F428774

General Info

Members Datasets Scaffolds Average Seq Length
380 232 760 201

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0037797|Ga0495672_0037797_293_997
Length 234
Sequence MALFLLQLLCSPYVNSSRQCLYFSSNNKKPVMKKTATLSLLTAVIGMFSFSVFTVPSLPIGSPLPKADQKLTDVSGKEISLQEARKENGLLVMFSCNTCPVVKENQSRTKEICGYALNKNIGVVLLNSNEADRSSGNSLGEMQSYAKDQGYQWYYAVDKNNELADAFGASRTPEVYLFDKDSKLVYHGAIDDSPGNMKGVKRHHLKEAINEILDGKAVSTKETRSVGCAIKRAG

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
139 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
140 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
141 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
146 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
147 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
187 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
188 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
189 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
190 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
191 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
198 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
201 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
202 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 2738541278 Niastella sp. CF465 Isolate Unclassified
232 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.89
Metatranscriptomes 21.58
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.11
Nodule 0
Rhizoplane 1.84
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0037797 3300047320 Unclassified 2951
2 JGI24751J29686_10005698 3300002459 Bacteria 2538
3 JGI24751J29686_10010143 3300002459 Bacteria 1942
4 Ga0006778J45830_1119413 3300003162 Bacteria 743
5 Ga0006759J45824_1013129 3300003163 Bacteria 751
6 Ga0006758J48902_1005719 3300003300 Bacteria 761
7 Ga0006770J48903_1007016 3300003305 Bacteria 700
8 rootH2_10053682 3300003320 Bacteria 6853
9 rootL2_10163711 3300003322 Bacteria 5533
10 rootL2_10207756 3300003322 Bacteria 3868
11 rootL2_10271172 3300003322 Bacteria 1300
12 rootL2_10345165 3300003322 Unclassified 3268
13 rootH1_10021375 3300003323 Bacteria 11386
14 rootH1_10263317 3300003323 Bacteria 1690
15 Ga0007417J51691_1021703 3300003544 Bacteria 715
16 Ga0007410J51695_1041888 3300003574 Bacteria 679
17 Ga0032354_1016027 3300003693 Bacteria 744
18 Ga0032354_1020405 3300003693 Bacteria 743
19 Ga0032354_1033529 3300003693 Bacteria 730
20 Ga0058859_11356359 3300004798 Bacteria 737
21 Ga0058860_11755900 3300004801 Bacteria 758
22 Ga0058862_12437584 3300004803 Bacteria 758
23 Ga0070670_100686320 3300005331 Bacteria 920
24 Ga0068869_100098809 3300005334 Bacteria 2205
25 Ga0068868_100071432 3300005338 Bacteria 2768
26 Ga0068868_100249269 3300005338 Unclassified 1494
27 Ga0068868_100413552 3300005338 Bacteria 1166
28 Ga0070660_100351874 3300005339 Bacteria 1213
29 Ga0070668_100052077 3300005347 Bacteria 3155
30 Ga0070668_100075106 3300005347 Bacteria 2638
31 Ga0070669_100434545 3300005353 Unclassified 1079
32 Ga0070669_100541285 3300005353 Bacteria 970
33 Ga0070675_100032943 3300005354 Unclassified 4197
34 Ga0070675_100833990 3300005354 Bacteria 843
35 Ga0070671_100023664 3300005355 Bacteria 5029
36 Ga0070674_100044536 3300005356 Bacteria 3026
37 Ga0070674_100263694 3300005356 Bacteria 1358
38 Ga0070673_100155488 3300005364 Bacteria 1940
39 Ga0070688_100552541 3300005365 Bacteria 875
40 Ga0070667_100092101 3300005367 Bacteria 2607
41 Ga0070713_100533215 3300005436 Bacteria 1110
42 Ga0070663_100309907 3300005455 Bacteria 1266
43 Ga0070678_100139903 3300005456 Bacteria 1935
44 Ga0070678_100288157 3300005456 Bacteria 1391
45 Ga0068867_100141095 3300005459 Bacteria 1883
46 Ga0070684_100529345 3300005535 Bacteria 1093
