F428008

General Info

Members Datasets Scaffolds Average Seq Length
378 275 356 331

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10178239|Ga0105243_101782392
Length 382
Sequence MDGFLLGERCALPMRAILRKAGIGAAVPCRSCDATYMARQRRRLPLVKLSILDLVRVREGGTPLSALEDSRSLAVHAESLGYGRFWVAEHHNMPGIASAATSVVIGYLAQATSRMRIGAGGIMLPNHAPIVIAEQFGTLAQLYPGRIDLGLGRAPGTDQPTMRALRRSLTNSDNFPQDVLELQAYFSAEQQAGQIQAVPAAGTDVPLWILGSSTYGAQLAAHLGLPYGFASHFAPDLLLDALAIYRSRFQLSAHCPRPYAMVGVNIIAADSDAEARRLATTQQMSFADLLRGARRLSRPPISNIEDYWSPTEKAQAQRMLARSIVGAPDTVQAGISALVEETGADELMIVSDIYDLEARKRSLEIIANSRALHGNAKMLSEV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221693 Rhizobium sp. Root491 Isolate Unclassified
7 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
8 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
9 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
10 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
11 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
12 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
13 2818991436 Collimonas arenae 515 Isolate Unclassified
14 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
15 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
16 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
17 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
18 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
19 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
20 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
21 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
22 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
23 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
26 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
31 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
32 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
33 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
34 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
101 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
163 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
164 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
171 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
221 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
265 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
266 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
267 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
271 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
272 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 0.26
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.79
Nodule 0.26
Rhizoplane 2.12
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 12.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2129276 2162886007 Bacteria 6469
2 JGI24741J21665_1000173 3300001915 Bacteria 18592
3 JGI24740J21852_10026576 3300001979 Bacteria 1937
4 JGI24739J22299_10000501 3300001989 Bacteria 13893
5 JGI24737J22298_10006592 3300001990 Bacteria 3956
6 JGI24735J21928_10013641 3300002067 Bacteria 2551
7 JGI24738J21930_10000823 3300002075 Bacteria 8877
8 JGI25165J46597_1000373 3300003214 Bacteria 49990
9 Ga0055538_1000144 3300003751 Bacteria 49990
10 Ga0055539_1000195 3300003752 Bacteria 49990
11 Ga0055533_1000196 3300003756 Bacteria 49990
12 Ga0055525_1000263 3300003759 Bacteria 49990
13 Ga0055541_1000128 3300003841 Bacteria 49990
14 Ga0065704_10002149 3300005289 Bacteria 9013
15 Ga0065704_10002858 3300005289 Bacteria 6556
16 Ga0065704_10116104 3300005289 Bacteria 1859
17 Ga0070683_100049688 3300005329 Bacteria 3880
18 Ga0070670_100000209 3300005331 Bacteria 54253
19 Ga0070666_10180823 3300005335 Bacteria 1479
20 Ga0070689_100118674 3300005340 Bacteria 2111
21 Ga0070669_100066733 3300005353 Bacteria 2653
22 Ga0070669_100088659 3300005353 Bacteria 2316
23 Ga0070669_100242954 3300005353 Bacteria 1431
24 Ga0070675_100182423 3300005354 Bacteria 1815
25 Ga0070671_100068643 3300005355 Bacteria 2957
26 Ga0070674_100012678 3300005356 Bacteria 5182
27 Ga0070674_100098056 3300005356 Bacteria 2130
28 Ga0070673_100010949 3300005364 Bacteria 6170
29 Ga0070659_100032876 3300005366 Bacteria 4027
30 Ga0070667_100000127 3300005367 Bacteria 95853
31 Ga0070667_100000174 3300005367 Bacteria 79730
32 Ga0070663_100000434 3300005455 Bacteria 22038
33 Ga0070681_10114160 3300005458 Bacteria 2640
34 Ga0068867_100460520 3300005459 Bacteria 1086
35 Ga0070684_100000769 3300005535 Bacteria 22213
36 Ga0070697_100252347 3300005536 Bacteria 1509
37 Ga0068853_100017446 3300005539 Bacteria 5924
38 Ga0068855_100018266 3300005563 Bacteria 8422
39 Ga0068855_100154177 3300005563 Bacteria 2611
40 Ga0068855_100298539 3300005563 Bacteria 1784
41 Ga0070664_100050610 3300005564 Bacteria 3517
42 Ga0068857_100052595 3300005577 Bacteria 3613
43 Ga0068854_100082969 3300005578 Bacteria 2369
44 Ga0068856_100015610 3300005614 Bacteria 7343
45 Ga0068856_100176121 3300005614 Bacteria 2151
46 Ga0068852_100069656 3300005616 Bacteria 3084
47 Ga0068859_100083309 3300005617 Bacteria 3241
48 Ga0068864_100000062 3300005618 Bacteria 121206
49 Ga0068864_100029288 3300005618 Bacteria 4660
50 Ga0068851_10051788 3300005834 Bacteria 2086
51 Ga0068851_10077548 3300005834 Bacteria 1730
52 Ga0068863_100000064 3300005841 Bacteria 118153
53 Ga0068863_100007816 3300005841 Bacteria 10459
54 Ga0068860_100000125 3300005843 Bacteria 123363
55 Ga0068860_100180705 3300005843 Bacteria 2039
56 Ga0068862_100000079 3300005844 Bacteria 113551
57 Ga0068862_100001663 3300005844 Bacteria 20201
58 Ga0075365_10065842 3300006038 Bacteria 2429
