3300049587 Bacteria 1908
325 Ga0501072_0000363 3300049588 Bacteria 32287
326 Ga0501072_0076911 3300049588 Bacteria 2641
327 Ga0501074_0000272 3300049590 Bacteria 29627
328 Ga0501074_0006610 3300049590 Bacteria 8383
329 Ga0501075_0002947 3300049591 Bacteria 11401
330 Ga0501075_0063277 3300049591 Bacteria 2789
331 Ga0501075_0087589 3300049591 Bacteria 2360
332 Ga0501076_0000431 3300049592 Bacteria 26434
333 Ga0501076_0000503 3300049592 Bacteria 24750
334 Ga0501076_0018982 3300049592 Bacteria 5247
335 Ga0501077_0003878 3300049593 Bacteria 9008
336 Ga0501077_0010323 3300049593 Bacteria 5810
337 Ga0501079_0000072 3300049741 Bacteria 46737
338 Ga0501079_0001997 3300049741 Bacteria 14621
339 Ga0501080_0029391 3300049742 Bacteria 5116
340 Ga0501080_0226628 3300049742 Bacteria 1709
341 Ga0501081_0000766 3300049743 Bacteria 18833
342 Ga0501081_0002122 3300049743 Bacteria 12400
343 Ga0501083_0028301 3300049744 Bacteria 3863
344 Ga0501035_0003618 3300049822 Bacteria 14753
345 Ga0501044_0086841 3300049823 Bacteria 3160
346 Ga0501045_0000211 3300049824 Bacteria 33570
347 Ga0501045_0003650 3300049824 Bacteria 10582
348 Ga0501045_0024963 3300049824 Bacteria 4294
349 Ga0501045_0080591 3300049824 Bacteria 2400
350 nmdc:mga05p37_105587_c1 3300050507 Bacteria 3465
351 nmdc:mga05p37_170795_c1 3300050507 Bacteria 2652
352 nmdc:mga05p37_7576_c2 3300050507 Bacteria 8355
353 nmdc:mga05p37_951476_c1 3300050507 Bacteria 919
354 nmdc:mga09592_10216_c1 3300050508 Bacteria 7638
355 nmdc:mga09592_399463_c1 3300050508 Bacteria 1188
356 nmdc:mga0qj67_541275_c1 3300050509 Unclassified 934
357 nmdc:mga06r32_142303_c1 3300050510 Bacteria 2375
358 nmdc:mga06r32_2249_c1 3300050510 Bacteria 17272
359 nmdc:mga06r32_49451_c1 3300050510 Bacteria 4020
360 nmdc:mga08y16_78113_c1 3300050511 Bacteria 3451
361 nmdc:mga08y16_8720_c1 3300050511 Bacteria 10634
362 nmdc:mga0n895_160154_c1 3300050512 Unclassified 2282
363 nmdc:mga0n895_22489_c1 3300050512 Bacteria 5912
364 nmdc:mga0n895_283398_c1 3300050512 Unclassified 1680
365 nmdc:mga0n895_42584_c1 3300050512 Bacteria 4418
366 nmdc:mga0rr50_8537_c1 3300050513 Bacteria 6382
367 nmdc:mga0a205_17207_c1 3300050515 Bacteria 6772
368 nmdc:mga0a205_3042_c1 3300050515 Bacteria 14865
369 nmdc:mga0a205_3946_c1 3300050515 Bacteria 13277
370 nmdc:mga0a205_40600_c1 3300050515 Bacteria 4480
371 Ga0501084_0010985 3300054114 Bacteria 7499
372 Ga0501084_0016911 3300054114 Bacteria 6062
373 Ga0501084_0406086 3300054114 Bacteria 1151
374 Ga0590071_000016 3300059421 Bacteria 44025
375 Ga0590071_041985 3300059421 Bacteria 1101
376 Ga0590074_000078 3300059423 Bacteria 10457
377 Ga0590075_001765 3300059424 Bacteria 5303
378 Ga0590077_001223 3300059426 Bacteria 6198
379 Ga0590077_001651 3300059426 Bacteria 5112
380 Ga0501082_0000783 3300060353 Bacteria 27945
381 Ga0501082_0161230 3300060353 Bacteria 1949
382 Ga0530510_0000027 3300061734 Bacteria 65176
383 Ga0530510_0002057 3300061734 Bacteria 13813
384 Ga0075428_100197065
385 MBSR1b_contig_11361990
386 MBSR1b_contig_12318460
387 JGI25406J46586_10016371
388 JGI25407J50210_10011962
389 Ga0065715_10166104
390 Ga0065707_10002520
391 Ga0070690_100015546
392 Ga0070670_100010701
393 Ga0070670_100069270
394 Ga0068869_100002912
395 Ga0068868_100127890
396 Ga0070668_100521860