47 Ga0068853_100179591 3300005539 Bacteria 1919
48 Ga0068853_100182622 3300005539 Bacteria 1903
49 Ga0068853_100308902 3300005539 Bacteria 1463
50 Ga0068853_100508513 3300005539 Bacteria 1138
51 Ga0068853_100587047 3300005539 Unclassified 1057
52 Ga0070672_100304112 3300005543 Bacteria 1352
53 Ga0070665_100000009 3300005548 Bacteria 562640
54 Ga0070665_100113338 3300005548 Bacteria 2714
55 Ga0070665_100771224 3300005548 Bacteria 974
56 Ga0070665_101068545 3300005548 Bacteria 819
57 Ga0068855_100004710 3300005563 Bacteria 16680
58 Ga0068855_100012457 3300005563 Bacteria 10268
59 Ga0068855_100376796 3300005563 Bacteria 1559
60 Ga0068855_100823939 3300005563 Unclassified 985
61 Ga0070664_100195917 3300005564 Bacteria 1801
62 Ga0070664_100333693 3300005564 Unclassified 1376
63 Ga0068857_100008152 3300005577 Bacteria 9046
64 Ga0068854_100125503 3300005578 Bacteria 1954
65 Ga0068852_100001323 3300005616 Bacteria 16594
66 Ga0068852_101297131 3300005616 Unclassified 750
67 Ga0068859_100096865 3300005617 Bacteria 3003
68 Ga0068864_100052042 3300005618 Bacteria 3529
69 Ga0068866_10076555 3300005718 Bacteria 1784
70 Ga0068866_10156658 3300005718 Bacteria 1324
71 Ga0068861_100235442 3300005719 Unclassified 1555
72 Ga0068861_100597729 3300005719 Bacteria 1012
73 Ga0068861_100814837 3300005719 Bacteria 877
74 Ga0068851_10238097 3300005834 Unclassified 1028
75 Ga0068858_100456804 3300005842 Unclassified 1231
76 Ga0068858_101622251 3300005842 Unclassified 638
77 Ga0068860_100000103 3300005843 Bacteria 139076
78 Ga0068860_100002588 3300005843 Bacteria 18925
79 Ga0068860_100007278 3300005843 Bacteria 11071
80 Ga0068860_100016594 3300005843 Bacteria 7182
81 Ga0068860_100061351 3300005843 Bacteria 3572
82 Ga0068860_100065275 3300005843 Bacteria 3457
83 Ga0068860_100541801 3300005843 Bacteria 1165
84 Ga0068860_101063086 3300005843 Bacteria 828
85 Ga0068862_100366001 3300005844 Bacteria 1341
86 Ga0081540_1005522 3300005983 Bacteria 9429
87 Ga0070712_100871667 3300006175 Bacteria 775
88 Ga0097621_100003071 3300006237 Bacteria 11446
89 Ga0068871_100001472 3300006358 Bacteria 15784
90 Ga0068865_100240559 3300006881 Bacteria 1424
91 Ga0097620_100096866 3300006931 Bacteria 3003
92 Ga0105240_10003898 3300009093 Bacteria 23042
93 Ga0105240_10018065 3300009093 Bacteria 9482
94 Ga0105240_10037831 3300009093 Bacteria 6197
95 Ga0105240_10075333 3300009093 Bacteria 4162
96 Ga0105240_10092479 3300009093 Unclassified 3693
97 Ga0111539_10009199 3300009094 Bacteria 12489
98 Ga0111539_10040741 3300009094 Bacteria 5589
99 Ga0111539_10305050 3300009094 Bacteria 1853
100 Ga0111539_10454329 3300009094 Bacteria 1492
101 Ga0105245_10476699 3300009098 Bacteria 1260
102 Ga0105247_10008423 3300009101 Bacteria 6283
103 Ga0114129_10285517 3300009147 Bacteria 2204
104 Ga0105241_10023283 3300009174 Bacteria 4593
105 Ga0105242_10087332 3300009176 Bacteria 2618
106 Ga0105242_10117760 3300009176 Bacteria 2274
107 Ga0105248_10059950 3300009177 Bacteria 4274
108 Ga0105248_10581835 3300009177 Bacteria 1263
109 Ga0105237_10001232 3300009545 Bacteria 34099
110 Ga0105237_10009446 3300009545 Bacteria 10447
111 Ga0105237_10031565 3300009545 Bacteria 5368
112 Ga0105237_10126330 3300009545 Bacteria 2552
113 Ga0105237_10229884 3300009545 Bacteria 1855
114 Ga0105238_10047259 3300009551 Unclassified 4342
115 Ga0105238_10196600 3300009551 Bacteria 1992
116 Ga0105249_10011582 3300009553 Bacteria 7750
117 Ga0105249_10143287 3300009553 Bacteria 2293
118 Ga0105249_10169598 3300009553 Bacteria 2115
119 Ga0105249_10902102 3300009553 Bacteria 951
120 Ga0105239_10000246 3300010375 Bacteria 80752
121 Ga0105239_10005163 3300010375 Bacteria 15405
122 Ga0105239_10011033 3300010375 Bacteria 10085
123 Ga0105239_10039217 3300010375 Bacteria 5189