59 Ga0075364_10002199 3300006051 Bacteria 10935
60 Ga0075364_10023205 3300006051 Bacteria 3927
61 Ga0075370_10066739 3300006353 Bacteria 2053
62 Ga0075430_100135925 3300006846 Bacteria 2048
63 Ga0075431_100119732 3300006847 Bacteria 2716
64 Ga0075434_100014840 3300006871 Bacteria 7453
65 Ga0075429_100099539 3300006880 Bacteria 2537
66 Ga0075436_100001741 3300006914 Bacteria 14907
67 Ga0097620_100083309 3300006931 Bacteria 3241
68 Ga0075435_100000018 3300007076 Bacteria 97506
69 Ga0105251_10003959 3300009011 Bacteria 10495
70 Ga0105240_10003721 3300009093 Bacteria 23562
71 Ga0105240_10010397 3300009093 Bacteria 13079
72 Ga0105247_10007723 3300009101 Bacteria 6581
73 Ga0105243_10178239 3300009148 Bacteria 1846
74 Ga0105243_10259795 3300009148 Bacteria 1554
75 Ga0105241_10019325 3300009174 Bacteria 5023
76 Ga0105248_10000014 3300009177 Bacteria 324729
77 Ga0105248_10026633 3300009177 Bacteria 6429
78 Ga0105248_10035276 3300009177 Bacteria 5595
79 Ga0105248_10064034 3300009177 Bacteria 4127
80 Ga0105237_10000130 3300009545 Bacteria 105282
81 Ga0105237_10030003 3300009545 Bacteria 5525
82 Ga0105237_10267976 3300009545 Bacteria 1711
83 Ga0105238_10208247 3300009551 Bacteria 1931
84 Ga0105238_10618100 3300009551 Bacteria 1092
85 Ga0105249_10000907 3300009553 Bacteria 26174
86 Ga0105148_100291 3300009978 Bacteria 6544
87 Ga0105239_10000031 3300010375 Bacteria 226947
88 Ga0105239_10615782 3300010375 Bacteria 1239
89 Ga0157369_10001433 3300013105 Bacteria 29260
90 Ga0163162_10014953 3300013306 Bacteria 7579
91 Ga0157372_10059406 3300013307 Bacteria 4276
92 Ga0157375_10394078 3300013308 Bacteria 1551
93 Ga0163163_10053916 3300014325 Bacteria 3971
94 Ga0157380_10012505 3300014326 Bacteria 6159
95 Ga0182005_1004946 3300015265 Bacteria 4225
96 Ga0213876_10000426 3300021384 Bacteria 34932
97 Ga0213875_10098224 3300021388 Bacteria 1366
98 Ga0209784_100010 3300025224 Bacteria 683664
99 Ga0209566_100008 3300025225 Bacteria 683664
100 Ga0209674_100019 3300025226 Bacteria 683664
101 Ga0209147_100678 3300025229 Bacteria 17543
102 Ga0209563_100021 3300025230 Bacteria 683764
103 Ga0207427_102342 3300025231 Bacteria 5197
104 Ga0209437_100019 3300025233 Bacteria 683764
105 Ga0209677_100011 3300025253 Bacteria 683664
106 Ga0209759_1006849 3300025256 Bacteria 3768
107 Ga0209233_1000025 3300025261 Bacteria 683764
108 Ga0209050_1001457 3300025298 Bacteria 25353
109 Ga0209257_1000323 3300025304 Bacteria 100164
110 Ga0207713_1024525 3300025735 Bacteria 2810
111 Ga0207710_10008534 3300025900 Bacteria 4319
112 Ga0207680_10163172 3300025903 Bacteria 1496
113 Ga0207680_10251035 3300025903 Bacteria 1222
114 Ga0207647_10040595 3300025904 Bacteria 2929
115 Ga0207699_10102334 3300025906 Bacteria 1820
116 Ga0207654_10014003 3300025911 Bacteria 4136
117 Ga0207695_10004043 3300025913 Bacteria 20183
118 Ga0207695_10006617 3300025913 Bacteria 14973
119 Ga0207671_10005191 3300025914 Bacteria 12103
120 Ga0207671_10031981 3300025914 Bacteria 3917
121 Ga0207657_10022904 3300025919 Bacteria 5828
122 Ga0207681_10013617 3300025923 Bacteria 5036
123 Ga0207650_10000367 3300025925 Bacteria 42933
124 Ga0207650_10030393 3300025925 Bacteria 3891
125 Ga0207659_10159493 3300025926 Bacteria 1769
126 Ga0207644_10265678 3300025931 Bacteria 1373
127 Ga0207670_10095661 3300025936 Bacteria 2110
128 Ga0207711_10000021 3300025941 Bacteria 355952
129 Ga0207711_10037844 3300025941 Bacteria 4101
130 Ga0207661_10073470 3300025944 Bacteria 2801
131 Ga0207667_10125398 3300025949 Bacteria 2644
132 Ga0207651_10000189 3300025960 Bacteria 26894
133 Ga0207712_10000687 3300025961 Bacteria 26162
134 Ga0207668_10000448 3300025972 Bacteria 26029
135 Ga0207640_10068006 3300025981 Bacteria 2386
136 Ga0207640_10085938 3300025981 Bacteria 2164
137 Ga0207658_10000122 3300025986 Bacteria 84415
138 Ga0207658_10000424 3300025986 Bacteria 40038
139 Ga0207658_10097918 3300025986 Bacteria 2291
140 Ga0207703_10025810 3300026035 Bacteria 4624
141 Ga0207639_10001222 3300026041 Bacteria 17439
142 Ga0207639_10011556 3300026041 Bacteria 6136
143 Ga0207678_10000584 3300026067 Bacteria 33400
144 Ga0207641_10000107 3300026088 Bacteria 121220
145 Ga0207641_10000956 3300026088 Bacteria 29693
146 Ga0207676_10000057 3300026095 Bacteria 121220
147 Ga0207674_10080708 3300026116 Bacteria 3255
148 Ga0207698_10003129 3300026142 Bacteria 9923
149 Ga0268266_10012111 3300028379 Bacteria 7464
150 Ga0268265_10000080 3300028380 Bacteria 121220
151 Ga0268265_10004207 3300028380 Bacteria 10066
152 Ga0268265_10237620 3300028380 Bacteria 1606
153 Ga0268264_10000166 3300028381 Bacteria 146960
154 Ga0265318_10012020 3300028577 Bacteria 3698
155 Ga0265336_10000028 3300028666 Bacteria 179201
156 Ga0265324_10003212 3300029957 Bacteria 7905
157 Ga0265765_1004811 3300030879 Bacteria 1400
158 Ga0265328_10024616 3300031239 Bacteria 2272
159 Ga0265328_10033179 3300031239 Bacteria 1914
160 Ga0265325_10000136 3300031241 Bacteria 50918
161 Ga0265340_10018526 3300031247 Bacteria 3590
162 Ga0265331_10049539 3300031250 Bacteria 2017
163 Ga0265316_10004957 3300031344 Bacteria 13086
164 Ga0265313_10009036 3300031595 Bacteria 6528
165 Ga0307405_10006287 3300031731 Bacteria 5829
166 Ga0307405_10072302 3300031731 Bacteria 2223
167 Ga0307410_10075228 3300031852 Bacteria 2354
168 Ga0307406_10232848 3300031901 Bacteria 1377
169 Ga0307412_10096394 3300031911 Bacteria 2082
170 Ga0307409_100140181 3300031995 Bacteria 2082
171 Ga0307414_10003996 3300032004 Bacteria 7959
172 Ga0307414_10094439 3300032004 Bacteria 2232
173 Ga0307411_10065648 3300032005 Bacteria 2435
