F428584

General Info

Members Datasets Scaffolds Average Seq Length
380 181 760 151

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10254303|Ga0070681_102543032
Length 164
Sequence MSSLSELYQNVILEHNRSPRNYRVMDDADGKAEGHNPLCGDQVTVWVRMDGDVIGDVSFRGAGCAISKASASLMTGAVKGKSREEAERLFARFHQLVTGTLPPGESETLGKLAVFSGVSEFPVRVKCASLSWHTLKAALEGRSGEQAVVGKSDGVMGGPAGPTA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
99 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
109 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
110 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
114 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.11
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10254303 3300005458 Bacteria 1669
2 rootL2_10045982 3300003322 Bacteria 1648
3 JGI26145J50221_1012255 3300003371 Bacteria 769
4 Ga0058863_11602864 3300004799 Bacteria 1227
5 Ga0058863_11673448 3300004799 Bacteria 1038
6 Ga0058861_12009754 3300004800 Bacteria 1654
7 Ga0058862_10040995 3300004803 Bacteria 1462
8 Ga0065712_10252424 3300005290 Bacteria 957
9 Ga0065715_10305363 3300005293 Bacteria 1032
10 Ga0065707_10637671 3300005295 Unclassified 670
11 Ga0068869_100585050 3300005334 Unclassified 941
12 Ga0070680_100082817 3300005336 Bacteria 2649
13 Ga0070680_100166968 3300005336 Bacteria 1851
14 Ga0068868_101162263 3300005338 Unclassified 712
15 Ga0070689_100630019 3300005340 Unclassified 931
16 Ga0070692_10554785 3300005345 Unclassified 753
17 Ga0070675_100930072 3300005354 Bacteria 797
18 Ga0070659_100018110 3300005366 Bacteria 5311
19 Ga0070667_100518851 3300005367 Unclassified 1093
20 Ga0070709_10186887 3300005434 Bacteria 1459
21 Ga0070709_10701644 3300005434 Bacteria 787
22 Ga0070711_100992221 3300005439 Bacteria 720
23 Ga0070705_100005007 3300005440 Bacteria 6448
24 Ga0070705_100128269 3300005440 Unclassified 1650
25 Ga0070705_100436131 3300005440 Bacteria 979
26 Ga0070705_100621991 3300005440 Bacteria 838
27 Ga0070694_100140032 3300005444 Bacteria 1756
28 Ga0070708_100007933 3300005445 Bacteria 8502
29 Ga0070708_100426976 3300005445 Bacteria 1250
30 Ga0070708_100480754 3300005445 Bacteria 1172
31 Ga0070708_100845749 3300005445 Bacteria 860
32 Ga0070663_100740732 3300005455 Unclassified 838
33 Ga0070662_100332322 3300005457 Unclassified 1242
34 Ga0070681_10150252 3300005458 Bacteria 2256
35 Ga0070685_10450615 3300005466 Unclassified 901
36 Ga0070706_100000287 3300005467 Bacteria 61228
37 Ga0070707_100000408 3300005468 Bacteria 42503
38 Ga0070707_100394126 3300005468 Bacteria 1344
39 Ga0070707_100419382 3300005468 Bacteria 1299
40 Ga0070699_100015910 3300005518 Bacteria 6458
41 Ga0070699_100522018 3300005518 Bacteria 1080
42 Ga0070699_100584442 3300005518 Bacteria 1018
43 Ga0070699_101260901 3300005518 Unclassified 678
44 Ga0070684_100248482 3300005535 Bacteria 1626
45 Ga0070697_100427295 3300005536 Bacteria 1152
46 Ga0068853_100507535 3300005539 Bacteria 1139
47 Ga0070695_100182728 3300005545 Bacteria 1487
48 Ga0070696_100002649 3300005546 Bacteria 11868
49 Ga0070696_100168241 3300005546 Bacteria 1619
50 Ga0070696_100244506 3300005546 Bacteria 1355
51 Ga0070696_100447593 3300005546 Bacteria 1019
52 Ga0070693_100331147 3300005547 Unclassified 1036
53 Ga0070704_100011771 3300005549 Bacteria 5378
54 Ga0070704_100227650 3300005549 Bacteria 1519
55 Ga0070664_100318554 3300005564 Bacteria 1408
56 Ga0070664_101534464 3300005564 Unclassified 631
57 Ga0068857_100398827 3300005577 Bacteria 1280
58 Ga0068859_100087143 3300005617 Bacteria 3169
59 Ga0068859_100415952 3300005617 Bacteria 1441
60 Ga0068863_100041377 3300005841 Bacteria 4382
61 Ga0068863_100587818 3300005841 Unclassified 1101
