F428383

General Info

Members Datasets Scaffolds Average Seq Length
379 235 330 287

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10284590|Ga0207712_102845901
Length 338
Sequence MATRASRRKFLKSAVAGAGALALPTAVFSPAIAQAKPLRVGILAPRSGIAASAGVSGLRAAEWAVEKFNATGGIAGRKVELVVEEETSPKDTIERYQKLLQQENVDCVQGIVSTGVGLALGPVAARFDMDWSLRPQGEKRRVLILASKFDHCLADLLYRWRTGELPMDLVGVVSNHPRETYERLRFDDLEFHHLPVTRGSKEAQEAQIWSLVQSTGTDLVVLARYMQILSDDLAAKLSGRCINIHHSFLPGFKGAKPYHQAHARGVKLIGATAHYVTADLDEGPIIEQDVERISHRDRPDDLVRKGRDIERRVLASAVRYHLTDRIIMNGTSTVVFPE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
8 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
9 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221733 Bosea sp. Root381 Isolate Unclassified
14 2643221736 Bosea sp. Root483D1 Isolate Unclassified
15 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
16 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
17 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
18 2773857925 Microvirga vignae BR3299 Isolate Unclassified
19 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
20 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
21 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
22 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
23 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
24 2841760612 Bosea sp. Tri-49 Isolate Nodule
25 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
26 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
27 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
28 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
29 2844104063 Bosea sp. Tri-39 Isolate Nodule
30 2851182111 Bosea sp. Tri-44 Isolate Nodule
31 2851246043 Bosea sp. Tri-54 Isolate Nodule
32 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
33 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
34 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
35 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
36 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
37 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
38 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
39 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
40 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
41 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
42 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
43 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
44 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
45 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
46 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
47 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
107 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
108 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
144 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
224 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
225 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
232 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
233 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
234 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
235 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.07
Metatranscriptomes 0
Isolates 12.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 5.54
Rhizoplane 7.39
Rhizosphere 59.1
Stem 0
Stem Tuber 0
Unclassified 18.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1786227 2162886007 Bacteria 975
2 SwRhRL2b_contig_387345 2162886007 Bacteria 3441
3 JGI24752J21851_1000041 3300001976 Bacteria 15555
4 JGI24750J21931_1000237 3300002070 Bacteria 9432
5 JGI24748J21848_1000030 3300002074 Bacteria 85078
6 JGI24749J21850_1000344 3300002076 Bacteria 6970
7 JGI24034J26672_10000046 3300002239 Bacteria 63764
8 JGI24751J29686_10000272 3300002459 Bacteria 20117
9 JGI25153J46596_10000357 3300003215 Bacteria 31522
10 Ga0055542_1000182 3300003762 Bacteria 77889
11 Ga0055529_1000186 3300003763 Bacteria 85165
12 Ga0055526_1004979 3300003771 Bacteria 7795
13 Ga0055524_1006472 3300003775 Bacteria 5075
14 Ga0065165_1001370 3300005262 Bacteria 26818
15 Ga0065704_10000616 3300005289 Bacteria 15099
16 Ga0065704_10003618 3300005289 Bacteria 4378
17 Ga0065704_10102038 3300005289 Bacteria 2218
18 Ga0065704_10114270 3300005289 Bacteria 1881
19 Ga0065707_10000862 3300005295 Bacteria 11252
20 Ga0065707_10087051 3300005295 Bacteria 5189
21 Ga0065707_10116625 3300005295 Bacteria 2232
22 Ga0065707_10122226 3300005295 Bacteria 2092
23 Ga0065707_10130972 3300005295 Bacteria 1921
24 Ga0065707_10295349 3300005295 Bacteria 1016
25 Ga0070690_100000005 3300005330 Bacteria 142006
26 Ga0070670_100005973 3300005331 Bacteria 10301
27 Ga0070666_10000084 3300005335 Bacteria 66975
28 Ga0070666_10131404 3300005335 Bacteria 1740
29 Ga0070666_10179650 3300005335 Bacteria 1484
30 Ga0070689_100002237 3300005340 Bacteria 12574
31 Ga0070668_100000015 3300005347 Bacteria 106650
32 Ga0070668_100017472 3300005347 Bacteria 5377
33 Ga0070668_100056460 3300005347 Bacteria 3032
34 Ga0070668_100351492 3300005347 Bacteria 1248
35 Ga0070669_100005649 3300005353 Bacteria 9035
36 Ga0070671_100000247 3300005355 Bacteria 36402
37 Ga0070671_100035630 3300005355 Bacteria 4122
38 Ga0070671_100094827 3300005355 Bacteria 2501
39 Ga0070688_100001297 3300005365 Bacteria 12455
40 Ga0070667_100000017 3300005367 Bacteria 230531
41 Ga0070667_100000066 3300005367 Bacteria 134529
42 Ga0070667_100004394 3300005367 Bacteria 11891
43 Ga0070667_100010427 3300005367 Bacteria 7671
44 Ga0070714_100490093 3300005435 Bacteria 1171
45 Ga0070705_100216957 3300005440 Bacteria 1322
46 Ga0070685_10000080 3300005466 Bacteria 58516
47 Ga0070685_10304543 3300005466 Bacteria 1075
48 Ga0070686_100000001 3300005544 Bacteria 515830
49 Ga0070665_100000425 3300005548 Bacteria 61609
50 Ga0070665_100012414 3300005548 Bacteria 8587
51 Ga0068852_100319227 3300005616 Bacteria 1508
52 Ga0068859_100004551 3300005617 Bacteria 14140
53 Ga0068864_100077198 3300005618 Bacteria 2912