174 Ga0395898_0159932 3300037466 Bacteria 2154
175 Ga0436364_0616084 3300037853 Bacteria 3184
176 Ga0395901_0374006 3300038443 Bacteria 1467
177 Ga0436365_0245367 3300039437 Bacteria 43680
178 Ga0436363_1707107 3300039450 Bacteria 2854
179 Ga0451807_2621016 3300041486 Bacteria 1879
180 Ga0451837_0503711 3300041494 Bacteria 2667
181 Ga0450904_000183 3300042139 Bacteria 13617
182 Ga0450904_000416 3300042139 Bacteria 8661
183 Ga0439446_0014133 3300042156 Bacteria 2200
184 Ga0453684_0123452 3300044712 Bacteria 3122
185 Ga0466968_0019104 3300044735 Bacteria 2755
186 Ga0466959_0149633 3300045049 Bacteria 1646
187 Ga0451576_0002071 3300045051 Bacteria 31414
188 Ga0466967_0063054 3300045976 Bacteria 3292
189 Ga0495617_012675 3300046452 Bacteria 2875
190 Ga0495627_000431 3300046453 Bacteria 36399
191 Ga0495627_001658 3300046453 Bacteria 12330
192 Ga0495590_0048525 3300046457 Bacteria 1481
193 Ga0495638_0087707 3300046460 Bacteria 1879
194 Ga0495651_0089742 3300046462 Bacteria 2306
195 Ga0495653_0008157 3300046463 Bacteria 8576
196 Ga0495584_0077553 3300046491 Bacteria 1671
197 Ga0495607_0000021 3300046501 Bacteria 164571
198 Ga0495607_0011163 3300046501 Bacteria 5999
199 Ga0495583_0000276 3300046506 Bacteria 82963
200 Ga0495608_0007994 3300046511 Bacteria 7436
201 Ga0495610_0000068 3300046512 Bacteria 122949
202 Ga0495618_0037908 3300046514 Bacteria 3028
203 Ga0495628_0063264 3300046516 Bacteria 2899
204 Ga0495632_0000007 3300046519 Bacteria 343246
205 Ga0495637_0000791 3300046520 Bacteria 21154
206 Ga0495643_0000005 3300046522 Bacteria 443135
207 Ga0495648_0005531 3300046524 Bacteria 10486
208 Ga0495648_0041713 3300046524 Bacteria 2895
209 Ga0495663_0000005 3300046525 Bacteria 342265
210 Ga0495645_0156512 3300046543 Bacteria 1578
211 Ga0495633_0000256 3300046558 Bacteria 62904
212 Ga0495633_0000766 3300046558 Bacteria 28930
213 Ga0495633_0012426 3300046558 Bacteria 4530
214 Ga0495611_0098993 3300046648 Bacteria 1353
215 Ga0495625_0000751 3300046660 Bacteria 45255
216 Ga0495625_0002958 3300046660 Bacteria 17693
217 Ga0495635_0201640 3300046663 Bacteria 1349
218 Ga0495661_0000284 3300046665 Bacteria 57616
219 Ga0495599_0043117 3300046678 Bacteria 2831
220 Ga0495646_0010736 3300046680 Bacteria 5820
221 Ga0495669_0061680 3300046684 Bacteria 1697
222 Ga0495624_0031206 3300046690 Bacteria 3467
223 Ga0495671_0000007 3300046692 Bacteria 443069
224 Ga0495649_0005498 3300046694 Bacteria 8038
225 Ga0495589_0004605 3300046794 Bacteria 7329
226 Ga0495600_0008875 3300046809 Bacteria 6194
227 Ga0495604_0101360 3300047317 Bacteria 2115
228 Ga0495672_0095743 3300047320 Bacteria 1620
229 Ga0495683_0022396 3300047323 Bacteria 3249
230 Ga0495681_0000055 3300047470 Bacteria 104502
231 Ga0495681_0002657 3300047470 Bacteria 12672
232 Ga0495686_0000164 3300047472 Bacteria 126101
233 Ga0495686_0036460 3300047472 Bacteria 3156
234 Ga0495686_0074650 3300047472 Bacteria 2080
235 Ga0496102_0092039 3300048905 Bacteria 2808
236 Ga0496102_0341784 3300048905 Bacteria 1409
237 Ga0496105_0058925 3300048908 Bacteria 3169
238 Ga0496108_0001299 3300048911 Bacteria 19625
239 Ga0496109_0105581 3300048912 Bacteria 2616
240 Ga0496113_0052840 3300048916 Bacteria 3036
241 Ga0496114_0141806 3300048917 Bacteria 2081
242 Ga0496117_0002505 3300048920 Bacteria 23035
243 Ga0496117_0008867 3300048920 Bacteria 9490
244 Ga0496117_0039058 3300048920 Bacteria 3508
245 Ga0496118_0000253 3300048921 Bacteria 94328
246 Ga0496118_0000597 3300048921 Bacteria 59798
247 Ga0496118_0011548 3300048921 Bacteria 8605
248 Ga0496119_0052742 3300048922 Bacteria 2489
249 Ga0496120_0166115 3300048923 Bacteria 1096
250 Ga0496121_0000009 3300048924 Bacteria 836971
251 Ga0496121_0000017 3300048924 Bacteria 546415
252 Ga0496121_0000069 3300048924 Bacteria 253087
253 Ga0496121_0000293 3300048924 Bacteria 103372
254 Ga0496121_0002582 3300048924 Bacteria 27397
255 Ga0496121_0037747 3300048924 Bacteria 4286
256 Ga0496121_0053446 3300048924 Bacteria 3384
257 Ga0496121_0056968 3300048924 Bacteria 3242
258 Ga0496122_0006942 3300048925 Bacteria 12766
259 Ga0496122_0171879 3300048925 Bacteria 1305
260 Ga0496122_0236635 3300048925 Bacteria 1033
261 Ga0496123_0198667 3300048926 Bacteria 1030
262 Ga0496124_0000458 3300048927 Bacteria 70719
263 Ga0496124_0007043 3300048927 Bacteria 12044
264 Ga0496124_0020337 3300048927 Bacteria 6139
265 Ga0496125_0022777 3300048928 Bacteria 5807
266 Ga0496125_0044095 3300048928 Bacteria 3777
267 Ga0496126_0007655 3300048929 Bacteria 11788
268 Ga0496126_0018009 3300048929 Bacteria 7021
269 Ga0496126_0029082 3300048929 Bacteria 5253
270 Ga0496126_0194511 3300048929 Bacteria 1716
271 Ga0501031_0007010 3300049568 Bacteria 7356
272 Ga0501032_0026099 3300049569 Bacteria 4023
273 Ga0501032_0113783 3300049569 Bacteria 1790
274 Ga0501032_0129509 3300049569 Bacteria 1665
275 Ga0501033_0001910 3300049570 Bacteria 18130
276 Ga0501033_0002876 3300049570 Bacteria 14423
277 Ga0501034_0094384 3300049571 Bacteria 2988
278 Ga0501034_0282958 3300049571 Bacteria 1597
279 Ga0501036_0014234 3300049572 Bacteria 6619
280 Ga0501036_0036910 3300049572 Bacteria 4134
281 Ga0501036_0142882 3300049572 Bacteria 2019
282 Ga0501037_0009629 3300049573 Bacteria 7089
283 Ga0501037_0092109 3300049573 Bacteria 2192
284 Ga0501038_0042747 3300049574 Bacteria 3945
285 Ga0501039_0030064 3300049575 Bacteria 4186
286 Ga0501039_0223868 3300049575 Bacteria 1479
287 Ga0501039_0324982 3300049575 Bacteria 1209
288 Ga0501041_0109425 3300049577 Bacteria 1714
289 Ga0501043_0003239 3300049579 Bacteria 13442