124 Ga0105239_10748819 3300010375 Unclassified 1118
125 Ga0105246_10028493 3300011119 Bacteria 3669
126 Ga0157370_10025137 3300013104 Bacteria 5896
127 Ga0157369_10070373 3300013105 Bacteria 3759
128 Ga0157374_10075710 3300013296 Bacteria 3180
129 Ga0157374_10160007 3300013296 Bacteria 2193
130 Ga0157374_10216124 3300013296 Bacteria 1880
131 Ga0157374_11358344 3300013296 Unclassified 733
132 Ga0157378_10025854 3300013297 Bacteria 5172
133 Ga0157378_10128642 3300013297 Bacteria 2341
134 Ga0157378_11449559 3300013297 Bacteria 730
135 Ga0157378_11493782 3300013297 Unclassified 720
136 Ga0163162_10000533 3300013306 Bacteria 35238
137 Ga0163162_10001119 3300013306 Bacteria 24928
138 Ga0163162_10006348 3300013306 Bacteria 11447
139 Ga0163162_10023940 3300013306 Bacteria 6026
140 Ga0163162_10257591 3300013306 Bacteria 1876
141 Ga0163162_10430837 3300013306 Bacteria 1451
142 Ga0157372_10001035 3300013307 Bacteria 30418
143 Ga0157375_10000324 3300013308 Bacteria 42877
144 Ga0163163_10000973 3300014325 Bacteria 24371
145 Ga0163163_10717956 3300014325 Unclassified 1063
146 Ga0157380_10000544 3300014326 Bacteria 23197
147 Ga0157377_10121719 3300014745 Bacteria 1582
148 Ga0157379_10011377 3300014968 Bacteria 7761
149 Ga0157379_10818796 3300014968 Bacteria 880
150 Ga0157376_10015940 3300014969 Bacteria 5693
151 Ga0157376_10295685 3300014969 Bacteria 1531
152 Ga0163161_10018334 3300017792 Unclassified 4906
153 Ga0163161_10019412 3300017792 Bacteria 4769
154 Ga0163161_10086053 3300017792 Bacteria 2320
155 Ga0197907_10539023 3300020069 Bacteria 811
156 Ga0206356_10462901 3300020070 Bacteria 725
157 Ga0206355_1147311 3300020076 Bacteria 717
158 Ga0206351_10812334 3300020077 Eukaryota 701
159 Ga0206352_10143444 3300020078 Bacteria 820
160 Ga0206352_10144710 3300020078 Bacteria 741
161 Ga0206354_11273201 3300020081 Bacteria 702
162 Ga0206353_11804303 3300020082 Bacteria 746
163 Ga0224712_10352039 3300022467 Bacteria 696
164 Ga0209646_1003330 3300025246 Bacteria 3202
165 Ga0207642_10064247 3300025899 Bacteria 1720
166 Ga0207642_10131368 3300025899 Bacteria 1307
167 Ga0207710_10003698 3300025900 Bacteria 6780
168 Ga0207688_10010187 3300025901 Bacteria 5117
169 Ga0207647_10043118 3300025904 Bacteria 2824
170 Ga0207645_10003157 3300025907 Bacteria 12616
171 Ga0207654_10345453 3300025911 Unclassified 1023
172 Ga0207695_10098123 3300025913 Unclassified 2929
173 Ga0207695_10112307 3300025913 Bacteria 2703
174 Ga0207695_10169689 3300025913 Bacteria 2108
175 Ga0207695_10307651 3300025913 Unclassified 1475
176 Ga0207671_10001075 3300025914 Bacteria 33165
177 Ga0207671_10003986 3300025914 Bacteria 14347
178 Ga0207671_10018281 3300025914 Bacteria 5381
179 Ga0207657_10303711 3300025919 Bacteria 1264
180 Ga0207681_10064609 3300025923 Bacteria 2528
181 Ga0207694_10501575 3300025924 Unclassified 1016
182 Ga0207650_10131193 3300025925 Bacteria 1961
183 Ga0207650_10569036 3300025925 Bacteria 951
184 Ga0207659_10049473 3300025926 Bacteria 2982
185 Ga0207659_10736387 3300025926 Bacteria 845
186 Ga0207690_10306379 3300025932 Bacteria 1244
187 Ga0207686_10183622 3300025934 Bacteria 1485
188 Ga0207669_10114568 3300025937 Bacteria 1815
189 Ga0207669_10158972 3300025937 Bacteria 1593
190 Ga0207704_10274780 3300025938 Bacteria 1278
191 Ga0207691_10394729 3300025940 Bacteria 1180
192 Ga0207691_10658519 3300025940 Bacteria 884
193 Ga0207711_10144040 3300025941 Bacteria 2146
194 Ga0207689_10003166 3300025942 Bacteria 15084
195 Ga0207689_10013918 3300025942 Bacteria 6852
196 Ga0207667_10002492 3300025949 Bacteria 22948
197 Ga0207667_10007482 3300025949 Bacteria 13115
198 Ga0207667_10013089 3300025949 Bacteria 9520
199 Ga0207651_10099566 3300025960 Bacteria 2153
200 Ga0207712_10057889 3300025961 Bacteria 2736