54 Ga0068861_100158361 3300005719 Bacteria 1865
55 Ga0068863_100000046 3300005841 Bacteria 143895
56 Ga0068863_100003457 3300005841 Bacteria 15580
57 Ga0068863_100009676 3300005841 Bacteria 9407
58 Ga0068863_100141711 3300005841 Bacteria 2298
59 Ga0068858_100000303 3300005842 Bacteria 52646
60 Ga0068858_100001972 3300005842 Bacteria 20980
61 Ga0068858_100016754 3300005842 Bacteria 6883
62 Ga0068858_100026267 3300005842 Bacteria 5413
63 Ga0068860_100000013 3300005843 Bacteria 323055
64 Ga0068860_100000056 3300005843 Bacteria 202751
65 Ga0068860_100033888 3300005843 Bacteria 4899
66 Ga0068860_100143322 3300005843 Bacteria 2297
67 Ga0068862_100000108 3300005844 Bacteria 99413
68 Ga0068862_100002005 3300005844 Bacteria 18468
69 Ga0068862_100010599 3300005844 Bacteria 7618
70 Ga0075365_10006090 3300006038 Bacteria 6591
71 Ga0075364_10008960 3300006051 Bacteria 5992
72 Ga0075362_10056591 3300006177 Bacteria 1765
73 Ga0097620_100004551 3300006931 Bacteria 14140
74 Ga0099825_1042742 3300006941 Bacteria 1242
75 Ga0099824_1028906 3300006942 Bacteria 2440
76 Ga0099822_1017856 3300006943 Bacteria 7495
77 Ga0105251_10017074 3300009011 Bacteria 3899
78 Ga0105250_10000013 3300009092 Bacteria 271050
79 Ga0105250_10022520 3300009092 Bacteria 2540
80 Ga0105240_10645532 3300009093 Bacteria 1161
81 Ga0105247_10002415 3300009101 Bacteria 12707
82 Ga0105247_10009070 3300009101 Bacteria 6055
83 Ga0105247_10009611 3300009101 Bacteria 5869
84 Ga0105243_10263609 3300009148 Bacteria 1544
85 Ga0105248_10012565 3300009177 Bacteria 9340
86 Ga0105248_10013600 3300009177 Bacteria 8958
87 Ga0105248_10046013 3300009177 Bacteria 4892
88 Ga0105248_10222459 3300009177 Bacteria 2125
89 Ga0105248_10508087 3300009177 Bacteria 1359
90 Ga0105237_10047507 3300009545 Bacteria 4315
91 Ga0105238_10054119 3300009551 Bacteria 4032
92 Ga0105249_10000543 3300009553 Bacteria 34906
93 Ga0105249_10035675 3300009553 Bacteria 4509
94 Ga0105249_10255238 3300009553 Bacteria 1740
95 Ga0105249_10311132 3300009553 Bacteria 1583
96 Ga0105148_100046 3300009978 Bacteria 18502
97 Ga0105239_10031161 3300010375 Bacteria 5867
98 Ga0105246_10074654 3300011119 Bacteria 2398
99 Ga0157326_1001304 3300012513 Bacteria 2762
100 Ga0157371_10005755 3300013102 Bacteria 10386
101 Ga0157369_10035897 3300013105 Bacteria 5433
102 Ga0163162_10025365 3300013306 Bacteria 5857
103 Ga0163162_10025473 3300013306 Bacteria 5845
104 Ga0163162_10093543 3300013306 Bacteria 3091
105 Ga0163163_10026201 3300014325 Bacteria 5569
106 Ga0157380_10000499 3300014326 Bacteria 23969
107 Ga0157380_10000935 3300014326 Bacteria 18441
108 Ga0157379_10022834 3300014968 Bacteria 5545
109 Ga0157379_10041180 3300014968 Bacteria 4124
110 Ga0183369_1007 3300015685 Bacteria 414878
111 Ga0163161_10000037 3300017792 Bacteria 150124
112 Ga0163161_10006059 3300017792 Bacteria 8381
113 Ga0163161_10096728 3300017792 Bacteria 2192
114 Ga0213872_10049107 3300021361 Bacteria 1917
115 Ga0213875_10180198 3300021388 Bacteria 992
116 Ga0207672_1000567 3300025223 Bacteria 4524
117 Ga0209148_1000008 3300025254 Bacteria 1504371
118 Ga0209455_1000002 3300025272 Bacteria 1505459
119 Ga0209130_1000797 3300025284 Bacteria 26804
120 Ga0209025_1000795 3300025294 Bacteria 51429
121 Ga0209025_1013439 3300025294 Bacteria 5146
122 Ga0209564_1000074 3300025295 Bacteria 286043
123 Ga0209758_1006912 3300025297 Bacteria 7922
124 Ga0209256_1000109 3300025299 Bacteria 184928
125 Ga0207697_10006183 3300025315 Bacteria 5458
126 Ga0207697_10010523 3300025315 Bacteria 3951
127 Ga0207696_1000072 3300025711 Bacteria 224214
128 Ga0207696_1003567 3300025711 Bacteria 7026
129 Ga0207713_1016076 3300025735 Bacteria 3812
130 Ga0207713_1076979 3300025735 Bacteria 1213
131 Ga0207710_10001929 3300025900 Bacteria 9933
132 Ga0207710_10082602 3300025900 Bacteria 1492
133 Ga0207688_10058419 3300025901 Bacteria 2170
134 Ga0207680_10000008 3300025903 Bacteria 518177
135 Ga0207705_10036119 3300025909 Bacteria 3536
136 Ga0207695_10137936 3300025913 Bacteria 2391
137 Ga0207671_10234601 3300025914 Bacteria 1440
138 Ga0207681_10000041 3300025923 Bacteria 140201
139 Ga0207681_10001087 3300025923 Bacteria 17643
140 Ga0207694_10014991 3300025924 Bacteria 5845
141 Ga0207650_10000012 3300025925 Bacteria 437889
142 Ga0207650_10011241 3300025925 Bacteria 6158
143 Ga0207664_10111829 3300025929 Bacteria 2273
144 Ga0207664_10408824 3300025929 Bacteria 1208
145 Ga0207644_10000139 3300025931 Bacteria 51953
146 Ga0207644_10000917 3300025931 Bacteria 18700
147 Ga0207644_10038014 3300025931 Bacteria 3388
148 Ga0207644_10039432 3300025931 Bacteria 3334
149 Ga0207644_10040722 3300025931 Bacteria 3284
150 Ga0207709_10387660 3300025935 Bacteria 1065
151 Ga0207711_10007038 3300025941 Bacteria 9422
152 Ga0207711_10011494 3300025941 Bacteria 7359
153 Ga0207711_10035666 3300025941 Bacteria 4218
154 Ga0207711_10074892 3300025941 Bacteria 2945
155 Ga0207711_10388436 3300025941 Bacteria 1296
156 Ga0207667_10298960 3300025949 Bacteria 1644
157 Ga0207712_10000009 3300025961 Bacteria 518177
158 Ga0207712_10000388 3300025961 Bacteria 38208
159 Ga0207712_10044095 3300025961 Bacteria 3080
160 Ga0207712_10284590 3300025961 Bacteria 1350
161 Ga0207668_10000012 3300025972 Bacteria 182541
162 Ga0207668_10010668 3300025972 Bacteria 5560
163 Ga0207668_10019699 3300025972 Bacteria 4270
164 Ga0207658_10000011 3300025986 Bacteria 239620
165 Ga0207658_10000426 3300025986 Bacteria 39995
166 Ga0207658_10000779 3300025986 Bacteria 27247
167 Ga0207658_10003621 3300025986 Bacteria 10913
168 Ga0207658_10016607 3300025986 Bacteria 5066
169 Ga0207703_10000409 3300026035 Bacteria 45646
170 Ga0207703_10000465 3300026035 Bacteria 42625
171 Ga0207703_10000529 3300026035 Bacteria 39299
172 Ga0207703_10003051 3300026035 Bacteria 14165
173 Ga0207703_10510868 3300026035 Bacteria 1129
174 Ga0207639_10157893 3300026041 Bacteria 1908
175 Ga0207702_10220159 3300026078 Bacteria 1769
176 Ga0207641_10000145 3300026088 Bacteria 100817
177 Ga0207641_10000906 3300026088 Bacteria 30745