290 Ga0501046_0068526 3300049580 Bacteria 2761
291 Ga0501046_0277376 3300049580 Bacteria 1228
292 Ga0501047_0348995 3300049581 Bacteria 1316
293 Ga0501048_0048450 3300049582 Bacteria 3030
294 Ga0501067_0002648 3300049583 Bacteria 9914
295 Ga0501068_0004826 3300049584 Bacteria 7339
296 Ga0501069_0028516 3300049585 Bacteria 3061
297 Ga0501069_0040054 3300049585 Bacteria 2589
298 Ga0501069_0185592 3300049585 Bacteria 1203
299 Ga0501070_0004856 3300049586 Bacteria 11487
300 Ga0501070_0109405 3300049586 Bacteria 2283
301 Ga0501070_0281988 3300049586 Bacteria 1355
302 Ga0501071_0101407 3300049587 Bacteria 2122
303 Ga0501071_0117920 3300049587 Bacteria 1966
304 Ga0501072_0120745 3300049588 Bacteria 2088
305 Ga0501072_0195718 3300049588 Bacteria 1612
306 Ga0501072_0260448 3300049588 Bacteria 1380
307 Ga0501073_0020321 3300049589 Bacteria 4791
308 Ga0501074_0038839 3300049590 Bacteria 3448
309 Ga0501075_0065423 3300049591 Bacteria 2743
310 Ga0501075_0073524 3300049591 Bacteria 2585
311 Ga0501076_0222603 3300049592 Bacteria 1542
312 Ga0501077_0113752 3300049593 Bacteria 1716
313 Ga0501211_000862 3300049658 Bacteria 3171
314 Ga0501223_000021 3300049663 Bacteria 66697
315 Ga0501225_0000011 3300049705 Bacteria 74084
316 Ga0501225_0001072 3300049705 Bacteria 8586
317 Ga0501079_0001769 3300049741 Bacteria 15409
318 Ga0501079_0012807 3300049741 Bacteria 6403
319 Ga0501080_0131445 3300049742 Bacteria 2318
320 Ga0501080_0216997 3300049742 Bacteria 1751
321 Ga0501080_0300822 3300049742 Bacteria 1455
322 Ga0501081_0114632 3300049743 Bacteria 1915
323 Ga0501083_0051518 3300049744 Bacteria 2767
324 Ga0501035_0000826 3300049822 Bacteria 33043
325 Ga0501035_0332086 3300049822 Bacteria 1275
326 Ga0501044_0116084 3300049823 Bacteria 2682
327 Ga0501044_0153294 3300049823 Bacteria 2285
328 Ga0501045_0008986 3300049824 Bacteria 6979
329 Ga0501045_0221420 3300049824 Bacteria 1409
330 nmdc:mga00v17_5679_c1 3300050491 Bacteria 6586
331 nmdc:mga0n895_112_c1 3300050512 Bacteria 48224
332 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
333 nmdc:mga08x19_77_c1 3300050514 Bacteria 91801
334 Ga0495601_0135964 3300053077 Bacteria 1602
335 Ga0500643_005656 3300053087 Bacteria 5346
336 Ga0500643_010138 3300053087 Bacteria 3535
337 Ga0500643_012984 3300053087 Bacteria 2962
338 Ga0500562_003548 3300053108 Bacteria 3912
339 Ga0500595_001521 3300053119 Bacteria 12313
340 Ga0500607_105110 3300053121 Bacteria 1395
341 Ga0500559_0010851 3300053136 Bacteria 3905
342 Ga0500559_0018683 3300053136 Bacteria 2927
343 Ga0500574_005208 3300053141 Bacteria 2510
344 Ga0500590_011772 3300053148 Bacteria 4441
345 Ga0500604_0004420 3300053151 Bacteria 3733
346 Ga0500619_000818 3300053154 Bacteria 5293
347 Ga0500624_000065 3300053157 Bacteria 63944
348 Ga0500636_0012490 3300053177 Bacteria 4978
349 Ga0500636_0038289 3300053177 Bacteria 2837
350 Ga0501084_0021158 3300054114 Bacteria 5424
351 Ga0501084_0142140 3300054114 Bacteria 2021
352 Ga0501084_0325446 3300054114 Bacteria 1298
353 Ga0501082_0002539 3300060353 Bacteria 15986
354 Ga0501082_0034027 3300060353 Bacteria 4395
355 Ga0501082_0035440 3300060353 Bacteria 4301
356 Ga0501082_0144840 3300060353 Bacteria 2062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049573 Ga0501037_0092109 Ga0501037_0092109_1264_2181 280
2 3300048926 Ga0496123_0198667 Ga0496123_0198667_173_1018 281
3 3300049592 Ga0501076_0222603 Ga0501076_0222603_603_1529 284
4 3300053087 Ga0500643_012984 Ga0500643_012984_10_903 297
5 3300031250 Ga0265331_10049539 Ga0265331_100495392 298
6 3300049658 Ga0501211_000862 Ga0501211_000862_1080_1979 299
7 3300049569 Ga0501032_0129509 Ga0501032_0129509_128_1120 305
8 3300049570 Ga0501033_0002876 Ga0501033_0002876_2204_3196 305
9 3300049571 Ga0501034_0282958 Ga0501034_0282958_449_1441 305
10 3300049572 Ga0501036_0014234 Ga0501036_0014234_2019_3011 305
11 3300049579 Ga0501043_0003239 Ga0501043_0003239_626_1618 305
12 3300049580 Ga0501046_0277376 Ga0501046_0277376_184_1176 305
13 3300049581 Ga0501047_0348995 Ga0501047_0348995_141_1133 305
14 3300049585 Ga0501069_0028516 Ga0501069_0028516_493_1485 305
15 3300049586 Ga0501070_0004856 Ga0501070_0004856_8233_9225 305
16 3300049741 Ga0501079_0001769 Ga0501079_0001769_343_1335 305
17 3300049742 Ga0501080_0216997 Ga0501080_0216997_449_1441 305
18 3300049744 Ga0501083_0051518 Ga0501083_0051518_1176_2168 305
19 3300049822 Ga0501035_0000826 Ga0501035_0000826_14763_15755 305
20 3300049823 Ga0501044_0116084 Ga0501044_0116084_541_1533 305
21 3300054114 Ga0501084_0021158 Ga0501084_0021158_2350_3342 305
22 3300060353 Ga0501082_0002539 Ga0501082_0002539_513_1505 305
23 3300042156 Ga0439446_0014133 Ga0439446_0014133_337_1341 306
24 3300049588 Ga0501072_0260448 Ga0501072_0260448_283_1275 306
25 3300009177 Ga0105248_10026633 Ga0105248_100266333 309
26 3300049568 Ga0501031_0007010 Ga0501031_0007010_5299_6300 309
27 3300049569 Ga0501032_0026099 Ga0501032_0026099_891_1892 309
28 3300049570 Ga0501033_0001910 Ga0501033_0001910_15486_16487 309
29 3300049572 Ga0501036_0036910 Ga0501036_0036910_762_1763 309
30 3300049573 Ga0501037_0009629 Ga0501037_0009629_740_1741 309
31 3300049574 Ga0501038_0042747 Ga0501038_0042747_749_1750 309
32 3300049575 Ga0501039_0030064 Ga0501039_0030064_3037_4038 309
33 3300049580 Ga0501046_0068526 Ga0501046_0068526_1124_2125 309
34 3300049583 Ga0501067_0002648 Ga0501067_0002648_5809_6810 309
35 3300049584 Ga0501068_0004826 Ga0501068_0004826_3544_4545 309
36 3300049589 Ga0501073_0020321 Ga0501073_0020321_996_1997 309
37 3300049590 Ga0501074_0038839 Ga0501074_0038839_379_1380 309