62 Ga0068863_100699961 3300005841 Unclassified 1007
63 Ga0068860_100539970 3300005843 Unclassified 1167
64 Ga0068862_100568181 3300005844 Bacteria 1085
65 Ga0068862_101350932 3300005844 Bacteria 715
66 Ga0070716_100992589 3300006173 Unclassified 663
67 Ga0070716_101277543 3300006173 Unclassified 592
68 Ga0075428_100043042 3300006844 Bacteria 4966
69 Ga0075428_100656187 3300006844 Bacteria 1119
70 Ga0075430_100347424 3300006846 Bacteria 1225
71 Ga0075430_100419652 3300006846 Bacteria 1104
72 Ga0075431_100285957 3300006847 Bacteria 1669
73 Ga0075431_100348247 3300006847 Bacteria 1490
74 Ga0075433_10026899 3300006852 Bacteria 4875
75 Ga0075433_10048593 3300006852 Bacteria 3690
76 Ga0075433_10138725 3300006852 Bacteria 2161
77 Ga0075433_10150500 3300006852 Bacteria 2070
78 Ga0075433_11044431 3300006852 Bacteria 711
79 Ga0075434_100119145 3300006871 Bacteria 2653
80 Ga0075434_100150659 3300006871 Bacteria 2346
81 Ga0075434_100265726 3300006871 Bacteria 1735
82 Ga0075434_101029024 3300006871 Bacteria 837
83 Ga0075429_101186664 3300006880 Bacteria 666
84 Ga0075436_100010960 3300006914 Bacteria 6224
85 Ga0075436_100241372 3300006914 Bacteria 1285
86 Ga0097620_100087143 3300006931 Bacteria 3169
87 Ga0097620_100415939 3300006931 Bacteria 1441
88 Ga0075435_100071308 3300007076 Bacteria 2837
89 Ga0075435_100268087 3300007076 Unclassified 1456
90 Ga0075435_100367197 3300007076 Bacteria 1235
91 Ga0075435_100919621 3300007076 Bacteria 763
92 Ga0111539_10022436 3300009094 Bacteria 7756
93 Ga0111539_10194232 3300009094 Bacteria 2368
94 Ga0114129_10002744 3300009147 Bacteria 24542
95 Ga0114129_10037389 3300009147 Bacteria 6854
96 Ga0114129_10055906 3300009147 Bacteria 5531
97 Ga0114129_10074829 3300009147 Bacteria 4716
98 Ga0114129_12724145 3300009147 Bacteria 589
99 Ga0105241_10367826 3300009174 Unclassified 1253
100 Ga0105242_11410887 3300009176 Unclassified 724
101 Ga0105239_10004067 3300010375 Bacteria 17658
102 Ga0157378_10983727 3300013297 Unclassified 877
103 Ga0163162_11059162 3300013306 Unclassified 918
104 Ga0207647_10482427 3300025904 Unclassified 692
105 Ga0207699_10089970 3300025906 Bacteria 1925
106 Ga0207684_10005296 3300025910 Bacteria 11962
107 Ga0207684_10343014 3300025910 Bacteria 1286
108 Ga0207654_10253211 3300025911 Unclassified 1181
109 Ga0207707_10322936 3300025912 Bacteria 1332
110 Ga0207663_10136657 3300025916 Unclassified 1702
111 Ga0207663_11004415 3300025916 Bacteria 669
112 Ga0207660_10050833 3300025917 Bacteria 2945
113 Ga0207652_10805024 3300025921 Bacteria 834
114 Ga0207646_10003839 3300025922 Bacteria 16695
115 Ga0207646_10833331 3300025922 Bacteria 820
116 Ga0207681_10373041 3300025923 Unclassified 1147
117 Ga0207690_10091879 3300025932 Bacteria 2146
118 Ga0207706_10843942 3300025933 Unclassified 776
119 Ga0207686_10893081 3300025934 Unclassified 717
120 Ga0207670_10350176 3300025936 Bacteria 1169
121 Ga0207665_10186352 3300025939 Bacteria 1506
122 Ga0207665_11034120 3300025939 Unclassified 654
123 Ga0207665_11491267 3300025939 Bacteria 537
124 Ga0207689_10801219 3300025942 Unclassified 795
125 Ga0207677_10961606 3300026023 Bacteria 773
126 Ga0207703_10098675 3300026035 Bacteria 2471
127 Ga0207678_10236241 3300026067 Bacteria 1565
128 Ga0207678_10807388 3300026067 Unclassified 828
129 Ga0207641_10022268 3300026088 Bacteria 5215
130 Ga0207676_10126247 3300026095 Bacteria 2167
131 Ga0207676_10684409 3300026095 Bacteria 992
132 Ga0207674_10281744 3300026116 Bacteria 1610
133 Ga0209998_10047558 3300027717 Bacteria 986
134 Ga0209974_10059952 3300027876 Bacteria 1287
135 Ga0268265_10205757 3300028380 Bacteria 1711
136 Ga0268265_10805304 3300028380 Bacteria 916