178 Ga0207641_10002990 3300026088 Bacteria 15287
179 Ga0207641_10120356 3300026088 Bacteria 2341
180 Ga0207676_10000150 3300026095 Bacteria 60517
181 Ga0207676_10002001 3300026095 Bacteria 14839
182 Ga0207676_10108282 3300026095 Bacteria 2319
183 Ga0207675_100079986 3300026118 Bacteria 3064
184 Ga0207698_10081477 3300026142 Bacteria 2613
185 Ga0209589_1011529 3300027357 Bacteria 12396
186 Ga0209489_109285 3300027361 Bacteria 12396
187 Ga0209700_108852 3300027363 Bacteria 12396
188 Ga0268266_10000009 3300028379 Bacteria 1097737
189 Ga0268266_10003044 3300028379 Bacteria 17175
190 Ga0268266_10005134 3300028379 Bacteria 12337
191 Ga0268266_10057571 3300028379 Bacteria 3345
192 Ga0268265_10000001 3300028380 Bacteria 1230727
193 Ga0268265_10000121 3300028380 Bacteria 97688
194 Ga0268265_10000429 3300028380 Bacteria 44619
195 Ga0268265_10055278 3300028380 Bacteria 3015
196 Ga0268264_10000003 3300028381 Bacteria 1141976
197 Ga0268264_10000039 3300028381 Bacteria 376641
198 Ga0268264_10000089 3300028381 Bacteria 234760
199 Ga0268264_10005300 3300028381 Bacteria 10920
200 Ga0268264_10054266 3300028381 Bacteria 3346
201 Ga0268264_10123540 3300028381 Bacteria 2285
202 Ga0307517_10015109 3300028786 Bacteria 10286
203 Ga0307515_10084264 3300028794 Bacteria 4085
204 Ga0265338_10151125 3300028800 Bacteria 1804
205 Ga0307508_10004043 3300031616 Bacteria 14515
206 Ga0307410_10420878 3300031852 Bacteria 1083
207 Ga0307406_10052233 3300031901 Bacteria 2599
208 Ga0307407_10335694 3300031903 Bacteria 1065
209 Ga0307412_10004190 3300031911 Bacteria 8042
210 Ga0307409_100485711 3300031995 Bacteria 1199
211 Ga0307416_100263227 3300032002 Bacteria 1687
212 Ga0307416_100396854 3300032002 Bacteria 1415
213 Ga0307415_100208997 3300032126 Bacteria 1555
214 Ga0307510_10042014 3300033180 Bacteria 4988
215 Ga0307510_10171864 3300033180 Bacteria 1745
216 Ga0436364_1106089 3300037853 Bacteria 1342
217 Ga0436364_1124930 3300037853 Bacteria 2681
218 Ga0395901_0004569 3300038443 Bacteria 13976
219 Ga0237819_04884 3300038705 Bacteria 2150
220 Ga0436360_0076406 3300039438 Bacteria 2786
221 Ga0436361_0235895 3300039447 Bacteria 2540
222 Ga0436361_1019386 3300039447 Bacteria 2575
223 Ga0466966_0026777 3300044684 Bacteria 3763
224 Ga0466968_0006590 3300044735 Bacteria 4380
225 Ga0495650_0000951 3300046471 Bacteria 33494
226 Ga0495639_0074599 3300046475 Bacteria 1572
227 Ga0495585_0037323 3300046492 Bacteria 2737
228 Ga0495583_0000412 3300046506 Bacteria 64931
229 Ga0495648_0035289 3300046524 Bacteria 3243
230 Ga0495666_0103830 3300046526 Bacteria 1338
231 Ga0495642_0008312 3300046528 Bacteria 3970
232 Ga0495622_0005144 3300046557 Bacteria 6066
233 Ga0495633_0046611 3300046558 Bacteria 2050
234 Ga0495625_0000189 3300046660 Bacteria 97637
235 Ga0495670_0069964 3300046691 Bacteria 1775
236 Ga0495600_0002567 3300046809 Bacteria 10469
237 Ga0495660_0112925 3300046810 Bacteria 1384
238 Ga0495636_0022590 3300047318 Bacteria 2544
239 Ga0495687_000044 3300047443 Bacteria 215400
240 Ga0496100_0037349 3300048903 Bacteria 3070
241 Ga0496101_0168200 3300048904 Bacteria 1684
242 Ga0496101_0194673 3300048904 Bacteria 1565
243 Ga0496102_0002154 3300048905 Bacteria 16907
244 Ga0496102_0085958 3300048905 Bacteria 2904
245 Ga0496103_0000163 3300048906 Bacteria 70387
246 Ga0496103_0003604 3300048906 Bacteria 9449
247 Ga0496104_0000135 3300048907 Bacteria 68612
248 Ga0496104_0000298 3300048907 Bacteria 43968
249 Ga0496104_0006186 3300048907 Bacteria 10512
250 Ga0496104_0042013 3300048907 Bacteria 4288
251 Ga0496105_0000061 3300048908 Bacteria 85514
252 Ga0496105_0015200 3300048908 Bacteria 6130
253 Ga0496105_0016698 3300048908 Bacteria 5864
254 Ga0496105_0045916 3300048908 Bacteria 3604
255 Ga0496105_0150999 3300048908 Bacteria 1909
256 Ga0496105_0199459 3300048908 Bacteria 1633
257 Ga0496106_0267511 3300048909 Bacteria 1368
258 Ga0496107_0193253 3300048910 Bacteria 1512
259 Ga0496107_0259166 3300048910 Bacteria 1294
260 Ga0496111_0088304 3300048914 Bacteria 2270
261 Ga0496112_0003364 3300048915 Bacteria 13201
262 Ga0496112_0150302 3300048915 Bacteria 2296
263 Ga0496113_0020428 3300048916 Bacteria 4655
264 Ga0496113_0029841 3300048916 Bacteria 3942
265 Ga0496115_0048016 3300048918 Bacteria 3415
266 Ga0496115_0057741 3300048918 Bacteria 3122
267 Ga0496116_0031760 3300048919 Bacteria 3774
268 Ga0496116_0082522 3300048919 Bacteria 1988
269 Ga0496117_0004779 3300048920 Bacteria 14686
270 Ga0496117_0007947 3300048920 Bacteria 10191
271 Ga0496117_0010440 3300048920 Bacteria 8464
272 Ga0496117_0185201 3300048920 Bacteria 1192
273 Ga0496118_0004275 3300048921 Bacteria 17088
274 Ga0496118_0028767 3300048921 Bacteria 4673
275 Ga0496118_0074101 3300048921 Bacteria 2435
276 Ga0496118_0091008 3300048921 Bacteria 2099
277 Ga0496119_0000666 3300048922 Bacteria 46010
278 Ga0496119_0003668 3300048922 Bacteria 15747
279 Ga0496119_0007916 3300048922 Bacteria 9460
280 Ga0496120_0006937 3300048923 Bacteria 8544
281 Ga0496121_0001242 3300048924 Bacteria 44229
282 Ga0496121_0060648 3300048924 Bacteria 3110
283 Ga0496122_0001189 3300048925 Bacteria 44564
284 Ga0496122_0077157 3300048925 Bacteria 2341
285 Ga0496123_0001203 3300048926 Bacteria 37856
286 Ga0496123_0057867 3300048926 Bacteria 2519
287 Ga0496124_0001181 3300048927 Bacteria 40778
288 Ga0496124_0003893 3300048927 Bacteria 17848
289 Ga0496124_0423944 3300048927 Bacteria 916
290 Ga0496125_0030337 3300048928 Bacteria 4839
291 Ga0496125_0161535 3300048928 Bacteria 1521
292 Ga0496126_0000337 3300048929 Bacteria 98585
293 Ga0496126_0001143 3300048929 Bacteria 44099
294 Ga0496126_0076614 3300048929 Bacteria 2967
295 Ga0501300_000593 3300049523 Bacteria 5432
296 Ga0501033_0038994 3300049570 Bacteria 3549
297 Ga0501034_0081961 3300049571 Bacteria 3228
298 Ga0501034_0095623 3300049571 Bacteria 2967
299 Ga0501036_0034689 3300049572 Bacteria 4268
300 Ga0501038_0066776 3300049574 Bacteria 3062
301 Ga0501046_0027509 3300049580 Bacteria 4638
