F427322

General Info

Members Datasets Scaffolds Average Seq Length
376 270 291 184

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10084364|Ga0105244_100843642
Length 209
Sequence MNKHLPDTLHIHSQYEEMMLTAKRRDVMKVLPLFMDGAAILEPKVYGDHRGYFMESYNEQVLHEQGIQHVFIQDNQSLSAEAGVLRGLHYQLQPKAQTKLVRVISGAIYDVIVDVRTSSPTFGQWKSVILSEYNQRQLLVPQGFAHGFCTLVPHSQVTYKVDAYYSPEHDRGILWNDPALAIDWPVTKPILSEKDQKHPLLKDAELNFD

Samples

Sample ID Description Type Environment
1 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
2 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
3 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
4 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
5 2643221729 Bacillus sp. Root11 Isolate Unclassified
6 2643221730 Bacillus sp. Root131 Isolate Unclassified
7 2684622632 Bacillus cereus 905 Isolate Unclassified
8 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
9 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
10 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
11 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
12 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
13 2738541358 Bacillus sp. OV752 Isolate Unclassified
14 2738543006 Bacillus sp. OK077 Isolate Unclassified
15 2738543024 Aminobacter sp. AP02 Isolate Unclassified
16 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
17 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
18 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
19 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
20 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
21 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
22 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
23 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
24 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
25 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
26 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
27 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
28 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
29 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
30 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
31 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
32 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
33 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
34 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
35 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
36 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
37 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
38 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
39 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
40 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
41 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
42 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
43 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
44 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
45 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
46 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
47 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
48 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
49 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
50 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
51 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
52 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
53 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
54 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
55 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
56 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
57 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
58 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
59 2938917290 Bacillus sp. CR71 Isolate Unclassified
60 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