137 Ga0268264_10547277 3300028381 Unclassified 1135
138 Ga0307408_100104069 3300031548 Bacteria 2168
139 Ga0307408_100164150 3300031548 Bacteria 1767
140 Ga0307408_100607908 3300031548 Bacteria 972
141 Ga0307405_10275485 3300031731 Bacteria 1264
142 Ga0307405_10389219 3300031731 Unclassified 1088
143 Ga0307405_11340074 3300031731 Bacteria 624
144 Ga0307413_10057578 3300031824 Bacteria 2377
145 Ga0307413_10257783 3300031824 Bacteria 1298
146 Ga0307413_10481199 3300031824 Bacteria 992
147 Ga0307413_10525524 3300031824 Bacteria 955
148 Ga0307410_10051125 3300031852 Bacteria 2783
149 Ga0307410_10094778 3300031852 Bacteria 2127
150 Ga0307410_11220109 3300031852 Unclassified 656
151 Ga0307406_10009981 3300031901 Bacteria 5341
152 Ga0307406_10064069 3300031901 Bacteria 2384
153 Ga0307406_10659464 3300031901 Bacteria 869
154 Ga0307407_10025422 3300031903 Bacteria 3120
155 Ga0307407_10256547 3300031903 Bacteria 1201
156 Ga0307407_10785937 3300031903 Bacteria 723
157 Ga0307412_11046663 3300031911 Bacteria 723
158 Ga0307409_100024650 3300031995 Bacteria 4200
159 Ga0307409_100110497 3300031995 Bacteria 2304
160 Ga0307409_100339055 3300031995 Bacteria 1414
161 Ga0307409_100833802 3300031995 Bacteria 932
162 Ga0307416_100058747 3300032002 Bacteria 3121
163 Ga0307416_100109249 3300032002 Bacteria 2432
164 Ga0307416_100121847 3300032002 Bacteria 2326
165 Ga0307416_100204743 3300032002 Bacteria 1876
166 Ga0307416_100526290 3300032002 Bacteria 1251
167 Ga0307414_10005549 3300032004 Bacteria 6959
168 Ga0307414_10010696 3300032004 Bacteria 5342
169 Ga0307414_10015499 3300032004 Bacteria 4601
170 Ga0307411_10035649 3300032005 Bacteria 3109
171 Ga0307411_10228227 3300032005 Bacteria 1449
172 Ga0307411_10310806 3300032005 Bacteria 1268
173 Ga0307415_100142795 3300032126 Bacteria 1831
174 Ga0307415_101290398 3300032126 Bacteria 691
175 Ga0373948_0008327 3300034817 Bacteria 1763
176 Ga0373928_0042809 3300035084 Bacteria 1046
177 Ga0373929_0020166 3300035085 Unclassified 1342
178 Ga0373929_0058304 3300035085 Bacteria 898
179 Ga0373940_0033937 3300035088 Bacteria 1374
180 Ga0373940_0309687 3300035088 Unclassified 546
181 Ga0373960_0121623 3300035121 Bacteria 867
182 Ga0373961_0134602 3300035241 Bacteria 830
183 Ga0373961_0192138 3300035241 Bacteria 716
184 Ga0373931_0004338 3300035691 Bacteria 6474
185 Ga0373931_0046939 3300035691 Bacteria 2285
186 Ga0373931_0052455 3300035691 Bacteria 2174
187 Ga0373931_0301993 3300035691 Bacteria 989
188 Ga0395899_0364889 3300037312 Bacteria 963
189 Ga0395900_1881069 3300037418 Bacteria 509
190 Ga0395905_0120975 3300037471 Bacteria 2461
191 Ga0395905_0198375 3300037471 Bacteria 1882
192 Ga0395905_0436901 3300037471 Bacteria 1206
193 Ga0395901_0371075 3300038443 Bacteria 1474
194 Ga0242420_000191 3300038996 Bacteria 6422
195 Ga0242420_019116 3300038996 Bacteria 1211
196 Ga0242420_058246 3300038996 Bacteria 766
197 Ga0451845_0400139 3300041501 Bacteria 994
198 Ga0439448_0002597 3300042005 Bacteria 4921
199 Ga0439449_0156591 3300042007 Bacteria 850
200 Ga0439446_0084035 3300042156 Bacteria 989
201 Ga0439458_0046423 3300042157 Bacteria 1064
202 Ga0439458_0097501 3300042157 Bacteria 761
203 Ga0439459_0055740 3300042438 Unclassified 880
204 Ga0439464_0125876 3300042439 Unclassified 792
205 Ga0451577_0483451 3300042876 Bacteria 1124
206 Ga0451577_0833686 3300042876 Bacteria 832
207 Ga0453683_0022670 3300044673 Bacteria 4004
208 Ga0453683_0027340 3300044673 Bacteria 3620
209 Ga0453684_0200894 3300044712 Bacteria 2324
210 Ga0466960_0357268 3300044901 Bacteria 834
211 Ga0451576_1418978 3300045051 Bacteria 722
212 Ga0495580_0061313 3300046472 Bacteria 2641
213 Ga0496101_0062119 3300048904 Bacteria 2715