302 Ga0501046_0303386 3300049580 Bacteria 1166
303 Ga0501047_0000277 3300049581 Bacteria 59304
304 Ga0501047_0011281 3300049581 Bacteria 8459
305 Ga0501047_0273005 3300049581 Bacteria 1537
306 Ga0501035_0012721 3300049822 Bacteria 7777
307 Ga0501044_0131978 3300049823 Bacteria 2491
308 Ga0501044_0155451 3300049823 Bacteria 2267
309 nmdc:mga03683_13589_c1 3300050489 Bacteria 3000
310 nmdc:mga00v17_29345_c1 3300050491 Bacteria 3228
311 nmdc:mga0yw44_1207_c1 3300050492 Bacteria 10116
312 Ga0495619_0064368 3300053085 Bacteria 2444
313 Ga0500643_000571 3300053087 Bacteria 25555
314 Ga0500643_001931 3300053087 Bacteria 11239
315 Ga0500643_009942 3300053087 Bacteria 3587
316 Ga0500641_0004469 3300053096 Bacteria 4946
317 Ga0500556_0000537 3300053104 Bacteria 25852
318 Ga0500556_0007026 3300053104 Bacteria 3212
319 Ga0500562_006974 3300053108 Bacteria 2849
320 Ga0500592_000116 3300053116 Bacteria 17271
321 Ga0500595_000287 3300053119 Bacteria 33350
322 Ga0500607_042773 3300053121 Bacteria 2445
323 Ga0500622_0007648 3300053156 Bacteria 6114
324 Ga0500622_0122410 3300053156 Bacteria 1260
325 Ga0500627_0012509 3300053158 Bacteria 3184
326 Ga0500636_0001236 3300053177 Bacteria 13823
327 Ga0500636_0163005 3300053177 Bacteria 1213
328 Ga0500645_000339 3300053730 Bacteria 33332
329 Ga0500645_004014 3300053730 Bacteria 5785
330 Ga0466962_0056168 3300061719 Bacteria 1881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2571042365 2572253473 278
2 iso_pu_bacteria 2643221736 2644746522 278
3 iso_pu_bacteria 2751185897 2753765008 278
4 iso_pu_bacteria 2824732956 2824734608 278
5 iso_pu_bacteria 2824753945 2824761636 278
6 iso_pu_bacteria 2824763712 2824771930 278
7 iso_pu_bacteria 2842038055 2842045820 278
8 iso_pu_bacteria 2842045827 2842053424 278
9 iso_pu_bacteria 2904711408 2904718853 278
10 iso_pu_bacteria 2643221598 2643999396 279
11 3300003762 Ga0055542_1000182 Ga0055542_100018239 280
12 3300003763 Ga0055529_1000186 Ga0055529_100018639 280
13 3300005355 Ga0070671_100094827 Ga0070671_1000948272 280
14 3300009177 Ga0105248_10046013 Ga0105248_100460134 280
15 3300013102 Ga0157371_10005755 Ga0157371_100057556 280
16 3300013105 Ga0157369_10035897 Ga0157369_100358974 280
17 3300014325 Ga0163163_10026201 Ga0163163_100262014 280
18 3300025254 Ga0209148_1000008 Ga0209148_100000824 280
19 3300025272 Ga0209455_1000002 Ga0209455_10000021400 280
20 3300025931 Ga0207644_10040722 Ga0207644_100407222 280
21 3300025941 Ga0207711_10035666 Ga0207711_100356664 280
22 3300046528 Ga0495642_0008312 Ga0495642_0008312_2546_3388 280
23 3300047318 Ga0495636_0022590 Ga0495636_0022590_1628_2470 280
24 3300048904 Ga0496101_0168200 Ga0496101_0168200_463_1305 280
25 3300048915 Ga0496112_0150302 Ga0496112_0150302_274_1116 280
26 3300048924 Ga0496121_0001242 Ga0496121_0001242_15889_16740 280
27 3300048927 Ga0496124_0423944 Ga0496124_0423944_33_887 280
28 3300048929 Ga0496126_0000337 Ga0496126_0000337_81849_82700 280
29 iso_pu_bacteria 2643221541 2643730621 280
30 iso_pu_bacteria 2643221559 2643818784 280
31 iso_pu_bacteria 2643221586 2643941037 280
32 iso_pu_bacteria 2643221605 2644037979 280
33 iso_pu_bacteria 2643221606 2644043790 280
34 iso_pu_bacteria 2643221612 2644079924 280
35 iso_pu_bacteria 2643221671 2644393949 280
36 iso_pu_bacteria 2643221727 2644695519 280
37 iso_pu_bacteria 2842775625 2842777784 280
38 3300048908 Ga0496105_0150999 Ga0496105_0150999_421_1338 281
39 3300048914 Ga0496111_0088304 Ga0496111_0088304_443_1360 281
40 3300053087 Ga0500643_000571 Ga0500643_000571_6393_7238 281
41 3300053104 Ga0500556_0007026 Ga0500556_0007026_2018_2863 281
42 3300053108 Ga0500562_006974 Ga0500562_006974_184_1029 281
43 3300053156 Ga0500622_0122410 Ga0500622_0122410_97_942 281
44 3300053730 Ga0500645_000339 Ga0500645_000339_9135_9980 281
45 3300053730 Ga0500645_004014 Ga0500645_004014_3823_4668 281
46 3300005335 Ga0070666_10179650 Ga0070666_101796501 282
47 3300005347 Ga0070668_100000015 Ga0070668_10000001548 282
48 3300005355 Ga0070671_100000247 Ga0070671_10000024724 282
49 3300005367 Ga0070667_100000017 Ga0070667_10000001778 282
50 3300005617 Ga0068859_100004551 Ga0068859_10000455116 282
51 3300005842 Ga0068858_100000303 Ga0068858_10000030320 282
52 3300005842 Ga0068858_100001972 Ga0068858_10000197216 282
53 3300005843 Ga0068860_100000056 Ga0068860_100000056166 282
54 3300005844 Ga0068862_100000108 Ga0068862_10000010874 282
55 3300006931 Ga0097620_100004551 Ga0097620_10000455116 282
56 3300009177 Ga0105248_10012565 Ga0105248_1001256510 282
57 3300009553 Ga0105249_10255238 Ga0105249_102552381 282
58 3300013306 Ga0163162_10025365 Ga0163162_100253652 282
59 3300025294 Ga0209025_1013439 Ga0209025_10134393 282
60 3300025315 Ga0207697_10010523 Ga0207697_100105234 282
61 3300025931 Ga0207644_10000139 Ga0207644_1000013923 282
62 3300025941 Ga0207711_10007038 Ga0207711_100070384 282
63 3300025961 Ga0207712_10044095 Ga0207712_100440954 282
64 3300025972 Ga0207668_10000012 Ga0207668_10000012163 282
65 3300025986 Ga0207658_10000011 Ga0207658_10000011165 282
66 3300026035 Ga0207703_10000409 Ga0207703_1000040916 282
67 3300026035 Ga0207703_10000529 Ga0207703_1000052923 282
68 3300026088 Ga0207641_10000906 Ga0207641_1000090624 282
69 3300026095 Ga0207676_10000150 Ga0207676_1000015028 282
70 3300028380 Ga0268265_10000429 Ga0268265_1000042944 282
71 3300028381 Ga0268264_10000089 Ga0268264_1000008984 282
72 3300028786 Ga0307517_10015109 Ga0307517_100151098 282
73 3300031616 Ga0307508_10004043 Ga0307508_100040432 282
74 3300033180 Ga0307510_10042014 Ga0307510_100420145 282
75 3300033180 Ga0307510_10171864 Ga0307510_101718641 282
76 3300038705 Ga0237819_04884 Ga0237819_04884_942_1790 282
77 3300046471 Ga0495650_0000951 Ga0495650_0000951_1427_2284 282
78 3300046475 Ga0495639_0074599 Ga0495639_0074599_221_1078 282
79 3300046492 Ga0495585_0037323 Ga0495585_0037323_747_1604 282
80 3300046506 Ga0495583_0000412 Ga0495583_0000412_32847_33704 282