38 3300049741 Ga0501079_0012807 Ga0501079_0012807_2246_3247 309
39 3300049824 Ga0501045_0008986 Ga0501045_0008986_3847_4848 309
40 3300060353 Ga0501082_0034027 Ga0501082_0034027_3188_4189 309
41 3300049582 Ga0501048_0048450 Ga0501048_0048450_1855_2847 310
42 3300048908 Ga0496105_0058925 Ga0496105_0058925_1386_2372 312
43 3300048917 Ga0496114_0141806 Ga0496114_0141806_731_1717 312
44 3300049585 Ga0501069_0040054 Ga0501069_0040054_349_1359 312
45 3300048925 Ga0496122_0236635 Ga0496122_0236635_75_1019 314
46 3300053087 Ga0500643_010138 Ga0500643_010138_1247_2257 315
47 3300053157 Ga0500624_000065 Ga0500624_000065_38999_40009 316
48 3300053177 Ga0500636_0012490 Ga0500636_0012490_914_1924 316
49 3300049593 Ga0501077_0113752 Ga0501077_0113752_391_1353 317
50 3300031731 Ga0307405_10072302 Ga0307405_100723022 321
51 3300048922 Ga0496119_0052742 Ga0496119_0052742_256_1230 321
52 3300031901 Ga0307406_10232848 Ga0307406_102328482 322
53 3300049586 Ga0501070_0109405 Ga0501070_0109405_1150_2124 323
54 3300049587 Ga0501071_0101407 Ga0501071_0101407_353_1327 323
55 3300060353 Ga0501082_0035440 Ga0501082_0035440_1236_2210 323
56 iso_pu_bacteria 2919138771 2919139371 323
57 3300005356 Ga0070674_100098056 Ga0070674_1000980562 324
58 3300013308 Ga0157375_10394078 Ga0157375_103940782 324
59 3300025914 Ga0207671_10005191 Ga0207671_100051918 324
60 3300031239 Ga0265328_10024616 Ga0265328_100246163 324
61 iso_pu_bacteria 2643221563 2643835560 324
62 iso_pu_bacteria 2643221608 2644056486 324
63 3300005536 Ga0070697_100252347 Ga0070697_1002523471 325
64 3300005616 Ga0068852_100069656 Ga0068852_1000696562 325
65 3300009177 Ga0105248_10035276 Ga0105248_100352764 325
66 3300026142 Ga0207698_10003129 Ga0207698_100031296 325
67 3300028577 Ga0265318_10012020 Ga0265318_100120202 325
68 3300031239 Ga0265328_10033179 Ga0265328_100331792 325
69 3300031241 Ga0265325_10000136 Ga0265325_1000013612 325
70 3300031247 Ga0265340_10018526 Ga0265340_100185262 325
71 3300031344 Ga0265316_10004957 Ga0265316_100049577 325
72 3300031595 Ga0265313_10009036 Ga0265313_1000903610 325
73 3300031852 Ga0307410_10075228 Ga0307410_100752283 325
74 3300032004 Ga0307414_10003996 Ga0307414_100039962 325
75 3300032004 Ga0307414_10094439 Ga0307414_100944392 325
76 3300032005 Ga0307411_10065648 Ga0307411_100656483 325
77 3300041494 Ga0451837_0503711 Ga0451837_0503711_184_1182 325
78 3300042139 Ga0450904_000183 Ga0450904_000183_5644_6624 325
79 3300042139 Ga0450904_000416 Ga0450904_000416_338_1318 325
80 3300048924 Ga0496121_0000009 Ga0496121_0000009_544583_545569 325
81 3300048929 Ga0496126_0029082 Ga0496126_0029082_2545_3525 325
82 3300049569 Ga0501032_0113783 Ga0501032_0113783_488_1468 325
83 3300049575 Ga0501039_0324982 Ga0501039_0324982_217_1197 325
84 iso_pu_bacteria 2919493220 2919494973 325
85 iso_pu_bacteria 2919543075 2919545927 325
86 iso_pu_bacteria 2923525760 2923529777 325
87 3300005354 Ga0070675_100182423 Ga0070675_1001824232 326
88 3300005459 Ga0068867_100460520 Ga0068867_1004605201 326
89 3300006038 Ga0075365_10065842 Ga0075365_100658422 326
90 3300006871 Ga0075434_100014840 Ga0075434_1000148403 326
91 3300006914 Ga0075436_100001741 Ga0075436_1000017412 326
92 3300007076 Ga0075435_100000018 Ga0075435_10000001843 326
93 3300025926 Ga0207659_10159493 Ga0207659_101594932 326
94 3300046524 Ga0495648_0041713 Ga0495648_0041713_229_1230 326
95 3300047320 Ga0495672_0095743 Ga0495672_0095743_212_1201 326
96 3300048924 Ga0496121_0000069 Ga0496121_0000069_176719_177720 326
97 3300048929 Ga0496126_0007655 Ga0496126_0007655_3922_4923 326
98 3300049572 Ga0501036_0142882 Ga0501036_0142882_473_1483 326
99 3300049575 Ga0501039_0223868 Ga0501039_0223868_45_1055 326
100 3300049577 Ga0501041_0109425 Ga0501041_0109425_270_1280 326
101 3300049585 Ga0501069_0185592 Ga0501069_0185592_179_1189 326
102 3300049586 Ga0501070_0281988 Ga0501070_0281988_152_1135 326
103 3300049587 Ga0501071_0117920 Ga0501071_0117920_226_1236 326
104 3300049588 Ga0501072_0120745 Ga0501072_0120745_785_1795 326
105 3300049591 Ga0501075_0073524 Ga0501075_0073524_331_1341 326
106 3300049742 Ga0501080_0131445 Ga0501080_0131445_805_1815 326
107 3300049742 Ga0501080_0300822 Ga0501080_0300822_318_1301 326
108 3300049822 Ga0501035_0332086 Ga0501035_0332086_157_1140 326
109 3300050512 nmdc:mga0n895_112_c1 nmdc:mga0n895_112_c1_41945_42928 326
110 3300050513 nmdc:mga0rr50_5_c1 nmdc:mga0rr50_5_c1_172997_173980 326
111 3300050514 nmdc:mga08x19_77_c1 nmdc:mga08x19_77_c1_15426_16409 326
112 3300054114 Ga0501084_0325446 Ga0501084_0325446_226_1236 326
113 3300005578 Ga0068854_100082969 Ga0068854_1000829694 327
114 3300009545 Ga0105237_10000130 Ga0105237_1000013069 327
115 3300009545 Ga0105237_10030003 Ga0105237_100300033 327
116 3300013105 Ga0157369_10001433 Ga0157369_1000143310 327
117 3300013307 Ga0157372_10059406 Ga0157372_100594063 327
118 3300025914 Ga0207671_10031981 Ga0207671_100319813 327
119 3300025981 Ga0207640_10068006 Ga0207640_100680064 327
120 3300053108 Ga0500562_003548 Ga0500562_003548_1652_2641 327
121 3300025298 Ga0209050_1001457 Ga0209050_100145710 328
122 3300025304 Ga0209257_1000323 Ga0209257_100032392 328
123 3300031911 Ga0307412_10096394 Ga0307412_100963943 328
124 3300037466 Ga0395898_0159932 Ga0395898_0159932_557_1549 328
125 3300038443 Ga0395901_0374006 Ga0395901_0374006_103_1095 328
126 3300041486 Ga0451807_2621016 Ga0451807_2621016_427_1416 328
127 3300046660 Ga0495625_0000751 Ga0495625_0000751_27135_28121 328
128 3300047472 Ga0495686_0000164 Ga0495686_0000164_55881_56870 328