201 Ga0207668_10163501 3300025972 Bacteria 1737
202 Ga0207640_10006797 3300025981 Bacteria 6291
203 Ga0207640_10105649 3300025981 Bacteria 1984
204 Ga0207658_10352015 3300025986 Bacteria 1283
205 Ga0207658_10425158 3300025986 Bacteria 1172
206 Ga0207677_10110420 3300026023 Bacteria 2047
207 Ga0207677_10452519 3300026023 Bacteria 1100
208 Ga0207703_10809102 3300026035 Unclassified 895
209 Ga0207703_11503051 3300026035 Unclassified 648
210 Ga0207639_10042837 3300026041 Unclassified 3395
211 Ga0207641_10808252 3300026088 Bacteria 928
212 Ga0207648_10003201 3300026089 Bacteria 17242
213 Ga0207648_10110786 3300026089 Bacteria 2410
214 Ga0207674_10001043 3300026116 Bacteria 36010
215 Ga0207674_10566505 3300026116 Bacteria 1097
216 Ga0207675_100123998 3300026118 Bacteria 2446
217 Ga0207675_100185550 3300026118 Bacteria 1993
218 Ga0207675_100322415 3300026118 Bacteria 1509
219 Ga0207675_100936831 3300026118 Bacteria 883
220 Ga0207683_10001842 3300026121 Bacteria 18744
221 Ga0207698_10021345 3300026142 Bacteria 4476
222 Ga0268266_10000105 3300028379 Bacteria 176691
223 Ga0268265_10119981 3300028380 Unclassified 2165
224 Ga0268265_10604952 3300028380 Bacteria 1048
225 Ga0268264_10000013 3300028381 Bacteria 513859
226 Ga0268264_10001619 3300028381 Bacteria 20805
227 Ga0268264_10005141 3300028381 Bacteria 11086
228 Ga0268264_10011517 3300028381 Bacteria 7305
229 Ga0268264_10048153 3300028381 Bacteria 3545
230 Ga0268264_10358847 3300028381 Bacteria 1389
231 Ga0268264_10649908 3300028381 Bacteria 1044
232 Ga0307517_10326775 3300028786 Unclassified 845
233 Ga0307513_10199423 3300031456 Bacteria 1843
234 Ga0307509_10044028 3300031507 Bacteria 4824
235 Ga0307508_10274960 3300031616 Bacteria 1278
236 Ga0307516_10146878 3300031730 Bacteria 2123
237 Ga0307510_10001098 3300033180 Bacteria 28868
238 Ga0373947_0328165 3300035725 Bacteria 1024
239 Ga0373925_0308804 3300037068 Bacteria 1278
240 Ga0439436_0026667 3300041404 Bacteria 1693
241 Ga0439439_0033652 3300041406 Bacteria 1313
242 Ga0451794_22069 3300041446 Bacteria 744
243 Ga0451805_020748 3300041461 Bacteria 688
244 Ga0451804_0001538 3300041463 Bacteria 859
245 Ga0451833_1109552 3300041491 Unclassified 882
246 Ga0451837_0683955 3300041494 Bacteria 739
247 Ga0451854_39618 3300041510 Bacteria 659
248 Ga0451853_0140988 3300041512 Bacteria 1983
249 Ga0452268_18717 3300041907 Bacteria 655
250 Ga0452268_48418 3300041907 Bacteria 650
251 Ga0452271_52223 3300041916 Bacteria 782
252 Ga0439433_0007002 3300041999 Bacteria 2434
253 Ga0439449_0008238 3300042007 Bacteria 3964
254 Ga0439449_0132931 3300042007 Bacteria 925
255 Ga0439449_0206467 3300042007 Bacteria 735
256 Ga0439457_000268 3300042014 Bacteria 14301
257 Ga0439457_006693 3300042014 Bacteria 2801
258 Ga0439462_0021156 3300042015 Bacteria 1698
259 Ga0439462_0033355 3300042015 Unclassified 1365
260 Ga0451577_0755363 3300042876 Bacteria 879
261 Ga0466972_0000092 3300044658 Bacteria 80656
262 Ga0466972_0006463 3300044658 Bacteria 5889
263 Ga0466965_0146148 3300044683 Bacteria 1234
264 Ga0466961_0263403 3300044693 Unclassified 1057
265 Ga0466964_0005934 3300044706 Bacteria 4549
266 Ga0453684_0545563 3300044712 Bacteria 1278
267 Ga0466957_0000580 3300044842 Bacteria 18501
268 Ga0495638_0229380 3300046460 Bacteria 1034
269 Ga0495606_0080048 3300046507 Bacteria 2034
270 Ga0495648_0001451 3300046524 Bacteria 23185
271 Ga0495668_0028064 3300046616 Bacteria 3185
272 Ga0495611_0000115 3300046648 Bacteria 56623
273 Ga0495649_0046960 3300046694 Unclassified 2350
274 Ga0495672_0021334 3300047320 Bacteria 4226
275 Ga0495687_000010 3300047443 Bacteria 413735
276 Ga0495686_0015104 3300047472 Bacteria 5289
277 Ga0496100_0165288 3300048903 Bacteria 1589
278 Ga0496104_0522015 3300048907 Bacteria 1099