81 3300046524 Ga0495648_0035289 Ga0495648_0035289_2099_2956 282
82 3300046526 Ga0495666_0103830 Ga0495666_0103830_50_907 282
83 3300046557 Ga0495622_0005144 Ga0495622_0005144_4095_4952 282
84 3300046558 Ga0495633_0046611 Ga0495633_0046611_604_1461 282
85 3300046660 Ga0495625_0000189 Ga0495625_0000189_64585_65442 282
86 3300046691 Ga0495670_0069964 Ga0495670_0069964_695_1552 282
87 3300046809 Ga0495600_0002567 Ga0495600_0002567_8252_9109 282
88 3300047443 Ga0495687_000044 Ga0495687_000044_113158_114015 282
89 3300049523 Ga0501300_000593 Ga0501300_000593_2818_3675 282
90 3300053096 Ga0500641_0004469 Ga0500641_0004469_848_1747 282
91 3300053119 Ga0500595_000287 Ga0500595_000287_21515_22372 282
92 3300053121 Ga0500607_042773 Ga0500607_042773_699_1556 282
93 3300053177 Ga0500636_0001236 Ga0500636_0001236_3945_4802 282
94 iso_pu_bacteria 2643221541 2643728787 282
95 iso_pu_bacteria 2643221606 2644044802 282
96 iso_pu_bacteria 2643221671 2644390975 282
97 iso_pu_bacteria 2667528175 2671118219 282
98 iso_pu_bacteria 2885383462 2885385492 282
99 iso_pu_bacteria 2909399089 2909399460 282
100 iso_pu_bacteria 2643221733 2644730337 283
101 iso_pu_bacteria 2687453130 2687583777 283
102 iso_pu_bacteria 2841760612 2841762806 283
103 iso_pu_bacteria 2841949485 2841957148 283
104 iso_pu_bacteria 2844104063 2844110186 283
105 iso_pu_bacteria 2851182111 2851182121 283
106 iso_pu_bacteria 2851246043 2851251848 283
107 iso_pu_bacteria 2884298095 2884300667 283
108 iso_pu_bacteria 2903748898 2903758511 283
109 iso_pu_bacteria 2904666416 2904667154 283
110 iso_pu_bacteria 2906626472 2906631194 283
111 iso_pu_bacteria 3005710791 3005716921 283
112 iso_pu_bacteria 8019555841 8019564490 283
113 iso_pu_bacteria 8019565922 8019574572 283
114 iso_pu_bacteria 8057529695 8057535563 283
115 3300005295 Ga0065707_10130972 Ga0065707_101309722 284
116 3300012513 Ga0157326_1001304 Ga0157326_10013042 284
117 3300037853 Ga0436364_1124930 Ga0436364_1124930_896_1750 284
118 3300049580 Ga0501046_0303386 Ga0501046_0303386_93_947 284
119 3300049581 Ga0501047_0000277 Ga0501047_0000277_51749_52603 284
120 3300049823 Ga0501044_0155451 Ga0501044_0155451_992_1846 284
121 3300053087 Ga0500643_009942 Ga0500643_009942_2213_3073 284
122 3300005295 Ga0065707_10295349 Ga0065707_102953491 285
123 3300005331 Ga0070670_100005973 Ga0070670_1000059737 285
124 3300005466 Ga0070685_10304543 Ga0070685_103045431 285
125 3300005616 Ga0068852_100319227 Ga0068852_1003192272 285
126 3300005841 Ga0068863_100003457 Ga0068863_10000345711 285
127 3300005844 Ga0068862_100002005 Ga0068862_10000200514 285
128 3300009101 Ga0105247_10002415 Ga0105247_100024155 285
129 3300009553 Ga0105249_10000543 Ga0105249_1000054330 285
130 3300014326 Ga0157380_10000499 Ga0157380_100004995 285
131 3300025900 Ga0207710_10001929 Ga0207710_100019299 285
132 3300025925 Ga0207650_10011241 Ga0207650_100112412 285
133 3300025961 Ga0207712_10000388 Ga0207712_1000038831 285
134 3300026041 Ga0207639_10157893 Ga0207639_101578932 285
135 3300026088 Ga0207641_10002990 Ga0207641_1000299015 285
136 3300026142 Ga0207698_10081477 Ga0207698_100814772 285
137 3300028380 Ga0268265_10000121 Ga0268265_1000012114 285
138 3300028381 Ga0268264_10005300 Ga0268264_1000530012 285
139 3300028800 Ga0265338_10151125 Ga0265338_101511252 285
140 3300053156 Ga0500622_0007648 Ga0500622_0007648_2376_3239 285
141 iso_pu_bacteria 2828305725 2828309111 285
142 2162886007 SwRhRL2b_contig_387345 SwRhRL2b_0271.00006490 286
143 3300001976 JGI24752J21851_1000041 JGI24752J21851_10000415 286
144 3300002070 JGI24750J21931_1000237 JGI24750J21931_10002377 286
145 3300002074 JGI24748J21848_1000030 JGI24748J21848_100003050 286
146 3300002076 JGI24749J21850_1000344 JGI24749J21850_10003444 286
147 3300002239 JGI24034J26672_10000046 JGI24034J26672_1000004667 286
148 3300002459 JGI24751J29686_10000272 JGI24751J29686_100002724 286
149 3300005289 Ga0065704_10000616 Ga0065704_100006164 286
150 3300005289 Ga0065704_10003618 Ga0065704_100036184 286
151 3300005289 Ga0065704_10114270 Ga0065704_101142702 286
152 3300005295 Ga0065707_10116625 Ga0065707_101166252 286
153 3300005295 Ga0065707_10122226 Ga0065707_101222262 286
154 3300005330 Ga0070690_100000005 Ga0070690_10000000546 286
155 3300005335 Ga0070666_10000084 Ga0070666_100000842 286
156 3300005335 Ga0070666_10131404 Ga0070666_101314042 286
157 3300005340 Ga0070689_100002237 Ga0070689_1000022377 286
158 3300005347 Ga0070668_100017472 Ga0070668_1000174723 286
159 3300005347 Ga0070668_100056460 Ga0070668_1000564602 286
160 3300005347 Ga0070668_100351492 Ga0070668_1003514921 286
161 3300005353 Ga0070669_100005649 Ga0070669_1000056495 286
162 3300005355 Ga0070671_100035630 Ga0070671_1000356304 286
163 3300005365 Ga0070688_100001297 Ga0070688_1000012975 286
164 3300005367 Ga0070667_100000066 Ga0070667_100000066141 286
165 3300005367 Ga0070667_100004394 Ga0070667_10000439411 286
166 3300005367 Ga0070667_100010427 Ga0070667_1000104276 286
167 3300005440 Ga0070705_100216957 Ga0070705_1002169571 286
168 3300005466 Ga0070685_10000080 Ga0070685_1000008031 286
169 3300005544 Ga0070686_100000001 Ga0070686_100000001255 286
170 3300005548 Ga0070665_100000425 Ga0070665_10000042538 286
171 3300005548 Ga0070665_100012414 Ga0070665_1000124147 286
172 3300005618 Ga0068864_100077198 Ga0068864_1000771982 286
173 3300005719 Ga0068861_100158361 Ga0068861_1001583611 286
174 3300005841 Ga0068863_100000046 Ga0068863_10000004695 286
175 3300005841 Ga0068863_100009676 Ga0068863_1000096762 286
176 3300005841 Ga0068863_100141711 Ga0068863_1001417113 286
177 3300005842 Ga0068858_100016754 Ga0068858_1000167542 286
178 3300005842 Ga0068858_100026267 Ga0068858_1000262674 286
179 3300005843 Ga0068860_100000013 Ga0068860_100000013260 286
180 3300005843 Ga0068860_100033888 Ga0068860_1000338884 286
181 3300005843 Ga0068860_100143322 Ga0068860_1001433222 286
182 3300005844 Ga0068862_100010599 Ga0068862_1000105995 286
183 3300009092 Ga0105250_10022520 Ga0105250_100225202 286