397 Ga0070669_100201796
398 Ga0070674_100003654
399 Ga0070674_100294104
400 Ga0070703_10022815
401 Ga0070703_10063122
402 Ga0070709_10000117
403 Ga0070709_10007362
404 Ga0070714_100102782
405 Ga0070714_100118357
406 Ga0070713_100002731
407 Ga0070710_10034504
408 Ga0070711_100105002
409 Ga0070705_100008356
410 Ga0070705_100036699
411 Ga0070700_100080931
412 Ga0070700_100256595
413 Ga0070694_100005520
414 Ga0070708_100078232
415 Ga0070663_100273538
416 Ga0070662_100006077
417 Ga0070662_100295250
418 Ga0070681_10108055
419 Ga0070706_100000467
420 Ga0070706_100106558
421 Ga0070707_100046479
422 Ga0070698_100031471
423 Ga0070698_100052502
424 Ga0070698_100236883
425 Ga0070698_100360645
426 Ga0070699_100009514
427 Ga0070684_100019196
428 Ga0070672_100002011
429 Ga0070695_100008385
430 Ga0070696_100015967
431 Ga0070696_100127672
432 Ga0070696_100246223
433 Ga0070693_100109083
434 Ga0070704_100016142
435 Ga0070704_100058747
436 Ga0070704_100142047
437 Ga0068855_100230128
438 Ga0068857_100102207
439 Ga0068854_100046333
440 Ga0068856_100623825
441 Ga0068856_100650465
442 Ga0070702_100100458
443 Ga0070702_100140196
444 Ga0068852_100254835
445 Ga0068859_100061870
446 Ga0068861_100114294
447 Ga0068863_100107242
448 Ga0068858_100045628
449 Ga0068862_100017416
450 Ga0068862_100024059
451 Ga0081455_10204524
452 Ga0081538_10003857
453 Ga0081538_10008958
454 Ga0081538_10022494
455 Ga0081538_10025467
456 Ga0081538_10031679
457 Ga0081538_10057092
458 Ga0081540_1023436
459 Ga0081539_10001879
460 Ga0081539_10047454
461 Ga0075363_100018542
462 Ga0075364_10127269
463 Ga0075432_10015000
464 Ga0070716_100025214
465 Ga0075428_100148896
466 Ga0075428_100501952
467 Ga0075430_100004355
468 Ga0075431_100059984
469 Ga0075431_100173491
470 Ga0075433_10014496
471 Ga0075433_10067386
472 Ga0075433_10089198
473 Ga0075433_10089536
474 Ga0075434_100057436
475 Ga0075434_100072036
476 Ga0075434_100085878
477 Ga0075434_100279029
478 Ga0075434_100486877
479 Ga0075429_100006777
480 Ga0068865_100183489
481 Ga0097620_100061870
482 Ga0075435_100000746
483 Ga0105240_10120725
484 Ga0111539_10008054
485 Ga0111539_10010586
486 Ga0111539_10272798
487 Ga0105245_10062017
488 Ga0105245_10141013
489 Ga0114129_10026251
490 Ga0114129_10112647
491 Ga0114129_10268360
492 Ga0114129_10278512
493 Ga0114129_10298558
494 Ga0105243_10006283
495 Ga0105243_10027496
496 Ga0105243_10096518
497 Ga0105243_10166858
498 Ga0105243_10456183
499 Ga0105241_10060690
500 Ga0105242_10052732
501 Ga0105242_10058146
502 Ga0105242_10175756
503 Ga0105248_10495273
504 Ga0105249_10017490
505 Ga0105249_10172284
506 Ga0105246_10404681
507 Ga0157372_10988125
508 Ga0157375_10051385
509 Ga0163163_10395906
510 Ga0163163_10491248
511 Ga0206353_11853663
512 Ga0213876_10002286
513 Ga0207697_10000243
514 Ga0207697_10009406
515 Ga0207688_10001364
516 Ga0207647_10009107
517 Ga0207699_10000035
518 Ga0207705_10052703
519 Ga0207684_10000728
520 Ga0207684_10089113
521 Ga0207654_10028124
522 Ga0207707_10014782
523 Ga0207693_10034340
524 Ga0207660_10138884
525 Ga0207662_10002273
526 Ga0207662_10024194
527 Ga0207652_10014602
528 Ga0207652_10343425
529 Ga0207681_10145791
530 Ga0207650_10024609
531 Ga0207659_10562069
532 Ga0207700_10000769
533 Ga0207700_10318473
534 Ga0207644_10241190
535 Ga0207706_10030126
536 Ga0207706_10100365