61 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
62 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
63 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
64 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
65 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
66 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
67 2965761152 Bacillus sp. COPE52 Isolate Unclassified
68 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
69 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
70 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
71 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
72 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
73 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
74 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
75 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
76 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
77 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
78 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
79 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
80 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
81 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
86 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
87 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
88 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
94 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
98 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
99 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
100 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
101 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
102 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
109 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
110 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
111 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
112 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
113 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
114 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
121 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
136 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
148 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
151 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
154 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
210 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
252 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
253 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
260 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
261 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
264 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
265 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
266 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
267 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
268 8023444577 Bacillus sp. BH32 Isolate Unclassified
269 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
270 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 76.06
Metatranscriptomes 1.33
Isolates 22.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.32
Nodule 12.5
Rhizoplane 0.8
Rhizosphere 61.97
Stem 0
Stem Tuber 0
Unclassified 19.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10002901 3300002067 Bacteria 5905
2 JGI24735J21928_10144681 3300002067 Bacteria 686
3 JGI25157J39369_1001893 3300002741 Bacteria 6404
4 rootL2_10053563 3300003322 Bacteria 8294
5 rootH1_10271230 3300003323 Bacteria 2906
6 JGI25160J50197_1031623 3300003354 Bacteria 1359
7 Ga0055538_1000329 3300003751 Bacteria 21780
8 Ga0070658_10000002 3300005327 Bacteria 637290
9 Ga0070658_10003417 3300005327 Bacteria 13066
10 Ga0070683_100131466 3300005329 Bacteria 2369
11 Ga0070690_100125879 3300005330 Bacteria 1725
12 Ga0070690_100586806 3300005330 Bacteria 844
13 Ga0068869_100065015 3300005334 Bacteria 2684
