F429327

General Info

Members Datasets Scaffolds Average Seq Length
382 173 764 120

Family's Representative Sequence

Representative Sequence 3300035241|Ga0373961_0434473|Ga0373961_0434473_27_470
Length 147
Sequence MDRSRYFSILKETVGTCSAHYPVDGDPMPHGKICYLEIPAKTAEASAEFYSTIFDWKVRKRGDGALAFDDTVGGVSGTWVKESDRTPDERTRTYIMVDDITATLKRIQQAGGRILTPRTDIGSGMGAFAAFADPVGNEFGLYEEPGS

Samples

Sample ID Description Type Environment
1 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.57
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 35.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373961_0434473 3300035241 Unclassified 509
2 JGI24034J14986_101481 3300001432 Bacteria 1334
3 JGI24748J21848_1000031 3300002074 Bacteria 80371
4 JGI24034J26672_10000005 3300002239 Bacteria 404185
5 JGI24742J22300_10024980 3300002244 Unclassified 1032
6 JGI25406J46586_10010601 3300003203 Bacteria 4085
7 JGI26145J50221_1019785 3300003371 Bacteria 645
8 JGI25405J52794_10007963 3300003911 Unclassified 1968
9 Ga0065714_10064481 3300005288 Bacteria 54282
10 Ga0065704_10188209 3300005289 Bacteria 1202
11 Ga0065704_10717262 3300005289 Bacteria 554
12 Ga0065712_10000143 3300005290 Bacteria 54339
13 Ga0065715_10006076 3300005293 Bacteria 3019
14 Ga0065715_10088954 3300005293 Bacteria 20865
15 Ga0065715_10125272 3300005293 Unclassified 2135
16 Ga0065715_10215843 3300005293 Unclassified 1293
17 Ga0065715_10232689 3300005293 Unclassified 1228
18 Ga0065707_10251956 3300005295 Bacteria 1122
19 Ga0070676_10914119 3300005328 Unclassified 654
20 Ga0070683_100062203 3300005329 Unclassified 3471
21 Ga0070683_100888560 3300005329 Bacteria 855
22 Ga0070690_101695046 3300005330 Unclassified 514
23 Ga0070677_10945051 3300005333 Unclassified 500
24 Ga0070680_100005747 3300005336 Bacteria 9412
25 Ga0070680_102008968 3300005336 Unclassified 501
26 Ga0070682_100007394 3300005337 Bacteria 6196
27 Ga0070691_10524088 3300005341 Unclassified 688
28 Ga0070687_100268119 3300005343 Bacteria 1069
29 Ga0070692_10020551 3300005345 Bacteria 3202
30 Ga0070675_100254421 3300005354 Bacteria 1538
31 Ga0070675_100534628 3300005354 Bacteria 1059
32 Ga0070671_100157598 3300005355 Bacteria 1918
33 Ga0070674_101874652 3300005356 Unclassified 544
34 Ga0070673_102193018 3300005364 Unclassified 525
35 Ga0070703_10000096 3300005406 Bacteria 45051
36 Ga0070703_10000797 3300005406 Bacteria 10322
37 Ga0070703_10170716 3300005406 Unclassified 833
38 Ga0070709_10007910 3300005434 Bacteria 5838
39 Ga0070710_10182065 3300005437 Bacteria 1316
40 Ga0070711_100000061 3300005439 Bacteria 64645
41 Ga0070711_100068287 3300005439 Unclassified 2497
42 Ga0070705_100275340 3300005440 Unclassified 1194
43 Ga0070705_100732893 3300005440 Bacteria 780
44 Ga0070694_100020136 3300005444 Unclassified 4250
45 Ga0070694_100085534 3300005444 Bacteria 2202
46 Ga0070694_100089714 3300005444 Bacteria 2154
47 Ga0070694_100238452 3300005444 Bacteria 1371
48 Ga0070708_100056835 3300005445 Bacteria 3481
49 Ga0070708_100167372 3300005445 Bacteria 2050
50 Ga0070708_100173242 3300005445 Unclassified 2015
51 Ga0070708_100795712 3300005445 Unclassified 889
52 Ga0070678_100895888 3300005456 Bacteria 811
53 Ga0070681_10495837 3300005458 Unclassified 1134
54 Ga0068867_101406668 3300005459 Unclassified 647
55 Ga0068867_101824008 3300005459 Bacteria 572
56 Ga0070706_100000328 3300005467 Bacteria 57851
57 Ga0070706_100002422 3300005467 Bacteria 18799
58 Ga0070706_100230100 3300005467 Bacteria 1730
59 Ga0070706_100247899 3300005467 Unclassified 1663
60 Ga0070706_100697577 3300005467 Bacteria 941
61 Ga0070706_101575133 3300005467 Unclassified 600
62 Ga0070707_100004033 3300005468 Bacteria 13811
63 Ga0070707_100037397 3300005468 Bacteria 4631
64 Ga0070707_100178442 3300005468 Bacteria 2070
65 Ga0070707_100409308 3300005468 Unclassified 1317