129 3300048923 Ga0496120_0166115 Ga0496120_0166115_58_1047 328
130 iso_pu_bacteria 2857576091 2857576760 328
131 3300005364 Ga0070673_100010949 Ga0070673_1000109492 329
132 3300006051 Ga0075364_10023205 Ga0075364_100232054 329
133 3300025960 Ga0207651_10000189 Ga0207651_1000018918 329
134 3300028380 Ga0268265_10237620 Ga0268265_102376202 329
135 3300048927 Ga0496124_0000458 Ga0496124_0000458_4847_5839 329
136 3300048928 Ga0496125_0022777 Ga0496125_0022777_2067_3059 329
137 3300053151 Ga0500604_0004420 Ga0500604_0004420_2582_3580 329
138 3300009148 Ga0105243_10259795 Ga0105243_102597952 330
139 3300025903 Ga0207680_10251035 Ga0207680_102510352 330
140 3300025906 Ga0207699_10102334 Ga0207699_101023342 330
141 3300026035 Ga0207703_10025810 Ga0207703_100258106 330
142 iso_pu_bacteria 2513237087 2513589563 330
143 iso_pu_bacteria 2643221605 2644040630 330
144 iso_pu_bacteria 2808606401 2809064312 330
145 iso_pu_bacteria 2808606404 2809080280 330
146 iso_pu_bacteria 2808606405 2809084644 330
147 iso_pu_bacteria 2818991436 2819542034 330
148 iso_pu_bacteria 2880518877 2880522119 330
149 3300005458 Ga0070681_10114160 Ga0070681_101141602 331
150 3300006846 Ga0075430_100135925 Ga0075430_1001359252 331
151 3300006847 Ga0075431_100119732 Ga0075431_1001197323 331
152 3300006880 Ga0075429_100099539 Ga0075429_1000995392 331
153 3300021384 Ga0213876_10000426 Ga0213876_1000042626 331
154 3300021388 Ga0213875_10098224 Ga0213875_100982242 331
155 3300037853 Ga0436364_0616084 Ga0436364_0616084_1912_2910 331
156 3300039437 Ga0436365_0245367 Ga0436365_0245367_31861_32859 331
157 3300039450 Ga0436363_1707107 Ga0436363_1707107_1472_2470 331
158 iso_pu_bacteria 2852677369 2852678094 331
159 iso_pu_bacteria 2919709256 2919712231 331
160 iso_pu_bacteria 8054563764 8054568930 331
161 3300001990 JGI24737J22298_10006592 JGI24737J22298_100065922 332
162 3300005617 Ga0068859_100083309 Ga0068859_1000833092 332
163 3300005843 Ga0068860_100180705 Ga0068860_1001807052 332
164 3300006931 Ga0097620_100083309 Ga0097620_1000833092 332
165 3300025256 Ga0209759_1006849 Ga0209759_10068493 332
166 3300028666 Ga0265336_10000028 Ga0265336_10000028151 332
167 3300029957 Ga0265324_10003212 Ga0265324_100032125 332
168 3300044735 Ga0466968_0019104 Ga0466968_0019104_1109_2110 332
169 3300046460 Ga0495638_0087707 Ga0495638_0087707_580_1578 332
170 3300046506 Ga0495583_0000276 Ga0495583_0000276_46839_47855 332
171 3300046660 Ga0495625_0002958 Ga0495625_0002958_325_1341 332
172 3300046665 Ga0495661_0000284 Ga0495661_0000284_55719_56720 332
173 3300046684 Ga0495669_0061680 Ga0495669_0061680_480_1496 332
174 3300046694 Ga0495649_0005498 Ga0495649_0005498_2748_3764 332
175 3300046794 Ga0495589_0004605 Ga0495589_0004605_3715_4731 332
176 3300047323 Ga0495683_0022396 Ga0495683_0022396_360_1376 332
177 3300048905 Ga0496102_0341784 Ga0496102_0341784_90_1097 332
178 3300048921 Ga0496118_0011548 Ga0496118_0011548_842_1849 332
179 3300049571 Ga0501034_0094384 Ga0501034_0094384_1541_2542 332
180 3300049823 Ga0501044_0153294 Ga0501044_0153294_228_1229 332
181 iso_pu_bacteria 2738541281 2738747257 332
182 iso_pu_bacteria 2738543032 2739356486 332
183 3300005289 Ga0065704_10002858 Ga0065704_100028584 333
184 3300005353 Ga0070669_100088659 Ga0070669_1000886591 333
185 3300005353 Ga0070669_100242954 Ga0070669_1002429542 333
186 3300005355 Ga0070671_100068643 Ga0070671_1000686432 333
187 3300005618 Ga0068864_100029288 Ga0068864_1000292884 333
188 3300009551 Ga0105238_10208247 Ga0105238_102082472 333
189 3300009978 Ga0105148_100291 Ga0105148_1002913 333
190 3300014326 Ga0157380_10012505 Ga0157380_100125054 333
191 3300025913 Ga0207695_10006617 Ga0207695_1000661715 333
192 3300025923 Ga0207681_10013617 Ga0207681_100136173 333
193 3300025925 Ga0207650_10030393 Ga0207650_100303934 333
194 3300025931 Ga0207644_10265678 Ga0207644_102656782 333
195 3300044712 Ga0453684_0123452 Ga0453684_0123452_1818_2852 333
196 3300048905 Ga0496102_0092039 Ga0496102_0092039_1222_2223 333
197 3300048912 Ga0496109_0105581 Ga0496109_0105581_43_1044 333
198 3300048916 Ga0496113_0052840 Ga0496113_0052840_197_1198 333
199 3300048924 Ga0496121_0000293 Ga0496121_0000293_35049_36053 333
200 3300048928 Ga0496125_0044095 Ga0496125_0044095_1788_2789 333
201 3300049663 Ga0501223_000021 Ga0501223_000021_53747_54748 333
202 3300049705 Ga0501225_0000011 Ga0501225_0000011_53752_54753 333
203 3300049705 Ga0501225_0001072 Ga0501225_0001072_6882_7883 333
204 3300053136 Ga0500559_0010851 Ga0500559_0010851_1456_2460 333
205 iso_pu_bacteria 2643221693 2644520062 333
206 iso_pu_bacteria 2828305725 2828309713 333
207 3300003214 JGI25165J46597_1000373 JGI25165J46597_100037345 334
208 3300003751 Ga0055538_1000144 Ga0055538_100014445 334
209 3300003752 Ga0055539_1000195 Ga0055539_100019513 334
210 3300003756 Ga0055533_1000196 Ga0055533_100019645 334
211 3300003759 Ga0055525_1000263 Ga0055525_100026345 334
212 3300003841 Ga0055541_1000128 Ga0055541_100012813 334
213 3300005539 Ga0068853_100017446 Ga0068853_1000174462 334
214 3300005577 Ga0068857_100052595 Ga0068857_1000525952 334
215 3300005614 Ga0068856_100176121 Ga0068856_1001761212 334
216 3300005834 Ga0068851_10077548 Ga0068851_100775482 334
217 3300006051 Ga0075364_10002199 Ga0075364_100021994 334
218 3300009093 Ga0105240_10003721 Ga0105240_1000372115 334
219 3300009551 Ga0105238_10618100 Ga0105238_106181001 334
220 3300015265 Ga0182005_1004946 Ga0182005_10049465 334
221 3300025224 Ga0209784_100010 Ga0209784_10001045 334
222 3300025225 Ga0209566_100008 Ga0209566_10000845 334