537 Ga0207686_10025264
538 Ga0207686_10055387
539 Ga0207709_10225607
540 Ga0207670_10059141
541 Ga0207669_10019533
542 Ga0207704_10024588
543 Ga0207691_10023285
544 Ga0207711_10009777
545 Ga0207689_10028271
546 Ga0207651_10001500
547 Ga0207712_10376634
548 Ga0207668_10355518
549 Ga0207640_10062427
550 Ga0207703_10024191
551 Ga0207678_10297490
552 Ga0207708_10043804
553 Ga0207708_10069745
554 Ga0207708_10287341
555 Ga0207641_10215208
556 Ga0207648_10024306
557 Ga0207648_10295087
558 Ga0207675_100026380
559 Ga0207675_100300395
560 Ga0207675_100411420
561 Ga0207698_10213041
562 Ga0207428_10001039
563 Ga0207428_10001084
564 Ga0268265_10037406
565 Ga0307405_10021857
566 Ga0307405_10063989
567 Ga0307405_10181229
568 Ga0307413_10020182
569 Ga0307413_10292023
570 Ga0307413_10325742
571 Ga0307410_10024014
572 Ga0307410_10037295
573 Ga0307410_10160225
574 Ga0307410_10172623
575 Ga0307406_10015308
576 Ga0307406_10026709
577 Ga0307406_10076055
578 Ga0307406_10576077
579 Ga0307407_10004229
580 Ga0307407_10006093
581 Ga0307412_10024138
582 Ga0307412_10059536
583 Ga0307412_10105360
584 Ga0307409_100001286
585 Ga0307409_100019727
586 Ga0307409_100022782
587 Ga0307409_100025941
588 Ga0307409_100164008
589 Ga0307409_100572578
590 Ga0307416_100009836
591 Ga0307416_100018433
592 Ga0307416_100018596
593 Ga0307416_100021464
594 Ga0307416_100079663
595 Ga0307416_100087605
596 Ga0307416_100246518
597 Ga0307416_100352782
598 Ga0307416_100640041
599 Ga0307416_100657141
600 Ga0307416_100794558
601 Ga0307414_10160497
602 Ga0307414_10277841
603 Ga0307414_10653059
604 Ga0307411_10056701
605 Ga0307411_10124568
606 Ga0307411_10179932
607 Ga0307411_10306941
608 Ga0307415_100002525
609 Ga0307415_100012108
610 Ga0307415_100023135
611 Ga0307415_100040294
612 Ga0307415_100157016
613 Ga0307415_100199183
614 Ga0373937_0537944
615 Ga0395905_0051061
616 Ga0242420_008233
617 Ga0436365_0694916
618 Ga0439441_000969
619 Ga0439448_0000290
620 Ga0439448_0040957
621 Ga0439450_000149
622 Ga0439451_012106
623 Ga0439454_003832
624 Ga0439454_005740
625 Ga0439455_0003471
626 Ga0439455_0007313
627 Ga0439456_025813
628 Ga0439463_000109
629 Ga0450888_002216
630 Ga0450900_017278
631 Ga0439444_0000212
632 Ga0439444_0013346
633 Ga0439464_0001676
634 Ga0439464_0029696
635 Ga0439460_0000309
636 Ga0451577_0000727
637 Ga0439440_0000123
638 Ga0453683_0019341
639 Ga0466965_0120236
640 Ga0466965_0269533
641 Ga0466963_0045268
642 Ga0453684_0024934
643 Ga0466970_0342042
644 Ga0466959_0373932
645 Ga0451576_0098413
646 Ga0466958_0299363
647 Ga0466967_0231580
648 Ga0495603_0045340
649 Ga0495629_0004335
650 Ga0495594_0314480
651 Ga0495621_0007243
652 Ga0495621_0026639
653 Ga0495621_0043114
654 Ga0495645_0195674
655 Ga0495622_0119571
656 Ga0495599_0209014
657 Ga0495670_0085619
658 Ga0495600_0096193
659 Ga0495581_0200417
660 Ga0495680_0013295
661 Ga0495614_0108918
662 Ga0496106_0597473
663 Ga0496108_0000060
664 Ga0496108_0226795
665 Ga0496109_0024472
666 Ga0496109_0324513
667 Ga0496110_0013240
668 Ga0496110_0261587
669 Ga0496112_0268711
670 Ga0496115_0000289
671 Ga0501031_0003924
672 Ga0501031_0014740
673 Ga0501032_0089065
674 Ga0501032_0093828
675 Ga0501032_0119496
676 Ga0501036_0001001
677 Ga0501036_0003356
678 Ga0501036_0063914
679 Ga0501037_0023856
680 Ga0501037_0123108