14 Ga0068869_100785027 3300005334 Bacteria 818
15 Ga0070680_100000186 3300005336 Bacteria 40260
16 Ga0070680_100906565 3300005336 Bacteria 761
17 Ga0070682_100106728 3300005337 Bacteria 1859
18 Ga0070682_100475801 3300005337 Bacteria 962
19 Ga0068868_100082970 3300005338 Bacteria 2572
20 Ga0068868_100576390 3300005338 Bacteria 994
21 Ga0070660_100046753 3300005339 Bacteria 3318
22 Ga0070660_100058445 3300005339 Bacteria 2989
23 Ga0070660_100274062 3300005339 Bacteria 1380
24 Ga0070689_100258007 3300005340 Bacteria 1440
25 Ga0070689_100463037 3300005340 Bacteria 1081
26 Ga0070661_100000003 3300005344 Bacteria 254653
27 Ga0070692_10003609 3300005345 Bacteria 6311
28 Ga0070692_10126072 3300005345 Bacteria 1434
29 Ga0070671_100131635 3300005355 Bacteria 2107
30 Ga0070671_100357278 3300005355 Bacteria 1247
31 Ga0070659_100001760 3300005366 Bacteria 15568
32 Ga0070659_100319764 3300005366 Bacteria 1297
33 Ga0070705_100460625 3300005440 Bacteria 956
34 Ga0070705_101105408 3300005440 Bacteria 649
35 Ga0070694_100054059 3300005444 Bacteria 2719
36 Ga0070698_100015333 3300005471 Bacteria 8099
37 Ga0070679_100000001 3300005530 Bacteria 764811
38 Ga0070679_100606780 3300005530 Bacteria 1037
39 Ga0070697_100746160 3300005536 Bacteria 865
40 Ga0068853_100374984 3300005539 Bacteria 1328
41 Ga0070686_100241859 3300005544 Bacteria 1314
42 Ga0070696_100196845 3300005546 Bacteria 1502
43 Ga0070693_100059889 3300005547 Bacteria 2209
44 Ga0068855_100880359 3300005563 Bacteria 947
45 Ga0068857_100108436 3300005577 Bacteria 2495
46 Ga0070702_100629397 3300005615 Bacteria 808
47 Ga0068852_100003115 3300005616 Bacteria 11550
48 Ga0068859_100152687 3300005617 Bacteria 2385
49 Ga0068859_101513954 3300005617 Bacteria 740
50 Ga0068864_100359305 3300005618 Bacteria 1376
51 Ga0068861_100136074 3300005719 Bacteria 1999
52 Ga0068870_10153166 3300005840 Bacteria 1360
53 Ga0068863_100004607 3300005841 Bacteria 13580
54 Ga0068858_100495920 3300005842 Bacteria 1179
55 Ga0068860_100001647 3300005843 Bacteria 23884
56 Ga0068862_100000032 3300005844 Bacteria 179887
57 Ga0068862_100057351 3300005844 Bacteria 3340
58 Ga0068862_100360726 3300005844 Bacteria 1350
59 Ga0068862_100361135 3300005844 Bacteria 1350
60 Ga0081455_10097959 3300005937 Bacteria 2362
61 Ga0081455_10209016 3300005937 Bacteria 1455
62 Ga0068871_100933349 3300006358 Bacteria 806
63 Ga0075433_10028145 3300006852 Bacteria 4776
64 Ga0075434_100001167 3300006871 Bacteria 21754
65 Ga0075436_100114349 3300006914 Bacteria 1884
66 Ga0097620_100152687 3300006931 Bacteria 2385
67 Ga0097620_101513934 3300006931 Bacteria 740
68 Ga0075435_100013421 3300007076 Bacteria 6095
69 Ga0099795_10003525 3300007788 Bacteria 3889
70 Ga0105244_10001504 3300009036 Bacteria 18671
71 Ga0105244_10055582 3300009036 Bacteria 2005
72 Ga0105244_10061020 3300009036 Bacteria 1899
73 Ga0105244_10084364 3300009036 Bacteria 1569
74 Ga0105250_10007553 3300009092 Bacteria 4667
75 Ga0105250_10119365 3300009092 Bacteria 1083
76 Ga0105250_10124223 3300009092 Bacteria 1062
77 Ga0105240_10103281 3300009093 Bacteria 3463
78 Ga0105240_10143330 3300009093 Bacteria 2854
79 Ga0105240_10349723 3300009093 Bacteria 1677
80 Ga0105240_10645208 3300009093 Bacteria 1161
81 Ga0105240_10686217 3300009093 Bacteria 1119
82 Ga0105245_10385403 3300009098 Bacteria 1397
83 Ga0105241_10435409 3300009174 Bacteria 1157
84 Ga0105241_10456496 3300009174 Bacteria 1131
85 Ga0105241_10457131 3300009174 Bacteria 1130
86 Ga0105242_10545094 3300009176 Bacteria 1111
87 Ga0105248_10523622 3300009177 Bacteria 1337
88 Ga0105237_10000794 3300009545 Bacteria 43200
89 Ga0105238_10642513 3300009551 Bacteria 1071
90 Ga0105238_11736078 3300009551 Unclassified 656
91 Ga0105249_10000017 3300009553 Bacteria 277115
92 Ga0105249_10588348 3300009553 Bacteria 1166
93 Ga0099796_10002352 3300010159 Bacteria 4133