66 Ga0070707_100431971 3300005468 Unclassified 1277
67 Ga0070707_100664673 3300005468 Unclassified 1005
68 Ga0070698_100231834 3300005471 Unclassified 1779
69 Ga0070698_100262223 3300005471 Bacteria 1660
70 Ga0070698_100372412 3300005471 Unclassified 1360
71 Ga0070699_100028788 3300005518 Bacteria 4790
72 Ga0070699_100049440 3300005518 Bacteria 3639
73 Ga0070699_100125322 3300005518 Unclassified 2261
74 Ga0070699_100166114 3300005518 Bacteria 1955
75 Ga0070699_100184647 3300005518 Unclassified 1851
76 Ga0070699_100194874 3300005518 Bacteria 1801
77 Ga0070699_100212741 3300005518 Bacteria 1721
78 Ga0070699_100261837 3300005518 Bacteria 1547
79 Ga0070684_100370710 3300005535 Bacteria 1318
80 Ga0070684_101244270 3300005535 Bacteria 700
81 Ga0070697_100000278 3300005536 Bacteria 41513
82 Ga0070697_100015222 3300005536 Bacteria 6037
83 Ga0070697_100135288 3300005536 Bacteria 2069
84 Ga0070697_100222060 3300005536 Bacteria 1610
85 Ga0070697_100280423 3300005536 Unclassified 1430
86 Ga0070697_100472050 3300005536 Bacteria 1095
87 Ga0070697_100575572 3300005536 Unclassified 989
88 Ga0070697_100675361 3300005536 Unclassified 910
89 Ga0070697_101240243 3300005536 Bacteria 665
90 Ga0070697_101275513 3300005536 Unclassified 655
91 Ga0070672_100000056 3300005543 Bacteria 50628
92 Ga0070695_100006243 3300005545 Bacteria 7039
93 Ga0070695_100015544 3300005545 Bacteria 4597
94 Ga0070695_100047265 3300005545 Bacteria 2749
95 Ga0070695_100067178 3300005545 Bacteria 2338
96 Ga0070695_101432420 3300005545 Unclassified 574
97 Ga0070696_100010188 3300005546 Bacteria 6291
98 Ga0070696_100016090 3300005546 Bacteria 5030
99 Ga0070696_100016130 3300005546 Bacteria 5025
100 Ga0070696_100018586 3300005546 Bacteria 4700
101 Ga0070696_100108343 3300005546 Unclassified 1998
102 Ga0070696_100302498 3300005546 Archaea 1225
103 Ga0070696_100408633 3300005546 Bacteria 1064
104 Ga0070696_101585201 3300005546 Bacteria 562
105 Ga0070696_101606846 3300005546 Unclassified 558
106 Ga0070693_100210670 3300005547 Bacteria 1268
107 Ga0070693_100630357 3300005547 Bacteria 777
108 Ga0070693_100667957 3300005547 Bacteria 757
109 Ga0070693_101553625 3300005547 Bacteria 518
110 Ga0070704_100007794 3300005549 Bacteria 6384
111 Ga0070704_100009003 3300005549 Bacteria 6018
112 Ga0070704_100049742 3300005549 Bacteria 2942
113 Ga0070704_100054941 3300005549 Bacteria 2821
114 Ga0070704_100111131 3300005549 Bacteria 2085
115 Ga0070704_100138552 3300005549 Unclassified 1896
116 Ga0070704_100181590 3300005549 Bacteria 1683
117 Ga0070704_100959300 3300005549 Unclassified 772
118 Ga0070664_100035354 3300005564 Bacteria 4194
119 Ga0070702_101380127 3300005615 Unclassified 575
120 Ga0068864_100559665 3300005618 Bacteria 1106
121 Ga0068861_102046266 3300005719 Unclassified 572
122 Ga0068858_100000384 3300005842 Bacteria 46280
123 Ga0068858_100354339 3300005842 Bacteria 1406
124 Ga0068860_100290681 3300005843 Unclassified 1599
125 Ga0068860_100661499 3300005843 Bacteria 1053
126 Ga0068862_102663180 3300005844 Bacteria 512
127 Ga0081455_10002968 3300005937 Bacteria 19837
128 Ga0070716_100912583 3300006173 Unclassified 689
129 Ga0070712_100897183 3300006175 Bacteria 764
130 Ga0070712_102041478 3300006175 Unclassified 502
131 Ga0097621_100278997 3300006237 Unclassified 1470
132 Ga0075428_100055185 3300006844 Bacteria 4353
133 Ga0075428_100131888 3300006844 Bacteria 2717
134 Ga0075428_100314977 3300006844 Bacteria 1682
135 Ga0075428_101098348 3300006844 Unclassified 840
136 Ga0075428_101328065 3300006844 Bacteria 756
137 Ga0075430_100010637 3300006846 Bacteria 7796
138 Ga0075430_100117009 3300006846 Unclassified 2221
139 Ga0075431_100043756 3300006847 Unclassified 4619
140 Ga0075431_100076466 3300006847 Bacteria 3455
141 Ga0075431_100184996 3300006847 Bacteria 2136