184 3300009101 Ga0105247_10009070 Ga0105247_100090705 286
185 3300009177 Ga0105248_10013600 Ga0105248_100136009 286
186 3300009177 Ga0105248_10222459 Ga0105248_102224593 286
187 3300009177 Ga0105248_10508087 Ga0105248_105080872 286
188 3300009551 Ga0105238_10054119 Ga0105238_100541191 286
189 3300009553 Ga0105249_10035675 Ga0105249_100356752 286
190 3300009553 Ga0105249_10311132 Ga0105249_103111322 286
191 3300009978 Ga0105148_100046 Ga0105148_10004611 286
192 3300013306 Ga0163162_10025473 Ga0163162_100254733 286
193 3300013306 Ga0163162_10093543 Ga0163162_100935432 286
194 3300014968 Ga0157379_10041180 Ga0157379_100411804 286
195 3300017792 Ga0163161_10000037 Ga0163161_10000037158 286
196 3300017792 Ga0163161_10006059 Ga0163161_100060596 286
197 3300017792 Ga0163161_10096728 Ga0163161_100967282 286
198 3300025223 Ga0207672_1000567 Ga0207672_10005672 286
199 3300025315 Ga0207697_10006183 Ga0207697_100061834 286
200 3300025711 Ga0207696_1003567 Ga0207696_10035677 286
201 3300025735 Ga0207713_1016076 Ga0207713_10160762 286
202 3300025735 Ga0207713_1076979 Ga0207713_10769791 286
203 3300025903 Ga0207680_10000008 Ga0207680_10000008249 286
204 3300025923 Ga0207681_10000041 Ga0207681_100000412 286
205 3300025923 Ga0207681_10001087 Ga0207681_1000108715 286
206 3300025924 Ga0207694_10014991 Ga0207694_100149911 286
207 3300025925 Ga0207650_10000012 Ga0207650_100000123 286
208 3300025931 Ga0207644_10000917 Ga0207644_100009178 286
209 3300025931 Ga0207644_10038014 Ga0207644_100380142 286
210 3300025931 Ga0207644_10039432 Ga0207644_100394322 286
211 3300025941 Ga0207711_10011494 Ga0207711_100114942 286
212 3300025941 Ga0207711_10074892 Ga0207711_100748923 286
213 3300025941 Ga0207711_10388436 Ga0207711_103884362 286
214 3300025961 Ga0207712_10000009 Ga0207712_10000009249 286
215 3300025972 Ga0207668_10010668 Ga0207668_100106682 286
216 3300025972 Ga0207668_10019699 Ga0207668_100196992 286
217 3300025986 Ga0207658_10000426 Ga0207658_1000042638 286
218 3300025986 Ga0207658_10000779 Ga0207658_1000077934 286
219 3300025986 Ga0207658_10003621 Ga0207658_100036216 286
220 3300025986 Ga0207658_10016607 Ga0207658_100166072 286
221 3300026035 Ga0207703_10000465 Ga0207703_1000046536 286
222 3300026035 Ga0207703_10003051 Ga0207703_100030512 286
223 3300026035 Ga0207703_10510868 Ga0207703_105108681 286
224 3300026088 Ga0207641_10000145 Ga0207641_1000014557 286
225 3300026088 Ga0207641_10120356 Ga0207641_101203563 286
226 3300026095 Ga0207676_10002001 Ga0207676_100020012 286
227 3300026095 Ga0207676_10108282 Ga0207676_101082822 286
228 3300026118 Ga0207675_100079986 Ga0207675_1000799862 286
229 3300028379 Ga0268266_10000009 Ga0268266_10000009825 286
230 3300028379 Ga0268266_10003044 Ga0268266_100030443 286
231 3300028380 Ga0268265_10000001 Ga0268265_10000001477 286
232 3300028380 Ga0268265_10055278 Ga0268265_100552781 286
233 3300028381 Ga0268264_10000003 Ga0268264_10000003871 286
234 3300028381 Ga0268264_10000039 Ga0268264_10000039258 286
235 3300028381 Ga0268264_10054266 Ga0268264_100542663 286
236 3300028381 Ga0268264_10123540 Ga0268264_101235402 286
237 3300048903 Ga0496100_0037349 Ga0496100_0037349_1127_1987 286
238 3300048904 Ga0496101_0194673 Ga0496101_0194673_19_879 286
239 3300048905 Ga0496102_0002154 Ga0496102_0002154_2416_3276 286
240 3300048905 Ga0496102_0085958 Ga0496102_0085958_107_967 286
241 3300048906 Ga0496103_0000163 Ga0496103_0000163_2409_3269 286
242 3300048906 Ga0496103_0003604 Ga0496103_0003604_1938_2798 286
243 3300048907 Ga0496104_0000298 Ga0496104_0000298_31152_32012 286
244 3300048908 Ga0496105_0015200 Ga0496105_0015200_3030_3890 286
245 3300048908 Ga0496105_0016698 Ga0496105_0016698_4097_4957 286
246 3300048909 Ga0496106_0267511 Ga0496106_0267511_464_1324 286
247 3300048910 Ga0496107_0193253 Ga0496107_0193253_122_982 286
248 3300048910 Ga0496107_0259166 Ga0496107_0259166_203_1063 286
249 3300048916 Ga0496113_0020428 Ga0496113_0020428_1199_2059 286
250 3300048918 Ga0496115_0057741 Ga0496115_0057741_1499_2359 286
251 3300048919 Ga0496116_0031760 Ga0496116_0031760_1100_1960 286
252 3300048919 Ga0496116_0082522 Ga0496116_0082522_106_966 286
253 3300048920 Ga0496117_0004779 Ga0496117_0004779_9273_10133 286
254 3300048920 Ga0496117_0010440 Ga0496117_0010440_1864_2724 286
255 3300048921 Ga0496118_0028767 Ga0496118_0028767_1950_2810 286
256 3300048921 Ga0496118_0091008 Ga0496118_0091008_292_1152 286
257 3300048922 Ga0496119_0003668 Ga0496119_0003668_11412_12272 286
258 3300048923 Ga0496120_0006937 Ga0496120_0006937_4141_5001 286
259 3300048925 Ga0496122_0077157 Ga0496122_0077157_824_1684 286
260 3300048926 Ga0496123_0057867 Ga0496123_0057867_1584_2444 286
261 3300048927 Ga0496124_0001181 Ga0496124_0001181_8718_9584 286
262 3300048927 Ga0496124_0003893 Ga0496124_0003893_5164_6024 286
263 3300048928 Ga0496125_0030337 Ga0496125_0030337_3717_4577 286
264 3300048929 Ga0496126_0001143 Ga0496126_0001143_31283_32143 286
265 3300048929 Ga0496126_0076614 Ga0496126_0076614_838_1698 286
266 3300053087 Ga0500643_001931 Ga0500643_001931_2990_3850 286
267 3300053116 Ga0500592_000116 Ga0500592_000116_16272_17132 286
268 3300053158 Ga0500627_0012509 Ga0500627_0012509_2128_2988 286
269 iso_pu_bacteria 2508501114 2509077325 286
270 iso_pu_bacteria 2773857925 2774872236 286
271 iso_pu_bacteria 2835312727 2835315968 286
272 iso_pu_bacteria 2878035449 2878036724 286
273 iso_pu_bacteria 2909399089 2909400173 286
274 iso_pu_bacteria 641228493 641335111 286
275 iso_pu_bacteria 643348555 643391409 286
276 2162886007 SwRhRL2b_contig_1786227 SwRhRL2b_0233.00001030 287
277 3300003215 JGI25153J46596_10000357 JGI25153J46596_100003574 287
278 3300003771 Ga0055526_1004979 Ga0055526_10049797 287
279 3300003775 Ga0055524_1006472 Ga0055524_10064722 287
280 3300005262 Ga0065165_1001370 Ga0065165_100137018 287
281 3300005289 Ga0065704_10102038 Ga0065704_101020381 287
282 3300005295 Ga0065707_10000862 Ga0065707_100008626 287
283 3300005295 Ga0065707_10087051 Ga0065707_100870513 287