214 Ga0496101_0160913 3300048904 Bacteria 1721
215 Ga0496102_0005289 3300048905 Bacteria 10958
216 Ga0496102_0018997 3300048905 Bacteria 6048
217 Ga0496102_0080155 3300048905 Bacteria 3007
218 Ga0496102_0165909 3300048905 Bacteria 2078
219 Ga0496103_0004479 3300048906 Bacteria 8467
220 Ga0496103_0147080 3300048906 Bacteria 1508
221 Ga0496104_0008793 3300048907 Bacteria 8978
222 Ga0496104_0017878 3300048907 Bacteria 6464
223 Ga0496104_0114317 3300048907 Bacteria 2588
224 Ga0496104_0498213 3300048907 Unclassified 1129
225 Ga0496105_0043157 3300048908 Bacteria 3719
226 Ga0496105_0195111 3300048908 Unclassified 1654
227 Ga0496106_0016304 3300048909 Bacteria 5497
228 Ga0496106_0018909 3300048909 Bacteria 5105
229 Ga0496106_0047576 3300048909 Bacteria 3229
230 Ga0496106_0206124 3300048909 Bacteria 1566
231 Ga0496106_0273276 3300048909 Bacteria 1353
232 Ga0496107_0382701 3300048910 Bacteria 1047
233 Ga0496108_0000737 3300048911 Bacteria 25438
234 Ga0496108_0023362 3300048911 Bacteria 5086
235 Ga0496108_0115816 3300048911 Bacteria 2295
236 Ga0496108_0712968 3300048911 Bacteria 869
237 Ga0496109_0000206 3300048912 Bacteria 58007
238 Ga0496109_0006368 3300048912 Bacteria 9940
239 Ga0496109_0007240 3300048912 Bacteria 9382
240 Ga0496109_0160222 3300048912 Bacteria 2108
241 Ga0496109_0250538 3300048912 Bacteria 1668
242 Ga0496110_0000500 3300048913 Bacteria 26635
243 Ga0496110_0007674 3300048913 Bacteria 8633
244 Ga0496110_0112194 3300048913 Bacteria 2451
245 Ga0496110_0188633 3300048913 Bacteria 1872
246 Ga0496111_0003584 3300048914 Bacteria 9619
247 Ga0496111_0018790 3300048914 Bacteria 4791
248 Ga0496111_0147486 3300048914 Bacteria 1744
249 Ga0496112_0000114 3300048915 Bacteria 49840
250 Ga0496112_0000557 3300048915 Bacteria 25556
251 Ga0496112_0002076 3300048915 Bacteria 15887
252 Ga0496113_0000106 3300048916 Bacteria 35660
253 Ga0496113_0013640 3300048916 Bacteria 5515
254 Ga0496113_0020862 3300048916 Bacteria 4614
255 Ga0496114_0083745 3300048917 Bacteria 2699
256 Ga0496114_0187070 3300048917 Bacteria 1810
257 Ga0496115_0164927 3300048918 Bacteria 1832
258 Ga0496115_0595623 3300048918 Unclassified 879
259 Ga0501298_181268 3300049521 Unclassified 528
260 Ga0501033_0132436 3300049570 Bacteria 1805
261 Ga0501033_0170858 3300049570 Bacteria 1561
262 Ga0501033_0799369 3300049570 Bacteria 638
263 Ga0501034_0061514 3300049571 Bacteria 3770
264 Ga0501036_0122597 3300049572 Bacteria 2195
265 Ga0501036_0159662 3300049572 Bacteria 1901
266 Ga0501036_1253816 3300049572 Bacteria 603
267 Ga0501037_0342028 3300049573 Bacteria 1033
268 Ga0501038_0114123 3300049574 Bacteria 2235
269 Ga0501038_0184414 3300049574 Bacteria 1682
270 Ga0501038_0224433 3300049574 Bacteria 1498
271 Ga0501038_0313740 3300049574 Bacteria 1228
272 Ga0501039_0194484 3300049575 Bacteria 1595
273 Ga0501039_0416927 3300049575 Bacteria 1055
274 Ga0501039_0578174 3300049575 Bacteria 881
275 Ga0501040_0031114 3300049576 Bacteria 3605
276 Ga0501040_0065976 3300049576 Bacteria 2494
277 Ga0501041_0144651 3300049577 Bacteria 1483
278 Ga0501041_0209417 3300049577 Bacteria 1223
279 Ga0501041_0311973 3300049577 Bacteria 992
280 Ga0501042_0027190 3300049578 Bacteria 4022
281 Ga0501042_0054866 3300049578 Bacteria 2843
282 Ga0501042_0768575 3300049578 Bacteria 701
283 Ga0501046_0741064 3300049580 Bacteria 691
284 Ga0501047_0199489 3300049581 Bacteria 1862
285 Ga0501048_0020693 3300049582 Bacteria 4823
286 Ga0501048_0035690 3300049582 Bacteria 3578
287 Ga0501048_0274469 3300049582 Bacteria 1198
288 Ga0501067_0037544 3300049583 Bacteria 2690
289 Ga0501068_0003929 3300049584 Bacteria 8085
290 Ga0501068_0199552 3300049584 Bacteria 1268