142 Ga0075431_100921431 3300006847 Bacteria 843
143 Ga0075431_100973627 3300006847 Unclassified 816
144 Ga0075431_101782613 3300006847 Unclassified 572
145 Ga0075431_101936719 3300006847 Unclassified 545
146 Ga0075433_10016414 3300006852 Bacteria 6103
147 Ga0075433_10111442 3300006852 Bacteria 2427
148 Ga0075433_10113275 3300006852 Bacteria 2406
149 Ga0075433_10142541 3300006852 Bacteria 2130
150 Ga0075433_10169114 3300006852 Bacteria 1945
151 Ga0075433_10346676 3300006852 Bacteria 1313
152 Ga0075433_10349749 3300006852 Unclassified 1306
153 Ga0075433_10450522 3300006852 Bacteria 1135
154 Ga0075433_10618224 3300006852 Unclassified 951
155 Ga0075433_11527478 3300006852 Unclassified 577
156 Ga0075434_100000684 3300006871 Bacteria 26399
157 Ga0075434_100031196 3300006871 Bacteria 5253
158 Ga0075434_100044760 3300006871 Bacteria 4390
159 Ga0075434_100126461 3300006871 Bacteria 2573
160 Ga0075434_100208169 3300006871 Bacteria 1977
161 Ga0075434_100244996 3300006871 Unclassified 1812
162 Ga0075434_100386253 3300006871 Bacteria 1421
163 Ga0075434_100484525 3300006871 Unclassified 1258
164 Ga0075434_101363075 3300006871 Bacteria 720
165 Ga0075429_100002103 3300006880 Bacteria 16621
166 Ga0075429_100024335 3300006880 Bacteria 5254
167 Ga0075429_100110063 3300006880 Unclassified 2408
168 Ga0075429_100364568 3300006880 Unclassified 1265
169 Ga0075429_100690942 3300006880 Bacteria 894
170 Ga0068865_100333845 3300006881 Unclassified 1223
171 Ga0075436_100180944 3300006914 Unclassified 1490
172 Ga0075436_100318299 3300006914 Unclassified 1117
173 Ga0075436_100577875 3300006914 Bacteria 826
174 Ga0075436_100694355 3300006914 Unclassified 753
175 Ga0075435_100366368 3300007076 Bacteria 1237
176 Ga0075435_100452670 3300007076 Bacteria 1107
177 Ga0099795_10370010 3300007788 Unclassified 645
178 Ga0105250_10131720 3300009092 Unclassified 1032
179 Ga0111539_10006638 3300009094 Bacteria 14906
180 Ga0111539_10522929 3300009094 Bacteria 1382
181 Ga0111539_10937060 3300009094 Unclassified 1007
182 Ga0105245_11052777 3300009098 Unclassified 859
183 Ga0105245_13247286 3300009098 Bacteria 504
184 Ga0105247_10000033 3300009101 Bacteria 184433
185 Ga0114129_10031960 3300009147 Bacteria 7441
186 Ga0114129_10032528 3300009147 Bacteria 7371
187 Ga0114129_10071913 3300009147 Bacteria 4822
188 Ga0114129_10088454 3300009147 Bacteria 4294
189 Ga0114129_10184272 3300009147 Bacteria 2838
190 Ga0114129_10688067 3300009147 Unclassified 1316
191 Ga0114129_10836045 3300009147 Bacteria 1172
192 Ga0114129_11099611 3300009147 Unclassified 995
193 Ga0114129_11191554 3300009147 Bacteria 949
194 Ga0105243_10000609 3300009148 Bacteria 35657
195 Ga0105243_12214517 3300009148 Unclassified 586
196 Ga0105243_12579460 3300009148 Unclassified 548
197 Ga0105241_10100338 3300009174 Bacteria 2300
198 Ga0105241_10192030 3300009174 Unclassified 1700
199 Ga0105242_10002620 3300009176 Bacteria 14111
200 Ga0105242_11340793 3300009176 Bacteria 741
201 Ga0105249_12660697 3300009553 Unclassified 572
202 Ga0105249_13373539 3300009553 Unclassified 514
203 Ga0105239_10684909 3300010375 Bacteria 1172
204 Ga0157373_10302679 3300013100 Bacteria 1135
205 Ga0157373_10822168 3300013100 Bacteria 686
206 Ga0157378_10006529 3300013297 Bacteria 10199
207 Ga0157378_10096902 3300013297 Unclassified 2688
208 Ga0157378_10235003 3300013297 Bacteria 1748
209 Ga0157378_10547196 3300013297 Bacteria 1162
210 Ga0157372_10819495 3300013307 Bacteria 1081
211 Ga0157372_10880756 3300013307 Bacteria 1039
212 Ga0157375_10000388 3300013308 Bacteria 39973
213 Ga0157375_10011717 3300013308 Bacteria 7750
214 Ga0157375_11193982 3300013308 Bacteria 892
215 Ga0163163_12777868 3300014325 Bacteria 546
216 Ga0157380_10302990 3300014326 Bacteria 1473
217 Ga0157380_10672317 3300014326 Bacteria 1036