94 Ga0105239_10000049 3300010375 Bacteria 177578
95 Ga0105239_10000086 3300010375 Bacteria 129798
96 Ga0105246_10001767 3300011119 Bacteria 12932
97 Ga0105246_10364407 3300011119 Bacteria 1189
98 Ga0157373_10002483 3300013100 Bacteria 14049
99 Ga0157371_10000980 3300013102 Bacteria 31717
100 Ga0157371_10522105 3300013102 Unclassified 878
101 Ga0157370_10041395 3300013104 Bacteria 4445
102 Ga0157370_10368466 3300013104 Bacteria 1324
103 Ga0157369_10028064 3300013105 Bacteria 6233
104 Ga0157369_10128823 3300013105 Bacteria 2682
105 Ga0157369_10141021 3300013105 Bacteria 2550
106 Ga0157369_10376539 3300013105 Bacteria 1474
107 Ga0157378_10544881 3300013297 Bacteria 1165
108 Ga0157372_10008722 3300013307 Bacteria 10768
109 Ga0157372_10201979 3300013307 Bacteria 2302
110 Ga0157372_10792177 3300013307 Bacteria 1101
111 Ga0157372_10976978 3300013307 Bacteria 981
112 Ga0157380_10207969 3300014326 Bacteria 1742
113 Ga0182008_10545793 3300014497 Bacteria 643
114 Ga0157376_10148620 3300014969 Bacteria 2111
115 Ga0206354_11418104 3300020081 Bacteria 10198
116 Ga0206353_11308154 3300020082 Bacteria 21393
117 Ga0213873_10000016 3300021358 Bacteria 124829
118 Ga0213874_10007705 3300021377 Bacteria 2595
119 Ga0213874_10038581 3300021377 Bacteria 1418
120 Ga0213876_10000056 3300021384 Bacteria 135017
121 Ga0213876_10000454 3300021384 Bacteria 32974
122 Ga0213876_10001776 3300021384 Bacteria 13065
123 Ga0213876_10008149 3300021384 Bacteria 5677
124 Ga0213875_10003597 3300021388 Bacteria 8774
125 Ga0213875_10018154 3300021388 Bacteria 3393
126 Ga0209784_100038 3300025224 Bacteria 253212
127 Ga0209147_104011 3300025229 Bacteria 2596
128 Ga0209646_1030990 3300025246 Bacteria 719
129 Ga0209026_1000005 3300025250 Bacteria 731387
130 Ga0209759_1000106 3300025256 Bacteria 149959
131 Ga0209759_1050898 3300025256 Bacteria 639
132 Ga0209233_1000068 3300025261 Bacteria 377969
133 Ga0209233_1000520 3300025261 Bacteria 22249
134 Ga0209130_1000537 3300025284 Bacteria 38152
135 Ga0209130_1000852 3300025284 Bacteria 25237
136 Ga0209130_1005441 3300025284 Bacteria 4410
137 Ga0209675_1023884 3300025291 Bacteria 1572
138 Ga0209025_1000053 3300025294 Bacteria 317600
139 Ga0209025_1000482 3300025294 Bacteria 77307
140 Ga0209025_1005261 3300025294 Bacteria 10649
141 Ga0209025_1005317 3300025294 Bacteria 10572
142 Ga0209025_1012823 3300025294 Bacteria 5332
143 Ga0209025_1065500 3300025294 Bacteria 1326
144 Ga0209758_1000847 3300025297 Bacteria 42599
145 Ga0207426_1000196 3300025302 Bacteria 146687
146 Ga0207696_1001998 3300025711 Bacteria 10334
147 Ga0207655_1001723 3300025728 Bacteria 19216
148 Ga0207655_1039754 3300025728 Bacteria 2038
149 Ga0207655_1045587 3300025728 Bacteria 1829
150 Ga0207655_1108174 3300025728 Bacteria 944
151 Ga0207647_10000588 3300025904 Bacteria 28282
152 Ga0207643_10155796 3300025908 Bacteria 1372
153 Ga0207705_10000005 3300025909 Bacteria 673478
154 Ga0207705_10009851 3300025909 Bacteria 6956
155 Ga0207654_10342214 3300025911 Bacteria 1028
156 Ga0207707_10049504 3300025912 Bacteria 3661
157 Ga0207707_10248983 3300025912 Bacteria 1544
158 Ga0207695_10046308 3300025913 Bacteria 4611
159 Ga0207695_10299361 3300025913 Bacteria 1500
160 Ga0207695_10395166 3300025913 Bacteria 1267
161 Ga0207671_10000888 3300025914 Bacteria 37881
162 Ga0207671_10039289 3300025914 Bacteria 3505
163 Ga0207660_10001348 3300025917 Bacteria 16452
164 Ga0207660_10590285 3300025917 Bacteria 904
165 Ga0207662_10044348 3300025918 Bacteria 2626
166 Ga0207657_10000749 3300025919 Bacteria 34403
167 Ga0207657_10047960 3300025919 Bacteria 3731
168 Ga0207657_10145586 3300025919 Bacteria 1933
169 Ga0207657_10522595 3300025919 Bacteria 929
170 Ga0207649_10000027 3300025920 Bacteria 161926
171 Ga0207652_10000003 3300025921 Bacteria 502441
172 Ga0207652_10581393 3300025921 Bacteria 1005
173 Ga0207694_10185688 3300025924 Bacteria 1687