279 Ga0496106_0472896 3300048909 Unclassified 1007
280 Ga0496114_0271771 3300048917 Bacteria 1494
281 Ga0496124_0049477 3300048927 Bacteria 3586
282 Ga0501315_033217 3300049531 Bacteria 753
283 Ga0501322_010221 3300049538 Bacteria 720
284 Ga0501327_06589 3300049543 Bacteria 708
285 Ga0501335_020487 3300049551 Bacteria 704
286 Ga0501034_0071735 3300049571 Bacteria 3473
287 Ga0501034_0161217 3300049571 Bacteria 2214
288 Ga0501037_0392461 3300049573 Bacteria 953
289 Ga0501043_0125687 3300049579 Bacteria 2011
290 Ga0501047_0491571 3300049581 Bacteria 1054
291 Ga0501225_0001093 3300049705 Bacteria 8507
292 Ga0501080_0918713 3300049742 Bacteria 762
293 Ga0501044_0005599 3300049823 Bacteria 13947
294 Ga0501044_0045791 3300049823 Bacteria 4531
295 nmdc:mga0k408_134012_c1 3300050493 Bacteria 1471
296 nmdc:mga0k408_179156_c1 3300050493 Bacteria 1264
297 nmdc:mga0k408_66072_c1 3300050493 Bacteria 2106
298 nmdc:mga05p37_340452_c1 3300050507 Bacteria 1769
299 nmdc:mga09592_636417_c1 3300050508 Unclassified 911
300 nmdc:mga08y16_142885_c1 3300050511 Bacteria 2488
301 nmdc:mga08y16_159243_c1 3300050511 Bacteria 2345
302 nmdc:mga08y16_220618_c1 3300050511 Unclassified 1963
303 Ga0500578_0000019 3300053086 Bacteria 169042
304 Ga0500644_0002938 3300053088 Bacteria 4231
305 Ga0500646_0054177 3300053090 Bacteria 1164
306 Ga0500583_0000018 3300053092 Bacteria 138148
307 Ga0500583_0001189 3300053092 Bacteria 7443
308 Ga0500583_0030017 3300053092 Bacteria 2377
309 Ga0500583_0031817 3300053092 Bacteria 2323
310 Ga0500555_077079 3300053103 Bacteria 871
311 Ga0500572_095943 3300053111 Bacteria 944
312 Ga0500594_0023670 3300053118 Bacteria 1560
313 Ga0500594_0027477 3300053118 Bacteria 1474
314 Ga0500594_0146890 3300053118 Bacteria 755
315 Ga0500642_0017450 3300053130 Bacteria 2752
316 Ga0500642_0109802 3300053130 Unclassified 1287
317 Ga0500658_0131780 3300053134 Bacteria 1116
318 Ga0500568_0051645 3300053139 Bacteria 1617
319 Ga0500573_0316633 3300053140 Bacteria 773
320 Ga0500589_032734 3300053147 Bacteria 2425
321 Ga0500604_0003892 3300053151 Bacteria 3989
322 Ga0500622_0089099 3300053156 Bacteria 1533
323 Ga0500622_0128667 3300053156 Unclassified 1219
324 Ga0500622_0146889 3300053156 Bacteria 1118
325 Ga0500636_0178327 3300053177 Bacteria 1143
326 Ga0500661_022544 3300055283 Bacteria 1116
327 Ga0587084_044725 3300059477 Bacteria 764
328 Ga0587084_060384 3300059477 Bacteria 694
329 Ga0587066_074503 3300059490 Bacteria 722
330 Ga0587070_067155 3300059491 Bacteria 756
331 Ga0587073_0113678 3300059492 Bacteria 721
332 Ga0587073_0124435 3300059492 Bacteria 700
333 Ga0587083_0100602 3300059505 Bacteria 719
334 Ga0587085_049422 3300059506 Bacteria 761
335 Ga0587085_062894 3300059506 Bacteria 707
336 Ga0587086_033769 3300059507 Bacteria 764
337 Ga0587088_070224 3300059508 Bacteria 728
338 Ga0587089_036429 3300059509 Bacteria 746
339 Ga0587089_043512 3300059509 Bacteria 701
340 Ga0587090_053909 3300059510 Bacteria 744
341 Ga0587090_064915 3300059510 Bacteria 701
342 Ga0587092_053917 3300059512 Bacteria 735
343 Ga0587092_062672 3300059512 Bacteria 699
344 Ga0587095_011763 3300059514 Bacteria 753
345 Ga0587106_044935 3300059605 Bacteria 763
346 Ga0587106_051873 3300059605 Bacteria 729
347 Ga0587101_053062 3300059623 Bacteria 704
348 Ga0587109_055758 3300059624 Bacteria 821
349 Ga0587109_068786 3300059624 Bacteria 761
350 Ga0587109_084141 3300059624 Bacteria 708
351 Ga0587117_041654 3300059627 Bacteria 733
352 Ga0587128_055624 3300059630 Bacteria 734
353 Ga0587128_057969 3300059630 Bacteria 724
354 Ga0587062_039034 3300059639 Bacteria 762
355 Ga0587062_040836 3300059639 Bacteria 752
356 Ga0587067_070719 3300059640 Bacteria 752
357 Ga0587067_073332 3300059640 Bacteria 743