218 Ga0157380_11296981 3300014326 Unclassified 775
219 Ga0157377_10599032 3300014745 Bacteria 786
220 Ga0157379_11017447 3300014968 Unclassified 790
221 Ga0207672_1000064 3300025223 Bacteria 14266
222 Ga0207653_10000195 3300025885 Bacteria 41499
223 Ga0207653_10000834 3300025885 Bacteria 10273
224 Ga0207653_10215662 3300025885 Unclassified 727
225 Ga0207710_10000001 3300025900 Bacteria 1797433
226 Ga0207699_10005960 3300025906 Bacteria 5867
227 Ga0207699_10806851 3300025906 Unclassified 690
228 Ga0207645_10623215 3300025907 Bacteria 733
229 Ga0207684_10000958 3300025910 Bacteria 32478
230 Ga0207684_10002226 3300025910 Bacteria 19780
231 Ga0207684_10110883 3300025910 Bacteria 2349
232 Ga0207684_10227218 3300025910 Bacteria 1610
233 Ga0207684_10563911 3300025910 Bacteria 974
234 Ga0207684_10667035 3300025910 Bacteria 885
235 Ga0207654_10088822 3300025911 Bacteria 1879
236 Ga0207663_10000005 3300025916 Bacteria 282473
237 Ga0207660_10004233 3300025917 Bacteria 9349
238 Ga0207662_10625752 3300025918 Unclassified 750
239 Ga0207649_10258650 3300025920 Bacteria 1257
240 Ga0207646_10008807 3300025922 Bacteria 10068
241 Ga0207646_10061686 3300025922 Unclassified 3346
242 Ga0207646_10157789 3300025922 Unclassified 2047
243 Ga0207646_10197826 3300025922 Unclassified 1815
244 Ga0207646_11265742 3300025922 Bacteria 645
245 Ga0207644_10000302 3300025931 Bacteria 32163
246 Ga0207706_10631348 3300025933 Unclassified 919
247 Ga0207686_10002204 3300025934 Bacteria 10725
248 Ga0207709_10005270 3300025935 Bacteria 7353
249 Ga0207669_11270745 3300025937 Unclassified 625
250 Ga0207704_10630155 3300025938 Unclassified 881
251 Ga0207665_10074961 3300025939 Unclassified 2317
252 Ga0207665_10915967 3300025939 Unclassified 696
253 Ga0207691_10001751 3300025940 Bacteria 21366
254 Ga0207661_11281201 3300025944 Bacteria 674
255 Ga0207679_10461384 3300025945 Bacteria 1128
256 Ga0207668_11803085 3300025972 Unclassified 552
257 Ga0207703_10000274 3300026035 Bacteria 57000
258 Ga0207703_10290763 3300026035 Bacteria 1487
259 Ga0207678_11749423 3300026067 Bacteria 545
260 Ga0207708_10092106 3300026075 Bacteria 2338
261 Ga0207708_11443341 3300026075 Unclassified 604
262 Ga0207702_10088051 3300026078 Bacteria 2712
263 Ga0207648_10344970 3300026089 Unclassified 1342
264 Ga0207648_11494128 3300026089 Bacteria 635
265 Ga0207676_10312727 3300026095 Bacteria 1439
266 Ga0207683_10803382 3300026121 Unclassified 873
267 Ga0207698_10180771 3300026142 Unclassified 1868
268 Ga0209981_1002536 3300027378 Unclassified 2330
269 Ga0209996_1001656 3300027395 Unclassified 2713
270 Ga0209984_1001530 3300027424 Bacteria 2504
271 Ga0210002_1026050 3300027617 Bacteria 958
272 Ga0209983_1052740 3300027665 Bacteria 891
273 Ga0209983_1076642 3300027665 Bacteria 748
274 Ga0209971_1055728 3300027682 Bacteria 956
275 Ga0209974_10007986 3300027876 Bacteria 3627
276 Ga0268265_10988114 3300028380 Bacteria 831
277 Ga0268264_10419018 3300028381 Unclassified 1291
278 Ga0268264_11980169 3300028381 Unclassified 592
279 Ga0307513_10733340 3300031456 Bacteria 694
280 Ga0307408_101282052 3300031548 Unclassified 686
281 Ga0307413_10439856 3300031824 Bacteria 1032
282 Ga0307406_10617232 3300031901 Bacteria 896
283 Ga0307407_10556132 3300031903 Bacteria 849
284 Ga0307409_100399689 3300031995 Unclassified 1312
285 Ga0307416_100291104 3300032002 Unclassified 1617
286 Ga0307416_100746343 3300032002 Bacteria 1071
287 Ga0307411_10353468 3300032005 Bacteria 1199
288 Ga0307411_10521903 3300032005 Bacteria 1008
289 Ga0307415_100104567 3300032126 Bacteria 2086
290 Ga0307415_100710168 3300032126 Bacteria 908
291 Ga0373941_0027742 3300035115 Bacteria 1656
292 Ga0373946_0306751 3300035171 Bacteria 786
293 Ga0373942_0065976 3300035207 Unclassified 1047
294 Ga0373931_0785165 3300035691 Unclassified 634