681 Ga0501038_0003890
682 Ga0501038_0017058
683 Ga0501039_0014552
684 Ga0501039_0014762
685 Ga0501040_0000074
686 Ga0501040_0000876
687 Ga0501040_0050089
688 Ga0501041_0000805
689 Ga0501041_0001699
690 Ga0501042_0001070
691 Ga0501042_0040066
692 Ga0501042_0231693
693 Ga0501043_0013243
694 Ga0501043_0018877
695 Ga0501046_0001562
696 Ga0501046_0010673
697 Ga0501048_0000599
698 Ga0501048_0001484
699 Ga0501048_0029384
700 Ga0501048_0332193
701 Ga0501068_0102766
702 Ga0501069_0041344
703 Ga0501069_0105803
704 Ga0501070_0317545
705 Ga0501071_0026097
706 Ga0501071_0031133
707 Ga0501071_0124999
708 Ga0501072_0000363
709 Ga0501072_0076911
710 Ga0501074_0000272
711 Ga0501074_0006610
712 Ga0501075_0002947
713 Ga0501075_0063277
714 Ga0501075_0087589
715 Ga0501076_0000431
716 Ga0501076_0000503
717 Ga0501076_0018982
718 Ga0501077_0003878
719 Ga0501077_0010323
720 Ga0501079_0000072
721 Ga0501079_0001997
722 Ga0501080_0029391
723 Ga0501080_0226628
724 Ga0501081_0000766
725 Ga0501081_0002122
726 Ga0501083_0028301
727 Ga0501035_0003618
728 Ga0501044_0086841
729 Ga0501045_0000211
730 Ga0501045_0003650
731 Ga0501045_0024963
732 Ga0501045_0080591
733 nmdc:mga05p37_105587_c1
734 nmdc:mga05p37_170795_c1
735 nmdc:mga05p37_7576_c2
736 nmdc:mga05p37_951476_c1
737 nmdc:mga09592_10216_c1
738 nmdc:mga09592_399463_c1
739 nmdc:mga0qj67_541275_c1
740 nmdc:mga06r32_142303_c1
741 nmdc:mga06r32_2249_c1
742 nmdc:mga06r32_49451_c1
743 nmdc:mga08y16_78113_c1
744 nmdc:mga08y16_8720_c1
745 nmdc:mga0n895_160154_c1
746 nmdc:mga0n895_22489_c1
747 nmdc:mga0n895_283398_c1
748 nmdc:mga0n895_42584_c1
749 nmdc:mga0rr50_8537_c1
750 nmdc:mga0a205_17207_c1
751 nmdc:mga0a205_3042_c1
752 nmdc:mga0a205_3946_c1
753 nmdc:mga0a205_40600_c1
754 Ga0501084_0010985
755 Ga0501084_0016911
756 Ga0501084_0406086
757 Ga0590071_000016
758 Ga0590071_041985
759 Ga0590074_000078
760 Ga0590075_001765
761 Ga0590077_001223
762 Ga0590077_001651
763 Ga0501082_0000783
764 Ga0501082_0161230
765 Ga0530510_0000027
766 Ga0530510_0002057

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

33

272

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.8478 2 267
4wgh-assembly1.cif.gz_A crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with nadp and acetate at 1.8 a resolution 0.8399 3 267
6cia-assembly1.cif.gz_A crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph. 0.8369 2 267
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.835 5 266
3erp-assembly1.cif.gz_A structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.8322 1 268
ID Description Score Start End Superfamily
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8528 1 198 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8459 1 265 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8422 2 266 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8356 1 270 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8335 1 266 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A5J4KW63-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9979 55 171
AF-A0A535C9A0-F1-model_v4 Aldo/keto reductase 0.9895 1 169
AF-A0A838DUI6-F1-model_v4 Aldo/keto reductase 0.9889 1 184
AF-A0A7V8XTP2-F1-model_v4 Aldo/keto reductase 0.9888 120 237
AF-A0A538A1L0-F1-model_v4 Aldo/keto reductase 0.9886 39 267 GO:0016491

Map