291 Ga0501068_0685645 3300049584 Bacteria 670
292 Ga0501069_0017587 3300049585 Bacteria 3851
293 Ga0501069_0088741 3300049585 Bacteria 1748
294 Ga0501069_0105171 3300049585 Bacteria 1604
295 Ga0501069_0469224 3300049585 Unclassified 749
296 Ga0501069_0598677 3300049585 Bacteria 661
297 Ga0501070_0032673 3300049586 Bacteria 4355
298 Ga0501070_0332575 3300049586 Bacteria 1234
299 Ga0501070_0722380 3300049586 Bacteria 787
300 Ga0501071_0094625 3300049587 Bacteria 2198
301 Ga0501071_0098904 3300049587 Bacteria 2149
302 Ga0501072_0012568 3300049588 Bacteria 6471
303 Ga0501072_0084667 3300049588 Bacteria 2514
304 Ga0501072_0165182 3300049588 Bacteria 1766
305 Ga0501072_0186850 3300049588 Bacteria 1653
306 Ga0501072_0947290 3300049588 Bacteria 672
307 Ga0501074_0064392 3300049590 Bacteria 2639
308 Ga0501074_0113200 3300049590 Bacteria 1941
309 Ga0501074_0146448 3300049590 Bacteria 1689
310 Ga0501074_0766781 3300049590 Bacteria 680
311 Ga0501075_0037312 3300049591 Bacteria 3630
312 Ga0501075_0461379 3300049591 Bacteria 969
313 Ga0501076_0032233 3300049592 Bacteria 4089
314 Ga0501076_0129942 3300049592 Bacteria 2043
315 Ga0501076_0216899 3300049592 Bacteria 1564
316 Ga0501076_0457819 3300049592 Bacteria 1050
317 Ga0501077_0000355 3300049593 Bacteria 27126
318 Ga0501077_0004664 3300049593 Bacteria 8331
319 Ga0501077_0007824 3300049593 Bacteria 6599
320 Ga0501225_0161213 3300049705 Bacteria 690
321 Ga0501079_0019362 3300049741 Bacteria 5197
322 Ga0501079_0078288 3300049741 Bacteria 2557
323 Ga0501079_0228536 3300049741 Bacteria 1453
324 Ga0501079_0320825 3300049741 Bacteria 1213
325 Ga0501080_0031392 3300049742 Bacteria 4950
326 Ga0501080_0051042 3300049742 Bacteria 3848
327 Ga0501080_0134983 3300049742 Bacteria 2284
328 Ga0501081_0023706 3300049743 Bacteria 4115
329 Ga0501081_0053115 3300049743 Bacteria 2797
330 Ga0501081_0147456 3300049743 Bacteria 1689
331 Ga0501083_0027359 3300049744 Bacteria 3935
332 Ga0501035_0331067 3300049822 Unclassified 1278
333 Ga0501035_0663503 3300049822 Bacteria 844
334 Ga0501045_0035063 3300049824 Bacteria 3643
335 Ga0501045_0049894 3300049824 Bacteria 3053
336 Ga0501045_0110995 3300049824 Bacteria 2033
337 Ga0501045_0268118 3300049824 Bacteria 1271
338 Ga0501045_0419488 3300049824 Bacteria 996
339 nmdc:mga05p37_11709_c1 3300050507 Bacteria 10454
340 nmdc:mga05p37_323988_c1 3300050507 Bacteria 1823
341 nmdc:mga05p37_4208_c1 3300050507 Bacteria 16813
342 nmdc:mga05p37_59814_c1 3300050507 Bacteria 4691
343 nmdc:mga05p37_78009_c1 3300050507 Bacteria 4078
344 nmdc:mga09592_109503_c1 3300050508 Bacteria 2369
345 nmdc:mga0qj67_403009_c1 3300050509 Bacteria 1104
346 nmdc:mga06r32_279269_c1 3300050510 Bacteria 1657
347 nmdc:mga06r32_284563_c1 3300050510 Bacteria 1640
348 nmdc:mga08y16_408564_c1 3300050511 Bacteria 1389
349 nmdc:mga0n895_124572_c1 3300050512 Bacteria 2600
350 nmdc:mga0n895_1556694_c1 3300050512 Bacteria 626
351 nmdc:mga0n895_266138_c1 3300050512 Bacteria 1739
352 nmdc:mga0n895_409069_c1 3300050512 Unclassified 1372
353 nmdc:mga0n895_490800_c1 3300050512 Bacteria 1238
354 nmdc:mga0n895_70851_c1 3300050512 Bacteria 3455
355 nmdc:mga0n895_972676_c1 3300050512 Bacteria 831
356 nmdc:mga0rr50_261902_c1 3300050513 Unclassified 1439
357 nmdc:mga0rr50_346963_c1 3300050513 Bacteria 1248
358 nmdc:mga0rr50_40067_c1 3300050513 Bacteria 3403
359 nmdc:mga0rr50_839441_c1 3300050513 Bacteria 784
360 nmdc:mga08x19_133232_c1 3300050514 Bacteria 1673
361 nmdc:mga0a205_179131_c1 3300050515 Bacteria 2014
362 nmdc:mga0a205_20032_c1 3300050515 Bacteria 3378
363 nmdc:mga0a205_37476_c1 3300050515 Bacteria 4662
364 nmdc:mga0a205_608834_c1 3300050515 Bacteria 945