295 Ga0395899_0058426 3300037312 Bacteria 2845
296 Ga0395901_0369419 3300038443 Bacteria 1478
297 Ga0242420_098079 3300038996 Bacteria 621
298 Ga0451802_1762647 3300041460 Unclassified 676
299 Ga0451577_0536267 3300042876 Unclassified 1063
300 Ga0453683_0005690 3300044673 Bacteria 8656
301 Ga0453683_0128539 3300044673 Bacteria 1596
302 Ga0453683_0846536 3300044673 Unclassified 603
303 Ga0453684_0460534 3300044712 Unclassified 1414
304 Ga0453684_1222333 3300044712 Unclassified 788
305 Ga0453684_1229420 3300044712 Unclassified 785
306 Ga0451576_0005666 3300045051 Bacteria 15593
307 Ga0451576_0057233 3300045051 Bacteria 4075
308 Ga0451576_0117262 3300045051 Bacteria 2771
309 Ga0451576_0313024 3300045051 Unclassified 1643
310 Ga0466967_1461758 3300045976 Bacteria 681
311 Ga0495633_0275554 3300046558 Bacteria 766
312 Ga0495581_0506190 3300047315 Unclassified 702
313 Ga0495593_0029626 3300047673 Bacteria 3000
314 Ga0496104_0273786 3300048907 Bacteria 1601
315 Ga0496106_0011146 3300048909 Bacteria 6651
316 Ga0496107_1269035 3300048910 Unclassified 528
317 Ga0496112_0130931 3300048915 Unclassified 2479
318 Ga0496112_0494045 3300048915 Bacteria 1159
319 Ga0501040_0374104 3300049576 Unclassified 1022
320 Ga0501076_0432164 3300049592 Bacteria 1084
321 Ga0501235_117964 3300049669 Bacteria 662
322 nmdc:mga05p37_11722_c1 3300050507 Bacteria 10450
323 nmdc:mga05p37_128569_c1 3300050507 Unclassified 3110
324 nmdc:mga05p37_135380_c1 3300050507 Bacteria 3022
325 nmdc:mga05p37_153385_c1 3300050507 Bacteria 2816
326 nmdc:mga05p37_227578_c2 3300050507 Unclassified 1821
327 nmdc:mga05p37_235107_c1 3300050507 Bacteria 2206
328 nmdc:mga05p37_24561_c1 3300050507 Bacteria 7326
329 nmdc:mga05p37_246731_c1 3300050507 Bacteria 2143
330 nmdc:mga05p37_27877_c1 3300050507 Bacteria 6881
331 nmdc:mga05p37_430644_c1 3300050507 Unclassified 1533
332 nmdc:mga05p37_531921_c1 3300050507 Bacteria 1342
333 nmdc:mga05p37_965612_c1 3300050507 Unclassified 598
334 nmdc:mga09592_128103_c1 3300050508 Bacteria 2183
335 nmdc:mga09592_131581_c1 3300050508 Bacteria 2153
336 nmdc:mga09592_274_c1 3300050508 Bacteria 37392
337 nmdc:mga09592_28571_c1 3300050508 Bacteria 4633
338 nmdc:mga09592_521424_c1 3300050508 Bacteria 1022
339 nmdc:mga09592_565403_c1 3300050508 Unclassified 976
340 nmdc:mga09592_72901_c1 3300050508 Unclassified 2917
341 nmdc:mga0qj67_1232313_c1 3300050509 Unclassified 581
342 nmdc:mga0qj67_1387516_c1 3300050509 Bacteria 543
343 nmdc:mga0qj67_35874_c1 3300050509 Unclassified 3878
344 nmdc:mga06r32_205654_c1 3300050510 Bacteria 1957
345 nmdc:mga06r32_79172_c1 3300050510 Unclassified 3196
346 nmdc:mga06r32_868862_c1 3300050510 Unclassified 860
347 nmdc:mga08y16_41375_c1 3300050511 Bacteria 4827
348 nmdc:mga0n895_1407646_c1 3300050512 Bacteria 666
349 nmdc:mga0n895_142098_c1 3300050512 Bacteria 2429
350 nmdc:mga0n895_1430793_c1 3300050512 Unclassified 659
351 nmdc:mga0n895_1580_c1 3300050512 Bacteria 17139
352 nmdc:mga0n895_34073_c1 3300050512 Bacteria 4899
353 nmdc:mga0n895_365662_c1 3300050512 Bacteria 1460
354 nmdc:mga0n895_38790_c1 3300050512 Unclassified 4617
355 nmdc:mga0n895_435283_c1 3300050512 Unclassified 1325
356 nmdc:mga0n895_555044_c1 3300050512 Bacteria 1154
357 nmdc:mga0n895_684134_c1 3300050512 Unclassified 1023
358 nmdc:mga0n895_764679_c1 3300050512 Bacteria 958
359 nmdc:mga0n895_80846_c1 3300050512 Bacteria 3239
360 nmdc:mga0n895_831571_c1 3300050512 Bacteria 912
361 nmdc:mga0rr50_282978_c1 3300050513 Bacteria 1384
362 nmdc:mga0rr50_357990_c1 3300050513 Bacteria 1228
363 nmdc:mga0rr50_514422_c1 3300050513 Bacteria 1018
364 nmdc:mga0rr50_705914_c1 3300050513 Unclassified 861
365 nmdc:mga08x19_100195_c1 3300050514 Bacteria 1921
366 nmdc:mga08x19_145648_c1 3300050514 Bacteria 1602