223 3300025226 Ga0209674_100019 Ga0209674_10001945 334
224 3300025230 Ga0209563_100021 Ga0209563_10002145 334
225 3300025231 Ga0207427_102342 Ga0207427_1023423 334
226 3300025233 Ga0209437_100019 Ga0209437_10001945 334
227 3300025253 Ga0209677_100011 Ga0209677_10001145 334
228 3300025261 Ga0209233_1000025 Ga0209233_100002545 334
229 3300025913 Ga0207695_10004043 Ga0207695_1000404315 334
230 3300026041 Ga0207639_10011556 Ga0207639_100115566 334
231 3300026116 Ga0207674_10080708 Ga0207674_100807085 334
232 3300030879 Ga0265765_1004811 Ga0265765_10048112 334
233 3300046462 Ga0495651_0089742 Ga0495651_0089742_633_1640 334
234 3300046463 Ga0495653_0008157 Ga0495653_0008157_4798_5805 334
235 3300046511 Ga0495608_0007994 Ga0495608_0007994_4071_5078 334
236 3300046514 Ga0495618_0037908 Ga0495618_0037908_319_1326 334
237 3300046516 Ga0495628_0063264 Ga0495628_0063264_889_1896 334
238 3300046543 Ga0495645_0156512 Ga0495645_0156512_358_1365 334
239 3300046648 Ga0495611_0098993 Ga0495611_0098993_188_1195 334
240 3300046663 Ga0495635_0201640 Ga0495635_0201640_102_1109 334
241 3300046678 Ga0495599_0043117 Ga0495599_0043117_1116_2123 334
242 3300046680 Ga0495646_0010736 Ga0495646_0010736_811_1818 334
243 3300046690 Ga0495624_0031206 Ga0495624_0031206_1641_2648 334
244 3300046809 Ga0495600_0008875 Ga0495600_0008875_5022_6029 334
245 3300047317 Ga0495604_0101360 Ga0495604_0101360_867_1874 334
246 3300047472 Ga0495686_0074650 Ga0495686_0074650_212_1219 334
247 3300049588 Ga0501072_0195718 Ga0501072_0195718_189_1196 334
248 3300049824 Ga0501045_0221420 Ga0501045_0221420_295_1302 334
249 3300050491 nmdc:mga00v17_5679_c1 nmdc:mga00v17_5679_c1_5151_6275 334
250 3300053077 Ga0495601_0135964 Ga0495601_0135964_355_1362 334
251 3300053119 Ga0500595_001521 Ga0500595_001521_5295_6302 334
252 3300053121 Ga0500607_105110 Ga0500607_105110_56_1063 334
253 3300053136 Ga0500559_0018683 Ga0500559_0018683_551_1558 334
254 3300053141 Ga0500574_005208 Ga0500574_005208_417_1424 334
255 3300053154 Ga0500619_000818 Ga0500619_000818_2459_3466 334
256 iso_pu_bacteria 2775507255 2778124737 334
257 3300009177 Ga0105248_10064034 Ga0105248_100640343 335
258 3300025941 Ga0207711_10037844 Ga0207711_100378443 335
259 3300045976 Ga0466967_0063054 Ga0466967_0063054_20_1045 335
260 3300046457 Ga0495590_0048525 Ga0495590_0048525_305_1315 335
261 3300046501 Ga0495607_0000021 Ga0495607_0000021_150513_151547 335
262 3300053148 Ga0500590_011772 Ga0500590_011772_3342_4352 335
263 3300053177 Ga0500636_0038289 Ga0500636_0038289_1434_2441 335
264 3300005289 Ga0065704_10116104 Ga0065704_101161043 336
265 3300005331 Ga0070670_100000209 Ga0070670_10000020927 336
266 3300005356 Ga0070674_100012678 Ga0070674_1000126782 336
267 3300005367 Ga0070667_100000127 Ga0070667_1000001277 336
268 3300005618 Ga0068864_100000062 Ga0068864_10000006229 336
269 3300005841 Ga0068863_100000064 Ga0068863_100000064106 336
270 3300005844 Ga0068862_100000079 Ga0068862_10000007995 336
271 3300005844 Ga0068862_100001663 Ga0068862_10000166314 336
272 3300006353 Ga0075370_10066739 Ga0075370_100667392 336
273 3300009011 Ga0105251_10003959 Ga0105251_100039598 336
274 3300009093 Ga0105240_10010397 Ga0105240_100103975 336
275 3300009101 Ga0105247_10007723 Ga0105247_100077237 336
276 3300009177 Ga0105248_10000014 Ga0105248_10000014279 336
277 3300009553 Ga0105249_10000907 Ga0105249_1000090724 336
278 3300010375 Ga0105239_10000031 Ga0105239_1000003121 336
279 3300013306 Ga0163162_10014953 Ga0163162_100149533 336
280 3300025735 Ga0207713_1024525 Ga0207713_10245254 336
281 3300025900 Ga0207710_10008534 Ga0207710_100085344 336
282 3300025925 Ga0207650_10000367 Ga0207650_1000036724 336
283 3300025941 Ga0207711_10000021 Ga0207711_1000002150 336
284 3300025961 Ga0207712_10000687 Ga0207712_1000068724 336
285 3300025972 Ga0207668_10000448 Ga0207668_1000044819 336
286 3300025986 Ga0207658_10000424 Ga0207658_1000042424 336
287 3300025986 Ga0207658_10097918 Ga0207658_100979183 336
288 3300026088 Ga0207641_10000107 Ga0207641_10000107110 336
289 3300026095 Ga0207676_10000057 Ga0207676_10000057110 336
290 3300028380 Ga0268265_10000080 Ga0268265_10000080110 336
291 3300028380 Ga0268265_10004207 Ga0268265_1000420711 336
292 3300048920 Ga0496117_0002505 Ga0496117_0002505_10655_11668 336
293 3300048920 Ga0496117_0008867 Ga0496117_0008867_6184_7197 336
294 3300048920 Ga0496117_0039058 Ga0496117_0039058_2112_3125 336
295 3300048921 Ga0496118_0000253 Ga0496118_0000253_39758_40771 336
296 3300048921 Ga0496118_0000597 Ga0496118_0000597_7288_8301 336
297 3300048924 Ga0496121_0000017 Ga0496121_0000017_91743_92783 336
298 3300048924 Ga0496121_0037747 Ga0496121_0037747_2536_3549 336
299 3300048924 Ga0496121_0056968 Ga0496121_0056968_2205_3218 336
300 3300048925 Ga0496122_0171879 Ga0496122_0171879_99_1112 336
301 3300048927 Ga0496124_0007043 Ga0496124_0007043_10786_11799 336
302 3300053087 Ga0500643_005656 Ga0500643_005656_334_1347 336
303 3300005335 Ga0070666_10180823 Ga0070666_101808232 337
304 3300005340 Ga0070689_100118674 Ga0070689_1001186743 337
305 3300005367 Ga0070667_100000174 Ga0070667_10000017441 337
306 3300005563 Ga0068855_100154177 Ga0068855_1001541771 337
307 3300005564 Ga0070664_100050610 Ga0070664_1000506102 337
308 3300005841 Ga0068863_100007816 Ga0068863_1000078167 337
309 3300005843 Ga0068860_100000125 Ga0068860_10000012553 337
310 3300025229 Ga0209147_100678 Ga0209147_1006786 337
311 3300025903 Ga0207680_10163172 Ga0207680_101631722 337
312 3300025936 Ga0207670_10095661 Ga0207670_100956613 337