365 nmdc:mga0a205_85443_c1 3300050515 Bacteria 3047
366 Ga0501084_0037025 3300054114 Bacteria 4076
367 Ga0501084_0163478 3300054114 Bacteria 1878
368 Ga0501084_0210468 3300054114 Bacteria 1640
369 Ga0501084_0234843 3300054114 Bacteria 1548
370 Ga0501084_0259535 3300054114 Bacteria 1467
371 Ga0590071_000097 3300059421 Bacteria 24550
372 Ga0590075_011166 3300059424 Bacteria 2168
373 Ga0590075_096807 3300059424 Bacteria 767
374 Ga0590077_010358 3300059426 Bacteria 1917
375 Ga0501082_0051858 3300060353 Bacteria 3536
376 Ga0501082_0132722 3300060353 Bacteria 2160
377 Ga0501082_0133176 3300060353 Bacteria 2156
378 Ga0530510_0020543 3300061734 Bacteria 4696
379 Ga0530510_0026830 3300061734 Bacteria 4126
380 Ga0530510_0498272 3300061734 Bacteria 923
381 Ga0070681_10254303
382 rootL2_10045982
383 JGI26145J50221_1012255
384 Ga0058863_11602864
385 Ga0058863_11673448
386 Ga0058861_12009754
387 Ga0058862_10040995
388 Ga0065712_10252424
389 Ga0065715_10305363
390 Ga0065707_10637671
391 Ga0068869_100585050
392 Ga0070680_100082817
393 Ga0070680_100166968
394 Ga0068868_101162263
395 Ga0070689_100630019
396 Ga0070692_10554785
397 Ga0070675_100930072
398 Ga0070659_100018110
399 Ga0070667_100518851
400 Ga0070709_10186887
401 Ga0070709_10701644
402 Ga0070711_100992221
403 Ga0070705_100005007
404 Ga0070705_100128269
405 Ga0070705_100436131
406 Ga0070705_100621991
407 Ga0070694_100140032
408 Ga0070708_100007933
409 Ga0070708_100426976
410 Ga0070708_100480754
411 Ga0070708_100845749
412 Ga0070663_100740732
413 Ga0070662_100332322
414 Ga0070681_10150252
415 Ga0070685_10450615
416 Ga0070706_100000287
417 Ga0070707_100000408
418 Ga0070707_100394126
419 Ga0070707_100419382
420 Ga0070699_100015910
421 Ga0070699_100522018
422 Ga0070699_100584442
423 Ga0070699_101260901
424 Ga0070684_100248482
425 Ga0070697_100427295
426 Ga0068853_100507535
427 Ga0070695_100182728
428 Ga0070696_100002649
429 Ga0070696_100168241
430 Ga0070696_100244506
431 Ga0070696_100447593
432 Ga0070693_100331147
433 Ga0070704_100011771
434 Ga0070704_100227650
435 Ga0070664_100318554
436 Ga0070664_101534464
437 Ga0068857_100398827
438 Ga0068859_100087143
439 Ga0068859_100415952
440 Ga0068863_100041377
441 Ga0068863_100587818
442 Ga0068863_100699961
443 Ga0068860_100539970
444 Ga0068862_100568181
445 Ga0068862_101350932
446 Ga0070716_100992589
447 Ga0070716_101277543
448 Ga0075428_100043042
449 Ga0075428_100656187
450 Ga0075430_100347424
451 Ga0075430_100419652
452 Ga0075431_100285957
453 Ga0075431_100348247
454 Ga0075433_10026899
455 Ga0075433_10048593
456 Ga0075433_10138725
457 Ga0075433_10150500
458 Ga0075433_11044431
459 Ga0075434_100119145
460 Ga0075434_100150659
461 Ga0075434_100265726
462 Ga0075434_101029024
463 Ga0075429_101186664
464 Ga0075436_100010960
465 Ga0075436_100241372
466 Ga0097620_100087143
467 Ga0097620_100415939
468 Ga0075435_100071308
469 Ga0075435_100268087
470 Ga0075435_100367197
471 Ga0075435_100919621
472 Ga0111539_10022436
473 Ga0111539_10194232
474 Ga0114129_10002744
475 Ga0114129_10037389
476 Ga0114129_10055906
477 Ga0114129_10074829
478 Ga0114129_12724145
479 Ga0105241_10367826
480 Ga0105242_11410887
481 Ga0105239_10004067
482 Ga0157378_10983727
483 Ga0163162_11059162
484 Ga0207647_10482427
485 Ga0207699_10089970
486 Ga0207684_10005296
487 Ga0207684_10343014
488 Ga0207654_10253211
489 Ga0207707_10322936
490 Ga0207663_10136657
491 Ga0207663_11004415
492 Ga0207660_10050833
493 Ga0207652_10805024
494 Ga0207646_10003839
495 Ga0207646_10833331
496 Ga0207681_10373041
497 Ga0207690_10091879
498 Ga0207706_10843942
499 Ga0207686_10893081
500 Ga0207670_10350176
501 Ga0207665_10186352
502 Ga0207665_11034120