367 nmdc:mga08x19_198495_c1 3300050514 Unclassified 1375
368 nmdc:mga08x19_284380_c1 3300050514 Bacteria 1146
369 nmdc:mga08x19_567222_c1 3300050514 Unclassified 804
370 nmdc:mga0a205_1017452_c1 3300050515 Unclassified 676
371 nmdc:mga0a205_152976_c1 3300050515 Bacteria 2206
372 nmdc:mga0a205_1607_c1 3300050515 Bacteria 19427
373 nmdc:mga0a205_338558_c1 3300050515 Unclassified 1373
374 nmdc:mga0a205_539600_c1 3300050515 Unclassified 1022
375 nmdc:mga0a205_642898_c1 3300050515 Unclassified 912
376 nmdc:mga0a205_93918_c1 3300050515 Bacteria 2898
377 Ga0501084_0042969 3300054114 Bacteria 3780
378 Ga0590071_000015 3300059421 Bacteria 45213
379 Ga0590075_000781 3300059424 Bacteria 8374
380 Ga0590077_000188 3300059426 Bacteria 17667
381 Ga0501082_0746127 3300060353 Bacteria 857
382 Ga0530510_0188948 3300061734 Unclassified 1529
383 Ga0373961_0434473
384 JGI24034J14986_101481
385 JGI24748J21848_1000031
386 JGI24034J26672_10000005
387 JGI24742J22300_10024980
388 JGI25406J46586_10010601
389 JGI26145J50221_1019785
390 JGI25405J52794_10007963
391 Ga0065714_10064481
392 Ga0065704_10188209
393 Ga0065704_10717262
394 Ga0065712_10000143
395 Ga0065715_10006076
396 Ga0065715_10088954
397 Ga0065715_10125272
398 Ga0065715_10215843
399 Ga0065715_10232689
400 Ga0065707_10251956
401 Ga0070676_10914119
402 Ga0070683_100062203
403 Ga0070683_100888560
404 Ga0070690_101695046
405 Ga0070677_10945051
406 Ga0070680_100005747
407 Ga0070680_102008968
408 Ga0070682_100007394
409 Ga0070691_10524088
410 Ga0070687_100268119
411 Ga0070692_10020551
412 Ga0070675_100254421
413 Ga0070675_100534628
414 Ga0070671_100157598
415 Ga0070674_101874652
416 Ga0070673_102193018
417 Ga0070703_10000096
418 Ga0070703_10000797
419 Ga0070703_10170716
420 Ga0070709_10007910
421 Ga0070710_10182065
422 Ga0070711_100000061
423 Ga0070711_100068287
424 Ga0070705_100275340
425 Ga0070705_100732893
426 Ga0070694_100020136
427 Ga0070694_100085534
428 Ga0070694_100089714
429 Ga0070694_100238452
430 Ga0070708_100056835
431 Ga0070708_100167372
432 Ga0070708_100173242
433 Ga0070708_100795712
434 Ga0070678_100895888
435 Ga0070681_10495837
436 Ga0068867_101406668
437 Ga0068867_101824008
438 Ga0070706_100000328
439 Ga0070706_100002422
440 Ga0070706_100230100
441 Ga0070706_100247899
442 Ga0070706_100697577
443 Ga0070706_101575133
444 Ga0070707_100004033
445 Ga0070707_100037397
446 Ga0070707_100178442
447 Ga0070707_100409308
448 Ga0070707_100431971
449 Ga0070707_100664673
450 Ga0070698_100231834
451 Ga0070698_100262223
452 Ga0070698_100372412
453 Ga0070699_100028788
454 Ga0070699_100049440
455 Ga0070699_100125322
456 Ga0070699_100166114
457 Ga0070699_100184647
458 Ga0070699_100194874
459 Ga0070699_100212741
460 Ga0070699_100261837
461 Ga0070684_100370710
462 Ga0070684_101244270
463 Ga0070697_100000278
464 Ga0070697_100015222
465 Ga0070697_100135288
466 Ga0070697_100222060
467 Ga0070697_100280423
468 Ga0070697_100472050
469 Ga0070697_100575572
470 Ga0070697_100675361
471 Ga0070697_101240243
472 Ga0070697_101275513
473 Ga0070672_100000056
474 Ga0070695_100006243
475 Ga0070695_100015544
476 Ga0070695_100047265
477 Ga0070695_100067178
478 Ga0070695_101432420
479 Ga0070696_100010188
480 Ga0070696_100016090
481 Ga0070696_100016130
482 Ga0070696_100018586
483 Ga0070696_100108343
484 Ga0070696_100302498
485 Ga0070696_100408633
486 Ga0070696_101585201
487 Ga0070696_101606846
488 Ga0070693_100210670
489 Ga0070693_100630357
490 Ga0070693_100667957
491 Ga0070693_101553625
492 Ga0070704_100007794
493 Ga0070704_100009003
494 Ga0070704_100049742
495 Ga0070704_100054941
496 Ga0070704_100111131
497 Ga0070704_100138552
498 Ga0070704_100181590
499 Ga0070704_100959300
500 Ga0070664_100035354
501 Ga0070702_101380127
502 Ga0068864_100559665
503 Ga0068861_102046266
504 Ga0068858_100000384
505 Ga0068858_100354339