358 Ga0587067_085235 3300059640 Bacteria 706
359 Ga0587068_053460 3300059641 Bacteria 761
360 Ga0587068_054239 3300059641 Bacteria 757
361 Ga0587068_057102 3300059641 Bacteria 743
362 Ga0587068_066758 3300059641 Bacteria 702
363 Ga0587069_046483 3300059642 Bacteria 758
364 Ga0587069_049136 3300059642 Bacteria 745
365 Ga0587076_063376 3300059645 Bacteria 750
366 Ga0587076_065733 3300059645 Bacteria 741
367 Ga0587076_067080 3300059645 Bacteria 736
368 Ga0587076_071713 3300059645 Bacteria 721
369 Ga0587076_077903 3300059645 Bacteria 702
370 Ga0587107_040043 3300059652 Bacteria 753
371 Ga0587108_012338 3300059653 Bacteria 738
372 Ga0587114_049630 3300059655 Bacteria 707
373 Ga0587119_028111 3300059658 Bacteria 755
374 Ga0587065_05172 3300060245 Bacteria 757
375 Ga0587111_0054921 3300060346 Bacteria 889
376 Ga0587111_0098676 3300060346 Bacteria 724
377 Ga0587111_0109854 3300060346 Bacteria 697
378 Ga0466962_0097371 3300061719 Bacteria 1411
379 2738727816 2738541278 Bacteria 9755573
380 2819587162 2818991444 Bacteria 6968812
381 Ga0495672_0037797
382 JGI24751J29686_10005698
383 JGI24751J29686_10010143
384 Ga0006778J45830_1119413
385 Ga0006759J45824_1013129
386 Ga0006758J48902_1005719
387 Ga0006770J48903_1007016
388 rootH2_10053682
389 rootL2_10163711
390 rootL2_10207756
391 rootL2_10271172
392 rootL2_10345165
393 rootH1_10021375
394 rootH1_10263317
395 Ga0007417J51691_1021703
396 Ga0007410J51695_1041888
397 Ga0032354_1016027
398 Ga0032354_1020405
399 Ga0032354_1033529
400 Ga0058859_11356359
401 Ga0058860_11755900
402 Ga0058862_12437584
403 Ga0070670_100686320
404 Ga0068869_100098809
405 Ga0068868_100071432
406 Ga0068868_100249269
407 Ga0068868_100413552
408 Ga0070660_100351874
409 Ga0070668_100052077
410 Ga0070668_100075106
411 Ga0070669_100434545
412 Ga0070669_100541285
413 Ga0070675_100032943
414 Ga0070675_100833990
415 Ga0070671_100023664
416 Ga0070674_100044536
417 Ga0070674_100263694
418 Ga0070673_100155488
419 Ga0070688_100552541
420 Ga0070667_100092101
421 Ga0070713_100533215
422 Ga0070663_100309907
423 Ga0070678_100139903
424 Ga0070678_100288157
425 Ga0068867_100141095
426 Ga0070684_100529345
427 Ga0068853_100179591
428 Ga0068853_100182622
429 Ga0068853_100308902
430 Ga0068853_100508513
431 Ga0068853_100587047
432 Ga0070672_100304112
433 Ga0070665_100000009
434 Ga0070665_100113338
435 Ga0070665_100771224
436 Ga0070665_101068545
437 Ga0068855_100004710
438 Ga0068855_100012457
439 Ga0068855_100376796
440 Ga0068855_100823939
441 Ga0070664_100195917
442 Ga0070664_100333693
443 Ga0068857_100008152
444 Ga0068854_100125503
445 Ga0068852_100001323
446 Ga0068852_101297131
447 Ga0068859_100096865
448 Ga0068864_100052042
449 Ga0068866_10076555
450 Ga0068866_10156658
451 Ga0068861_100235442
452 Ga0068861_100597729
453 Ga0068861_100814837
454 Ga0068851_10238097
455 Ga0068858_100456804
456 Ga0068858_101622251
457 Ga0068860_100000103
458 Ga0068860_100002588
459 Ga0068860_100007278
460 Ga0068860_100016594
461 Ga0068860_100061351
462 Ga0068860_100065275
463 Ga0068860_100541801
464 Ga0068860_101063086
465 Ga0068862_100366001
466 Ga0081540_1005522
467 Ga0070712_100871667
468 Ga0097621_100003071
469 Ga0068871_100001472
470 Ga0068865_100240559
471 Ga0097620_100096866
472 Ga0105240_10003898
473 Ga0105240_10018065
474 Ga0105240_10037831
475 Ga0105240_10075333
476 Ga0105240_10092479
477 Ga0111539_10009199
478 Ga0111539_10040741
479 Ga0111539_10305050
480 Ga0111539_10454329
481 Ga0105245_10476699
482 Ga0105247_10008423
483 Ga0114129_10285517
484 Ga0105241_10023283
485 Ga0105242_10087332
486 Ga0105242_10117760
487 Ga0105248_10059950
488 Ga0105248_10581835
489 Ga0105237_10001232
490 Ga0105237_10009446
491 Ga0105237_10031565
492 Ga0105237_10126330
493 Ga0105237_10229884