503 Ga0207665_11491267
504 Ga0207689_10801219
505 Ga0207677_10961606
506 Ga0207703_10098675
507 Ga0207678_10236241
508 Ga0207678_10807388
509 Ga0207641_10022268
510 Ga0207676_10126247
511 Ga0207676_10684409
512 Ga0207674_10281744
513 Ga0209998_10047558
514 Ga0209974_10059952
515 Ga0268265_10205757
516 Ga0268265_10805304
517 Ga0268264_10547277
518 Ga0307408_100104069
519 Ga0307408_100164150
520 Ga0307408_100607908
521 Ga0307405_10275485
522 Ga0307405_10389219
523 Ga0307405_11340074
524 Ga0307413_10057578
525 Ga0307413_10257783
526 Ga0307413_10481199
527 Ga0307413_10525524
528 Ga0307410_10051125
529 Ga0307410_10094778
530 Ga0307410_11220109
531 Ga0307406_10009981
532 Ga0307406_10064069
533 Ga0307406_10659464
534 Ga0307407_10025422
535 Ga0307407_10256547
536 Ga0307407_10785937
537 Ga0307412_11046663
538 Ga0307409_100024650
539 Ga0307409_100110497
540 Ga0307409_100339055
541 Ga0307409_100833802
542 Ga0307416_100058747
543 Ga0307416_100109249
544 Ga0307416_100121847
545 Ga0307416_100204743
546 Ga0307416_100526290
547 Ga0307414_10005549
548 Ga0307414_10010696
549 Ga0307414_10015499
550 Ga0307411_10035649
551 Ga0307411_10228227
552 Ga0307411_10310806
553 Ga0307415_100142795
554 Ga0307415_101290398
555 Ga0373948_0008327
556 Ga0373928_0042809
557 Ga0373929_0020166
558 Ga0373929_0058304
559 Ga0373940_0033937
560 Ga0373940_0309687
561 Ga0373960_0121623
562 Ga0373961_0134602
563 Ga0373961_0192138
564 Ga0373931_0004338
565 Ga0373931_0046939
566 Ga0373931_0052455
567 Ga0373931_0301993
568 Ga0395899_0364889
569 Ga0395900_1881069
570 Ga0395905_0120975
571 Ga0395905_0198375
572 Ga0395905_0436901
573 Ga0395901_0371075
574 Ga0242420_000191
575 Ga0242420_019116
576 Ga0242420_058246
577 Ga0451845_0400139
578 Ga0439448_0002597
579 Ga0439449_0156591
580 Ga0439446_0084035
581 Ga0439458_0046423
582 Ga0439458_0097501
583 Ga0439459_0055740
584 Ga0439464_0125876
585 Ga0451577_0483451
586 Ga0451577_0833686
587 Ga0453683_0022670
588 Ga0453683_0027340
589 Ga0453684_0200894
590 Ga0466960_0357268
591 Ga0451576_1418978
592 Ga0495580_0061313
593 Ga0496101_0062119
594 Ga0496101_0160913
595 Ga0496102_0005289
596 Ga0496102_0018997
597 Ga0496102_0080155
598 Ga0496102_0165909
599 Ga0496103_0004479
600 Ga0496103_0147080
601 Ga0496104_0008793
602 Ga0496104_0017878
603 Ga0496104_0114317
604 Ga0496104_0498213
605 Ga0496105_0043157
606 Ga0496105_0195111
607 Ga0496106_0016304
608 Ga0496106_0018909
609 Ga0496106_0047576
610 Ga0496106_0206124
611 Ga0496106_0273276
612 Ga0496107_0382701
613 Ga0496108_0000737
614 Ga0496108_0023362
615 Ga0496108_0115816
616 Ga0496108_0712968
617 Ga0496109_0000206
618 Ga0496109_0006368
619 Ga0496109_0007240
620 Ga0496109_0160222
621 Ga0496109_0250538
622 Ga0496110_0000500
623 Ga0496110_0007674
624 Ga0496110_0112194
625 Ga0496110_0188633
626 Ga0496111_0003584
627 Ga0496111_0018790
628 Ga0496111_0147486
629 Ga0496112_0000114
630 Ga0496112_0000557
631 Ga0496112_0002076
632 Ga0496113_0000106
633 Ga0496113_0013640
634 Ga0496113_0020862
635 Ga0496114_0083745
636 Ga0496114_0187070
637 Ga0496115_0164927
638 Ga0496115_0595623
639 Ga0501298_181268
640 Ga0501033_0132436
641 Ga0501033_0170858
642 Ga0501033_0799369
643 Ga0501034_0061514
644 Ga0501036_0122597
645 Ga0501036_0159662
646 Ga0501036_1253816
647 Ga0501037_0342028
648 Ga0501038_0114123
649 Ga0501038_0184414
650 Ga0501038_0224433
651 Ga0501038_0313740
652 Ga0501039_0194484
653 Ga0501039_0416927
654 Ga0501039_0578174
655 Ga0501040_0031114
656 Ga0501040_0065976
657 Ga0501041_0144651
658 Ga0501041_0209417
659 Ga0501041_0311973
660 Ga0501042_0027190
661 Ga0501042_0054866
662 Ga0501042_0768575
663 Ga0501046_0741064
664 Ga0501047_0199489
665 Ga0501048_0020693