506 Ga0068860_100290681
507 Ga0068860_100661499
508 Ga0068862_102663180
509 Ga0081455_10002968
510 Ga0070716_100912583
511 Ga0070712_100897183
512 Ga0070712_102041478
513 Ga0097621_100278997
514 Ga0075428_100055185
515 Ga0075428_100131888
516 Ga0075428_100314977
517 Ga0075428_101098348
518 Ga0075428_101328065
519 Ga0075430_100010637
520 Ga0075430_100117009
521 Ga0075431_100043756
522 Ga0075431_100076466
523 Ga0075431_100184996
524 Ga0075431_100921431
525 Ga0075431_100973627
526 Ga0075431_101782613
527 Ga0075431_101936719
528 Ga0075433_10016414
529 Ga0075433_10111442
530 Ga0075433_10113275
531 Ga0075433_10142541
532 Ga0075433_10169114
533 Ga0075433_10346676
534 Ga0075433_10349749
535 Ga0075433_10450522
536 Ga0075433_10618224
537 Ga0075433_11527478
538 Ga0075434_100000684
539 Ga0075434_100031196
540 Ga0075434_100044760
541 Ga0075434_100126461
542 Ga0075434_100208169
543 Ga0075434_100244996
544 Ga0075434_100386253
545 Ga0075434_100484525
546 Ga0075434_101363075
547 Ga0075429_100002103
548 Ga0075429_100024335
549 Ga0075429_100110063
550 Ga0075429_100364568
551 Ga0075429_100690942
552 Ga0068865_100333845
553 Ga0075436_100180944
554 Ga0075436_100318299
555 Ga0075436_100577875
556 Ga0075436_100694355
557 Ga0075435_100366368
558 Ga0075435_100452670
559 Ga0099795_10370010
560 Ga0105250_10131720
561 Ga0111539_10006638
562 Ga0111539_10522929
563 Ga0111539_10937060
564 Ga0105245_11052777
565 Ga0105245_13247286
566 Ga0105247_10000033
567 Ga0114129_10031960
568 Ga0114129_10032528
569 Ga0114129_10071913
570 Ga0114129_10088454
571 Ga0114129_10184272
572 Ga0114129_10688067
573 Ga0114129_10836045
574 Ga0114129_11099611
575 Ga0114129_11191554
576 Ga0105243_10000609
577 Ga0105243_12214517
578 Ga0105243_12579460
579 Ga0105241_10100338
580 Ga0105241_10192030
581 Ga0105242_10002620
582 Ga0105242_11340793
583 Ga0105249_12660697
584 Ga0105249_13373539
585 Ga0105239_10684909
586 Ga0157373_10302679
587 Ga0157373_10822168
588 Ga0157378_10006529
589 Ga0157378_10096902
590 Ga0157378_10235003
591 Ga0157378_10547196
592 Ga0157372_10819495
593 Ga0157372_10880756
594 Ga0157375_10000388
595 Ga0157375_10011717
596 Ga0157375_11193982
597 Ga0163163_12777868
598 Ga0157380_10302990
599 Ga0157380_10672317
600 Ga0157380_11296981
601 Ga0157377_10599032
602 Ga0157379_11017447
603 Ga0207672_1000064
604 Ga0207653_10000195
605 Ga0207653_10000834
606 Ga0207653_10215662
607 Ga0207710_10000001
608 Ga0207699_10005960
609 Ga0207699_10806851
610 Ga0207645_10623215
611 Ga0207684_10000958
612 Ga0207684_10002226
613 Ga0207684_10110883
614 Ga0207684_10227218
615 Ga0207684_10563911
616 Ga0207684_10667035
617 Ga0207654_10088822
618 Ga0207663_10000005
619 Ga0207660_10004233
620 Ga0207662_10625752
621 Ga0207649_10258650
622 Ga0207646_10008807
623 Ga0207646_10061686
624 Ga0207646_10157789
625 Ga0207646_10197826
626 Ga0207646_11265742
627 Ga0207644_10000302
628 Ga0207706_10631348
629 Ga0207686_10002204
630 Ga0207709_10005270
631 Ga0207669_11270745
632 Ga0207704_10630155
633 Ga0207665_10074961
634 Ga0207665_10915967
635 Ga0207691_10001751
636 Ga0207661_11281201
637 Ga0207679_10461384
638 Ga0207668_11803085
639 Ga0207703_10000274
640 Ga0207703_10290763
641 Ga0207678_11749423
642 Ga0207708_10092106
643 Ga0207708_11443341
644 Ga0207702_10088051
645 Ga0207648_10344970
646 Ga0207648_11494128
647 Ga0207676_10312727
648 Ga0207683_10803382
649 Ga0207698_10180771
650 Ga0209981_1002536
651 Ga0209996_1001656
652 Ga0209984_1001530
653 Ga0210002_1026050
654 Ga0209983_1052740
655 Ga0209983_1076642
656 Ga0209971_1055728
657 Ga0209974_10007986
658 Ga0268265_10988114
659 Ga0268264_10419018
660 Ga0268264_11980169
661 Ga0307513_10733340
662 Ga0307408_101282052
663 Ga0307413_10439856
664 Ga0307406_10617232
665 Ga0307407_10556132
666 Ga0307409_100399689
667 Ga0307416_100291104