284 3300005435 Ga0070714_100490093 Ga0070714_1004900932 287
285 3300006038 Ga0075365_10006090 Ga0075365_100060901 287
286 3300006051 Ga0075364_10008960 Ga0075364_100089601 287
287 3300006177 Ga0075362_10056591 Ga0075362_100565912 287
288 3300006941 Ga0099825_1042742 Ga0099825_10427422 287
289 3300006942 Ga0099824_1028906 Ga0099824_10289062 287
290 3300006943 Ga0099822_1017856 Ga0099822_10178566 287
291 3300009011 Ga0105251_10017074 Ga0105251_100170742 287
292 3300009092 Ga0105250_10000013 Ga0105250_100000136 287
293 3300009093 Ga0105240_10645532 Ga0105240_106455322 287
294 3300009101 Ga0105247_10009611 Ga0105247_100096115 287
295 3300009148 Ga0105243_10263609 Ga0105243_102636092 287
296 3300009545 Ga0105237_10047507 Ga0105237_100475072 287
297 3300010375 Ga0105239_10031161 Ga0105239_100311615 287
298 3300011119 Ga0105246_10074654 Ga0105246_100746542 287
299 3300014326 Ga0157380_10000935 Ga0157380_100009356 287
300 3300014968 Ga0157379_10022834 Ga0157379_100228343 287
301 3300015685 Ga0183369_1007 Ga0183369_1007369 287
302 3300021361 Ga0213872_10049107 Ga0213872_100491072 287
303 3300021388 Ga0213875_10180198 Ga0213875_101801981 287
304 3300025284 Ga0209130_1000797 Ga0209130_100079719 287
305 3300025294 Ga0209025_1000795 Ga0209025_100079539 287
306 3300025295 Ga0209564_1000074 Ga0209564_1000074110 287
307 3300025297 Ga0209758_1006912 Ga0209758_10069127 287
308 3300025299 Ga0209256_1000109 Ga0209256_1000109153 287
309 3300025711 Ga0207696_1000072 Ga0207696_1000072135 287
310 3300025900 Ga0207710_10082602 Ga0207710_100826021 287
311 3300025901 Ga0207688_10058419 Ga0207688_100584192 287
312 3300025909 Ga0207705_10036119 Ga0207705_100361194 287
313 3300025913 Ga0207695_10137936 Ga0207695_101379362 287
314 3300025914 Ga0207671_10234601 Ga0207671_102346012 287
315 3300025929 Ga0207664_10111829 Ga0207664_101118292 287
316 3300025929 Ga0207664_10408824 Ga0207664_104088241 287
317 3300025935 Ga0207709_10387660 Ga0207709_103876601 287
318 3300025949 Ga0207667_10298960 Ga0207667_102989602 287
319 3300025961 Ga0207712_10284590 Ga0207712_102845901 287
320 3300026078 Ga0207702_10220159 Ga0207702_102201593 287
321 3300027357 Ga0209589_1011529 Ga0209589_10115293 287
322 3300027361 Ga0209489_109285 Ga0209489_1092853 287
323 3300027363 Ga0209700_108852 Ga0209700_1088523 287
324 3300028379 Ga0268266_10005134 Ga0268266_100051344 287
325 3300028379 Ga0268266_10057571 Ga0268266_100575713 287
326 3300028794 Ga0307515_10084264 Ga0307515_100842642 287
327 3300031852 Ga0307410_10420878 Ga0307410_104208781 287
328 3300031901 Ga0307406_10052233 Ga0307406_100522333 287
329 3300031903 Ga0307407_10335694 Ga0307407_103356941 287
330 3300031911 Ga0307412_10004190 Ga0307412_100041906 287
331 3300031995 Ga0307409_100485711 Ga0307409_1004857112 287
332 3300032002 Ga0307416_100263227 Ga0307416_1002632271 287
333 3300032002 Ga0307416_100396854 Ga0307416_1003968542 287
334 3300032126 Ga0307415_100208997 Ga0307415_1002089972 287
335 3300037853 Ga0436364_1106089 Ga0436364_1106089_455_1318 287
336 3300038443 Ga0395901_0004569 Ga0395901_0004569_4527_5390 287
337 3300039438 Ga0436360_0076406 Ga0436360_0076406_1798_2661 287
338 3300039447 Ga0436361_0235895 Ga0436361_0235895_1480_2346 287
339 3300039447 Ga0436361_1019386 Ga0436361_1019386_1546_2409 287
340 3300044684 Ga0466966_0026777 Ga0466966_0026777_1391_2254 287
341 3300044735 Ga0466968_0006590 Ga0466968_0006590_1203_2066 287
342 3300046810 Ga0495660_0112925 Ga0495660_0112925_155_1018 287
343 3300048907 Ga0496104_0000135 Ga0496104_0000135_21899_22816 287
344 3300048907 Ga0496104_0006186 Ga0496104_0006186_9079_9996 287
345 3300048907 Ga0496104_0042013 Ga0496104_0042013_1175_2092 287
346 3300048908 Ga0496105_0000061 Ga0496105_0000061_38801_39718 287
347 3300048908 Ga0496105_0045916 Ga0496105_0045916_2216_3133 287
348 3300048908 Ga0496105_0199459 Ga0496105_0199459_245_1162 287
349 3300048915 Ga0496112_0003364 Ga0496112_0003364_4631_5548 287
350 3300048916 Ga0496113_0029841 Ga0496113_0029841_319_1236 287
351 3300048918 Ga0496115_0048016 Ga0496115_0048016_1843_2760 287
352 3300048920 Ga0496117_0007947 Ga0496117_0007947_4334_5197 287
353 3300048920 Ga0496117_0185201 Ga0496117_0185201_235_1098 287
354 3300048921 Ga0496118_0004275 Ga0496118_0004275_7479_8342 287
355 3300048921 Ga0496118_0074101 Ga0496118_0074101_790_1653 287
356 3300048922 Ga0496119_0000666 Ga0496119_0000666_12748_13665 287
357 3300048922 Ga0496119_0007916 Ga0496119_0007916_4207_5070 287
358 3300048924 Ga0496121_0060648 Ga0496121_0060648_1145_2008 287
359 3300048925 Ga0496122_0001189 Ga0496122_0001189_36559_37422 287
360 3300048926 Ga0496123_0001203 Ga0496123_0001203_2378_3241 287
361 3300048928 Ga0496125_0161535 Ga0496125_0161535_53_1069 287
362 3300049570 Ga0501033_0038994 Ga0501033_0038994_1179_2042 287
363 3300049571 Ga0501034_0081961 Ga0501034_0081961_2319_3182 287
364 3300049571 Ga0501034_0095623 Ga0501034_0095623_1454_2332 287
365 3300049572 Ga0501036_0034689 Ga0501036_0034689_1608_2471 287
366 3300049574 Ga0501038_0066776 Ga0501038_0066776_1748_2611 287
367 3300049580 Ga0501046_0027509 Ga0501046_0027509_2547_3410 287
368 3300049581 Ga0501047_0011281 Ga0501047_0011281_277_1140 287
369 3300049581 Ga0501047_0273005 Ga0501047_0273005_451_1320 287
370 3300049822 Ga0501035_0012721 Ga0501035_0012721_2519_3382 287
371 3300049823 Ga0501044_0131978 Ga0501044_0131978_288_1151 287
372 3300050489 nmdc:mga03683_13589_c1 nmdc:mga03683_13589_c1_1725_2588 287
373 3300050491 nmdc:mga00v17_29345_c1 nmdc:mga00v17_29345_c1_2188_3051 287
374 3300050492 nmdc:mga0yw44_1207_c1 nmdc:mga0yw44_1207_c1_437_1300 287
375 3300053085 Ga0495619_0064368 Ga0495619_0064368_1208_2128 287
376 3300053104 Ga0500556_0000537 Ga0500556_0000537_22570_23433 287
377 3300053177 Ga0500636_0163005 Ga0500636_0163005_212_1075 287
378 3300061719 Ga0466962_0056168 Ga0466962_0056168_697_1560 287
379 iso_pu_bacteria 2894232714 2894238249 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