313 3300025944 Ga0207661_10073470 Ga0207661_100734701 337
314 3300025949 Ga0207667_10125398 Ga0207667_101253983 337
315 3300025986 Ga0207658_10000122 Ga0207658_100001222 337
316 3300026088 Ga0207641_10000956 Ga0207641_100009569 337
317 3300028379 Ga0268266_10012111 Ga0268266_100121113 337
318 3300028381 Ga0268264_10000166 Ga0268264_1000016674 337
319 3300031995 Ga0307409_100140181 Ga0307409_1001401813 337
320 3300045049 Ga0466959_0149633 Ga0466959_0149633_556_1584 337
321 3300046452 Ga0495617_012675 Ga0495617_012675_605_1618 337
322 3300046453 Ga0495627_000431 Ga0495627_000431_19004_20017 337
323 3300046453 Ga0495627_001658 Ga0495627_001658_3904_4917 337
324 3300046491 Ga0495584_0077553 Ga0495584_0077553_450_1463 337
325 3300046501 Ga0495607_0011163 Ga0495607_0011163_1339_2364 337
326 3300046512 Ga0495610_0000068 Ga0495610_0000068_57667_58680 337
327 3300046519 Ga0495632_0000007 Ga0495632_0000007_77466_78479 337
328 3300046520 Ga0495637_0000791 Ga0495637_0000791_19915_20928 337
329 3300046522 Ga0495643_0000005 Ga0495643_0000005_88942_89955 337
330 3300046524 Ga0495648_0005531 Ga0495648_0005531_6219_7232 337
331 3300046525 Ga0495663_0000005 Ga0495663_0000005_76485_77498 337
332 3300046558 Ga0495633_0000256 Ga0495633_0000256_14039_15052 337
333 3300046558 Ga0495633_0000766 Ga0495633_0000766_14026_15039 337
334 3300046558 Ga0495633_0012426 Ga0495633_0012426_1588_2601 337
335 3300046692 Ga0495671_0000007 Ga0495671_0000007_88942_89955 337
336 3300047470 Ga0495681_0000055 Ga0495681_0000055_85067_86080 337
337 3300047470 Ga0495681_0002657 Ga0495681_0002657_2863_3876 337
338 3300047472 Ga0495686_0036460 Ga0495686_0036460_1978_2991 337
339 3300049591 Ga0501075_0065423 Ga0501075_0065423_376_1395 337
340 3300049743 Ga0501081_0114632 Ga0501081_0114632_492_1511 337
341 3300054114 Ga0501084_0142140 Ga0501084_0142140_905_1924 337
342 3300060353 Ga0501082_0144840 Ga0501082_0144840_837_1856 337
343 3300005329 Ga0070683_100049688 Ga0070683_1000496882 338
344 3300005535 Ga0070684_100000769 Ga0070684_1000007697 338
345 3300005563 Ga0068855_100018266 Ga0068855_1000182665 338
346 3300025981 Ga0207640_10085938 Ga0207640_100859382 338
347 3300048924 Ga0496121_0053446 Ga0496121_0053446_421_1437 338
348 3300048925 Ga0496122_0006942 Ga0496122_0006942_2712_3728 338
349 3300048927 Ga0496124_0020337 Ga0496124_0020337_974_1990 338
350 3300048929 Ga0496126_0194511 Ga0496126_0194511_529_1545 338
351 3300009148 Ga0105243_10178239 Ga0105243_101782392 339
352 3300001915 JGI24741J21665_1000173 JGI24741J21665_10001737 341
353 3300001979 JGI24740J21852_10026576 JGI24740J21852_100265762 341
354 3300001989 JGI24739J22299_10000501 JGI24739J22299_100005018 341
355 3300002067 JGI24735J21928_10013641 JGI24735J21928_100136413 341
356 3300002075 JGI24738J21930_10000823 JGI24738J21930_100008237 341
357 3300005366 Ga0070659_100032876 Ga0070659_1000328762 341
358 3300005455 Ga0070663_100000434 Ga0070663_10000043417 341
359 3300005563 Ga0068855_100298539 Ga0068855_1002985392 341
360 3300005614 Ga0068856_100015610 Ga0068856_1000156103 341
361 3300005834 Ga0068851_10051788 Ga0068851_100517882 341
362 3300009174 Ga0105241_10019325 Ga0105241_100193252 341
363 3300009545 Ga0105237_10267976 Ga0105237_102679762 341
364 3300010375 Ga0105239_10615782 Ga0105239_106157821 341
365 3300014325 Ga0163163_10053916 Ga0163163_100539162 341
366 3300025904 Ga0207647_10040595 Ga0207647_100405951 341
367 3300025911 Ga0207654_10014003 Ga0207654_100140032 341
368 3300025919 Ga0207657_10022904 Ga0207657_100229046 341
369 3300026041 Ga0207639_10001222 Ga0207639_100012229 341
370 3300026067 Ga0207678_10000584 Ga0207678_1000058412 341
371 3300031731 Ga0307405_10006287 Ga0307405_100062873 341
372 3300045051 Ga0451576_0002071 Ga0451576_0002071_29205_30263 341
373 3300048929 Ga0496126_0018009 Ga0496126_0018009_549_1577 342
374 2162886007 SwRhRL2b_contig_2129276 SwRhRL2b_0607.00000790 345
375 3300005289 Ga0065704_10002149 Ga0065704_100021496 345
376 3300005353 Ga0070669_100066733 Ga0070669_1000667331 345
377 3300048911 Ga0496108_0001299 Ga0496108_0001299_5796_6833 345
378 3300048924 Ga0496121_0002582 Ga0496121_0002582_12843_13880 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

47

346

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8984 5 329
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8892 1 329
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8838 5 329
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8776 5 329
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8763 1 329
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9727 1 327 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9669 1 327 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9573 4 328 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9432 4 328 3.20.20.30
4us5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9306 5 329 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A418ZSE9-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9937 6 78 GO:0005829
GO:0016705
AF-A0A4Q2YTM3-F1-model_v4 Alkane 1-monooxygenase 0.9919 216 330 GO:0004497
GO:0005829
GO:0016705
AF-A0A534XP08-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9916 4 97 GO:0005829
GO:0016705
AF-A0A379W1Y8-F1-model_v4 Monooxygenase 0.9897 6 77 GO:0004497
GO:0005829
GO:0016020
GO:0016705
AF-A0A3S1Z7A8-F1-model_v4 MsnO8 family LLM class oxidoreductase (EC 1.-.-.-) 0.9893 4 145 GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
91.41 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map