494 Ga0105238_10047259
495 Ga0105238_10196600
496 Ga0105249_10011582
497 Ga0105249_10143287
498 Ga0105249_10169598
499 Ga0105249_10902102
500 Ga0105239_10000246
501 Ga0105239_10005163
502 Ga0105239_10011033
503 Ga0105239_10039217
504 Ga0105239_10748819
505 Ga0105246_10028493
506 Ga0157370_10025137
507 Ga0157369_10070373
508 Ga0157374_10075710
509 Ga0157374_10160007
510 Ga0157374_10216124
511 Ga0157374_11358344
512 Ga0157378_10025854
513 Ga0157378_10128642
514 Ga0157378_11449559
515 Ga0157378_11493782
516 Ga0163162_10000533
517 Ga0163162_10001119
518 Ga0163162_10006348
519 Ga0163162_10023940
520 Ga0163162_10257591
521 Ga0163162_10430837
522 Ga0157372_10001035
523 Ga0157375_10000324
524 Ga0163163_10000973
525 Ga0163163_10717956
526 Ga0157380_10000544
527 Ga0157377_10121719
528 Ga0157379_10011377
529 Ga0157379_10818796
530 Ga0157376_10015940
531 Ga0157376_10295685
532 Ga0163161_10018334
533 Ga0163161_10019412
534 Ga0163161_10086053
535 Ga0197907_10539023
536 Ga0206356_10462901
537 Ga0206355_1147311
538 Ga0206351_10812334
539 Ga0206352_10143444
540 Ga0206352_10144710
541 Ga0206354_11273201
542 Ga0206353_11804303
543 Ga0224712_10352039
544 Ga0209646_1003330
545 Ga0207642_10064247
546 Ga0207642_10131368
547 Ga0207710_10003698
548 Ga0207688_10010187
549 Ga0207647_10043118
550 Ga0207645_10003157
551 Ga0207654_10345453
552 Ga0207695_10098123
553 Ga0207695_10112307
554 Ga0207695_10169689
555 Ga0207695_10307651
556 Ga0207671_10001075
557 Ga0207671_10003986
558 Ga0207671_10018281
559 Ga0207657_10303711
560 Ga0207681_10064609
561 Ga0207694_10501575
562 Ga0207650_10131193
563 Ga0207650_10569036
564 Ga0207659_10049473
565 Ga0207659_10736387
566 Ga0207690_10306379
567 Ga0207686_10183622
568 Ga0207669_10114568
569 Ga0207669_10158972
570 Ga0207704_10274780
571 Ga0207691_10394729
572 Ga0207691_10658519
573 Ga0207711_10144040
574 Ga0207689_10003166
575 Ga0207689_10013918
576 Ga0207667_10002492
577 Ga0207667_10007482
578 Ga0207667_10013089
579 Ga0207651_10099566
580 Ga0207712_10057889
581 Ga0207668_10163501
582 Ga0207640_10006797
583 Ga0207640_10105649
584 Ga0207658_10352015
585 Ga0207658_10425158
586 Ga0207677_10110420
587 Ga0207677_10452519
588 Ga0207703_10809102
589 Ga0207703_11503051
590 Ga0207639_10042837
591 Ga0207641_10808252
592 Ga0207648_10003201
593 Ga0207648_10110786
594 Ga0207674_10001043
595 Ga0207674_10566505
596 Ga0207675_100123998
597 Ga0207675_100185550
598 Ga0207675_100322415
599 Ga0207675_100936831
600 Ga0207683_10001842
601 Ga0207698_10021345
602 Ga0268266_10000105
603 Ga0268265_10119981
604 Ga0268265_10604952
605 Ga0268264_10000013
606 Ga0268264_10001619
607 Ga0268264_10005141
608 Ga0268264_10011517
609 Ga0268264_10048153
610 Ga0268264_10358847
611 Ga0268264_10649908
612 Ga0307517_10326775
613 Ga0307513_10199423
614 Ga0307509_10044028
615 Ga0307508_10274960
616 Ga0307516_10146878
617 Ga0307510_10001098
618 Ga0373947_0328165
619 Ga0373925_0308804
620 Ga0439436_0026667
621 Ga0439439_0033652
622 Ga0451794_22069
623 Ga0451805_020748
624 Ga0451804_0001538
625 Ga0451833_1109552
626 Ga0451837_0683955
627 Ga0451854_39618
628 Ga0451853_0140988
629 Ga0452268_18717
630 Ga0452268_48418
631 Ga0452271_52223
632 Ga0439433_0007002
633 Ga0439449_0008238
634 Ga0439449_0132931
635 Ga0439449_0206467
636 Ga0439457_000268
637 Ga0439457_006693
638 Ga0439462_0021156
639 Ga0439462_0033355
640 Ga0451577_0755363
641 Ga0466972_0000092
642 Ga0466972_0006463
643 Ga0466965_0146148
644 Ga0466961_0263403
645 Ga0466964_0005934
646 Ga0453684_0545563
647 Ga0466957_0000580
648 Ga0495638_0229380
649 Ga0495606_0080048
650 Ga0495648_0001451
651 Ga0495668_0028064
652 Ga0495611_0000115
653 Ga0495649_0046960
654 Ga0495672_0021334
655 Ga0495687_000010
656 Ga0495686_0015104
657 Ga0496100_0165288