666 Ga0501048_0035690
667 Ga0501048_0274469
668 Ga0501067_0037544
669 Ga0501068_0003929
670 Ga0501068_0199552
671 Ga0501068_0685645
672 Ga0501069_0017587
673 Ga0501069_0088741
674 Ga0501069_0105171
675 Ga0501069_0469224
676 Ga0501069_0598677
677 Ga0501070_0032673
678 Ga0501070_0332575
679 Ga0501070_0722380
680 Ga0501071_0094625
681 Ga0501071_0098904
682 Ga0501072_0012568
683 Ga0501072_0084667
684 Ga0501072_0165182
685 Ga0501072_0186850
686 Ga0501072_0947290
687 Ga0501074_0064392
688 Ga0501074_0113200
689 Ga0501074_0146448
690 Ga0501074_0766781
691 Ga0501075_0037312
692 Ga0501075_0461379
693 Ga0501076_0032233
694 Ga0501076_0129942
695 Ga0501076_0216899
696 Ga0501076_0457819
697 Ga0501077_0000355
698 Ga0501077_0004664
699 Ga0501077_0007824
700 Ga0501225_0161213
701 Ga0501079_0019362
702 Ga0501079_0078288
703 Ga0501079_0228536
704 Ga0501079_0320825
705 Ga0501080_0031392
706 Ga0501080_0051042
707 Ga0501080_0134983
708 Ga0501081_0023706
709 Ga0501081_0053115
710 Ga0501081_0147456
711 Ga0501083_0027359
712 Ga0501035_0331067
713 Ga0501035_0663503
714 Ga0501045_0035063
715 Ga0501045_0049894
716 Ga0501045_0110995
717 Ga0501045_0268118
718 Ga0501045_0419488
719 nmdc:mga05p37_11709_c1
720 nmdc:mga05p37_323988_c1
721 nmdc:mga05p37_4208_c1
722 nmdc:mga05p37_59814_c1
723 nmdc:mga05p37_78009_c1
724 nmdc:mga09592_109503_c1
725 nmdc:mga0qj67_403009_c1
726 nmdc:mga06r32_279269_c1
727 nmdc:mga06r32_284563_c1
728 nmdc:mga08y16_408564_c1
729 nmdc:mga0n895_124572_c1
730 nmdc:mga0n895_1556694_c1
731 nmdc:mga0n895_266138_c1
732 nmdc:mga0n895_409069_c1
733 nmdc:mga0n895_490800_c1
734 nmdc:mga0n895_70851_c1
735 nmdc:mga0n895_972676_c1
736 nmdc:mga0rr50_261902_c1
737 nmdc:mga0rr50_346963_c1
738 nmdc:mga0rr50_40067_c1
739 nmdc:mga0rr50_839441_c1
740 nmdc:mga08x19_133232_c1
741 nmdc:mga0a205_179131_c1
742 nmdc:mga0a205_20032_c1
743 nmdc:mga0a205_37476_c1
744 nmdc:mga0a205_608834_c1
745 nmdc:mga0a205_85443_c1
746 Ga0501084_0037025
747 Ga0501084_0163478
748 Ga0501084_0210468
749 Ga0501084_0234843
750 Ga0501084_0259535
751 Ga0590071_000097
752 Ga0590075_011166
753 Ga0590075_096807
754 Ga0590077_010358
755 Ga0501082_0051858
756 Ga0501082_0132722
757 Ga0501082_0133176
758 Ga0530510_0020543
759 Ga0530510_0026830
760 Ga0530510_0498272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

7

140

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9703 4 139
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9517 4 139
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9507 7 141
6a6f-assembly1.cif.gz_B crystal structure of putative iron-sulfur cluster assembly scaffold protein for suf system (fisufu) from thermophilic fervidobacterium islandicum aw-1 0.9375 7 140
1su0-assembly1.cif.gz_B crystal structure of a hypothetical protein at 2.3 a resolution 0.9353 7 141
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9382 2 139 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9277 4 139 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.925 2 139 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9079 3 138 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8951 3 138 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2A5RV02-F1-model_v4 Fe-S assembly protein NifU 0.9704 12 140 GO:0005506
GO:0016226
GO:0051536
AF-A0A7C2YLG2-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.969 4 139 GO:0005506
GO:0016226
GO:0051536
AF-G5GGP8-F1-model_v4 NifU family SUF system FeS assembly protein 0.969 8 140 GO:0005506
GO:0016226
GO:0051536
AF-A0A1H5ZGZ5-F1-model_v4 deleted 0.967 2 142
AF-A0A3D1M601-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9667 8 139 GO:0005506
GO:0016226
GO:0051536

Map