668 Ga0307416_100746343
669 Ga0307411_10353468
670 Ga0307411_10521903
671 Ga0307415_100104567
672 Ga0307415_100710168
673 Ga0373941_0027742
674 Ga0373946_0306751
675 Ga0373942_0065976
676 Ga0373931_0785165
677 Ga0395899_0058426
678 Ga0395901_0369419
679 Ga0242420_098079
680 Ga0451802_1762647
681 Ga0451577_0536267
682 Ga0453683_0005690
683 Ga0453683_0128539
684 Ga0453683_0846536
685 Ga0453684_0460534
686 Ga0453684_1222333
687 Ga0453684_1229420
688 Ga0451576_0005666
689 Ga0451576_0057233
690 Ga0451576_0117262
691 Ga0451576_0313024
692 Ga0466967_1461758
693 Ga0495633_0275554
694 Ga0495581_0506190
695 Ga0495593_0029626
696 Ga0496104_0273786
697 Ga0496106_0011146
698 Ga0496107_1269035
699 Ga0496112_0130931
700 Ga0496112_0494045
701 Ga0501040_0374104
702 Ga0501076_0432164
703 Ga0501235_117964
704 nmdc:mga05p37_11722_c1
705 nmdc:mga05p37_128569_c1
706 nmdc:mga05p37_135380_c1
707 nmdc:mga05p37_153385_c1
708 nmdc:mga05p37_227578_c2
709 nmdc:mga05p37_235107_c1
710 nmdc:mga05p37_24561_c1
711 nmdc:mga05p37_246731_c1
712 nmdc:mga05p37_27877_c1
713 nmdc:mga05p37_430644_c1
714 nmdc:mga05p37_531921_c1
715 nmdc:mga05p37_965612_c1
716 nmdc:mga09592_128103_c1
717 nmdc:mga09592_131581_c1
718 nmdc:mga09592_274_c1
719 nmdc:mga09592_28571_c1
720 nmdc:mga09592_521424_c1
721 nmdc:mga09592_565403_c1
722 nmdc:mga09592_72901_c1
723 nmdc:mga0qj67_1232313_c1
724 nmdc:mga0qj67_1387516_c1
725 nmdc:mga0qj67_35874_c1
726 nmdc:mga06r32_205654_c1
727 nmdc:mga06r32_79172_c1
728 nmdc:mga06r32_868862_c1
729 nmdc:mga08y16_41375_c1
730 nmdc:mga0n895_1407646_c1
731 nmdc:mga0n895_142098_c1
732 nmdc:mga0n895_1430793_c1
733 nmdc:mga0n895_1580_c1
734 nmdc:mga0n895_34073_c1
735 nmdc:mga0n895_365662_c1
736 nmdc:mga0n895_38790_c1
737 nmdc:mga0n895_435283_c1
738 nmdc:mga0n895_555044_c1
739 nmdc:mga0n895_684134_c1
740 nmdc:mga0n895_764679_c1
741 nmdc:mga0n895_80846_c1
742 nmdc:mga0n895_831571_c1
743 nmdc:mga0rr50_282978_c1
744 nmdc:mga0rr50_357990_c1
745 nmdc:mga0rr50_514422_c1
746 nmdc:mga0rr50_705914_c1
747 nmdc:mga08x19_100195_c1
748 nmdc:mga08x19_145648_c1
749 nmdc:mga08x19_198495_c1
750 nmdc:mga08x19_284380_c1
751 nmdc:mga08x19_567222_c1
752 nmdc:mga0a205_1017452_c1
753 nmdc:mga0a205_152976_c1
754 nmdc:mga0a205_1607_c1
755 nmdc:mga0a205_338558_c1
756 nmdc:mga0a205_539600_c1
757 nmdc:mga0a205_642898_c1
758 nmdc:mga0a205_93918_c1
759 Ga0501084_0042969
760 Ga0590071_000015
761 Ga0590075_000781
762 Ga0590077_000188
763 Ga0501082_0746127
764 Ga0530510_0188948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

141

0.92

PF18029

Glyoxalase_6

Glyoxalase-like domain

35

142

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.8055 84 116
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7886 9 116
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.7749 9 115
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.7694 8 115
4fk1-assembly2.cif.gz_C crystal structure of putative thioredoxin reductase trxb from bacillus anthracis 0.7684 30 51
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8101 63 119 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8056 61 116 3.30.720.110
5zu3A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8011 97 115 3.50.50.60
5yy7B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8002 64 118 3.10.180.10
af_A0A1D6FD19_418_460_2.40.50.740 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Ribosomal protein S4, central domain 0.7958 30 54 2.40.50.740
ID Description Score Start End GO Terms
AF-A0A1Q7ZVB6-F1-model_v4 VOC domain-containing protein 0.9146 60 116
AF-A0A3C0S1G1-F1-model_v4 VOC family protein 0.8957 63 116
AF-A0A5M6C920-F1-model_v4 VOC domain-containing protein 0.8896 63 119
AF-A0A7W3W7R9-F1-model_v4 deleted 0.8836 66 118
AF-A0A1G8B487-F1-model_v4 VOC domain-containing protein 0.8779 57 116

Map