658 Ga0496104_0522015
659 Ga0496106_0472896
660 Ga0496114_0271771
661 Ga0496124_0049477
662 Ga0501315_033217
663 Ga0501322_010221
664 Ga0501327_06589
665 Ga0501335_020487
666 Ga0501034_0071735
667 Ga0501034_0161217
668 Ga0501037_0392461
669 Ga0501043_0125687
670 Ga0501047_0491571
671 Ga0501225_0001093
672 Ga0501080_0918713
673 Ga0501044_0005599
674 Ga0501044_0045791
675 nmdc:mga0k408_134012_c1
676 nmdc:mga0k408_179156_c1
677 nmdc:mga0k408_66072_c1
678 nmdc:mga05p37_340452_c1
679 nmdc:mga09592_636417_c1
680 nmdc:mga08y16_142885_c1
681 nmdc:mga08y16_159243_c1
682 nmdc:mga08y16_220618_c1
683 Ga0500578_0000019
684 Ga0500644_0002938
685 Ga0500646_0054177
686 Ga0500583_0000018
687 Ga0500583_0001189
688 Ga0500583_0030017
689 Ga0500583_0031817
690 Ga0500555_077079
691 Ga0500572_095943
692 Ga0500594_0023670
693 Ga0500594_0027477
694 Ga0500594_0146890
695 Ga0500642_0017450
696 Ga0500642_0109802
697 Ga0500658_0131780
698 Ga0500568_0051645
699 Ga0500573_0316633
700 Ga0500589_032734
701 Ga0500604_0003892
702 Ga0500622_0089099
703 Ga0500622_0128667
704 Ga0500622_0146889
705 Ga0500636_0178327
706 Ga0500661_022544
707 Ga0587084_044725
708 Ga0587084_060384
709 Ga0587066_074503
710 Ga0587070_067155
711 Ga0587073_0113678
712 Ga0587073_0124435
713 Ga0587083_0100602
714 Ga0587085_049422
715 Ga0587085_062894
716 Ga0587086_033769
717 Ga0587088_070224
718 Ga0587089_036429
719 Ga0587089_043512
720 Ga0587090_053909
721 Ga0587090_064915
722 Ga0587092_053917
723 Ga0587092_062672
724 Ga0587095_011763
725 Ga0587106_044935
726 Ga0587106_051873
727 Ga0587101_053062
728 Ga0587109_055758
729 Ga0587109_068786
730 Ga0587109_084141
731 Ga0587117_041654
732 Ga0587128_055624
733 Ga0587128_057969
734 Ga0587062_039034
735 Ga0587062_040836
736 Ga0587067_070719
737 Ga0587067_073332
738 Ga0587067_085235
739 Ga0587068_053460
740 Ga0587068_054239
741 Ga0587068_057102
742 Ga0587068_066758
743 Ga0587069_046483
744 Ga0587069_049136
745 Ga0587076_063376
746 Ga0587076_065733
747 Ga0587076_067080
748 Ga0587076_071713
749 Ga0587076_077903
750 Ga0587107_040043
751 Ga0587108_012338
752 Ga0587114_049630
753 Ga0587119_028111
754 Ga0587065_05172
755 Ga0587111_0054921
756 Ga0587111_0098676
757 Ga0587111_0109854
758 Ga0466962_0097371
759 2738727816
760 2819587162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

59

206

0.91

PF00578

AhpC-TSA

AhpC/TSA family

60

187

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.9012 13 192
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.893 15 192
2cvb-assembly1.cif.gz_A crystal structure of a thioredoxin-like protein from thermus thermophilus hb8 0.8929 14 191
3u5r-assembly1.cif.gz_E crystal structure of a hypothetical protein smc02350 from sinorhizobium meliloti 1021 0.8613 15 192
2ywi-assembly2.cif.gz_B crystal structure of uncharacterized conserved protein from geobacillus kaustophilus 0.8562 13 192
ID Description Score Start End Superfamily
2ywoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8925 14 191 3.40.30.10
af_I1KAL3_50_244_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8902 15 192 3.40.30.10
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8701 18 144 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8604 15 188 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8426 23 141 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3E1NSX1-F1-model_v4 Thioredoxin family protein 0.9699 9 189 GO:0016209
GO:0016491
AF-A0A1Q3X8X0-F1-model_v4 Thioredoxin domain-containing protein 0.9685 14 189 GO:0016491
AF-A0A2H6ENI7-F1-model_v4 Uncharacterized protein 0.9624 99 188
AF-A0A4R8DTE9-F1-model_v4 AhpC/TSA family protein 0.9619 1 189 GO:0016209
GO:0016491
AF-A0A7Z9Q7I4-F1-model_v4 Redoxin domain-containing protein 0.961 76 189 GO:0016491

Map