37

129

0.97

PF00551

Formyl_trans_N

Formyl transferase

140

318

0.94

PF13433

Peripla_BP_5

Periplasmic binding protein domain

38

123

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9535 4 286
3lou-assembly1.cif.gz_B crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9511 5 286
3obi-assembly1.cif.gz_A crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution 0.9494 5 287
3n0v-assembly1.cif.gz_D crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution 0.9481 5 285
3lou-assembly1.cif.gz_A crystal structure of formyltetrahydrofolate deformylase (yp_105254.1) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9469 4 286
ID Description Score Start End Superfamily
3obiD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9669 5 82 3.30.70.260
3nrbA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9328 4 85 3.30.70.260
3n0vB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9299 5 82 3.30.70.260
3louD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.9218 5 84 3.30.70.260
3nrbB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.916 91 287 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A1Y3C7I0-F1-model_v4 Formyltetrahydrofolate deformylase 0.9727 2 84 GO:0006189
GO:0008864
AF-A0A4Q5SC98-F1-model_v4 ACT domain-containing protein 0.9645 3 117 GO:0006189
GO:0008864
AF-A0A388PTG6-F1-model_v4 Formyltetrahydrofolate deformylase 0.9621 3 123 GO:0006189
GO:0008864
AF-A0A258Q1R9-F1-model_v4 Formyltetrahydrofolate deformylase 0.9602 1 118 GO:0006189
GO:0008864
AF-A0A6B3B6A5-F1-model_v4 Formyltetrahydrofolate deformylase (EC 3.5.1.10) (Formyl-FH(4) hydrolase) 0.9595 2 286 GO:0006189
GO:0006730
GO:0008864

Feature Viewer

pLDDT pTM Quality
92.26 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map