174 Ga0207687_10307152 3300025927 Unclassified 1279
175 Ga0207644_10286276 3300025931 Bacteria 1324
176 Ga0207690_10012764 3300025932 Bacteria 5034
177 Ga0207690_10039934 3300025932 Bacteria 3065
178 Ga0207686_10263509 3300025934 Bacteria 1265
179 Ga0207670_11008689 3300025936 Bacteria 700
180 Ga0207689_10002484 3300025942 Bacteria 17129
181 Ga0207712_10000012 3300025961 Bacteria 392363
182 Ga0207640_10039330 3300025981 Bacteria 2993
183 Ga0207640_10457583 3300025981 Bacteria 1053
184 Ga0207639_10054194 3300026041 Bacteria 3064
185 Ga0207639_10066396 3300026041 Bacteria 2804
186 Ga0207641_10002117 3300026088 Bacteria 18786
187 Ga0207648_10083137 3300026089 Bacteria 2792
188 Ga0207674_10107524 3300026116 Bacteria 2766
189 Ga0207674_10264671 3300026116 Bacteria 1667
190 Ga0207675_100002969 3300026118 Bacteria 16692
191 Ga0207698_10006046 3300026142 Bacteria 7525
192 Ga0268265_10000081 3300028380 Bacteria 120869
193 Ga0268264_10003030 3300028381 Bacteria 14572
194 Ga0237817_10007 3300030083 Bacteria 89937
195 Ga0237817_10107 3300030083 Bacteria 25720
196 Ga0265327_10027576 3300031251 Bacteria 3266
197 Ga0307412_10000458 3300031911 Bacteria 24608
198 Ga0307416_100168984 3300032002 Bacteria 2033
199 Ga0316593_10160980 3300032168 Unclassified 820
200 Ga0373931_0051819 3300035691 Bacteria 2187
201 Ga0373931_0344177 3300035691 Bacteria 932
202 Ga0373947_0043470 3300035725 Bacteria 2684
203 Ga0373947_0053966 3300035725 Bacteria 2425
204 Ga0316582_0120729 3300036647 Bacteria 1753
205 Ga0395899_0307638 3300037312 Bacteria 1071
206 Ga0395900_0120776 3300037418 Bacteria 2688
207 Ga0395900_0252161 3300037418 Bacteria 1766
208 Ga0395900_1095705 3300037418 Bacteria 714
209 Ga0395905_0036556 3300037471 Bacteria 4612
210 Ga0395905_0480246 3300037471 Bacteria 1142
211 Ga0436364_0308817 3300037853 Bacteria 21693
212 Ga0436364_1356743 3300037853 Bacteria 3517
213 Ga0395901_0082499 3300038443 Bacteria 3359
214 Ga0395901_0448286 3300038443 Bacteria 1320
215 Ga0395901_0676347 3300038443 Bacteria 1032
216 Ga0237819_00097 3300038705 Bacteria 32482
217 Ga0237819_00453 3300038705 Bacteria 13980
218 Ga0237819_17254 3300038705 Bacteria 798
219 Ga0400483_040873 3300039062 Bacteria 11814
220 Ga0436365_0372107 3300039437 Bacteria 45396
221 Ga0436365_0499375 3300039437 Bacteria 98723
222 Ga0436365_0594533 3300039437 Bacteria 37835
223 Ga0436365_1335293 3300039437 Bacteria 1924
224 Ga0436365_1455305 3300039437 Bacteria 24185
225 Ga0436360_0072862 3300039438 Unclassified 872
226 Ga0436361_0003380 3300039447 Bacteria 992
227 Ga0436363_0381103 3300039450 Bacteria 771
228 Ga0436363_0720333 3300039450 Bacteria 51178
229 Ga0436363_1310672 3300039450 Bacteria 10749
230 Ga0436362_0580304 3300039453 Bacteria 124869
231 Ga0436362_0608143 3300039453 Bacteria 11435
232 Ga0436362_0620166 3300039453 Bacteria 873
233 Ga0439449_0128282 3300042007 Bacteria 942
234 Ga0439457_034650 3300042014 Bacteria 1122
235 Ga0450904_001194 3300042139 Bacteria 3917
236 Ga0466966_0115773 3300044684 Bacteria 1650
237 Ga0453684_0257778 3300044712 Bacteria 1999
238 Ga0466970_0168548 3300044765 Bacteria 1213
239 Ga0466959_0144985 3300045049 Bacteria 1676
240 Ga0451576_0037900 3300045051 Bacteria 5104
241 Ga0451576_0046938 3300045051 Bacteria 4544
242 Ga0466967_0000084 3300045976 Bacteria 34517
243 Ga0495651_0268604 3300046462 Bacteria 1157
244 Ga0495580_0235425 3300046472 Bacteria 1256
245 Ga0495610_0001719 3300046512 Bacteria 19175
246 Ga0495628_0030511 3300046516 Bacteria 4364
247 Ga0495630_0362519 3300046517 Bacteria 1109
248 Ga0495666_0020285 3300046526 Bacteria 3294
249 Ga0495587_0125498 3300046536 Bacteria 1469
250 Ga0495657_0250514 3300046675 Bacteria 1066
251 Ga0495599_0035766 3300046678 Bacteria 3117
252 Ga0495624_0003216 3300046690 Bacteria 12171
253 Ga0495649_0083018 3300046694 Bacteria 1712
254 Ga0495604_0250172 3300047317 Bacteria 1208
255 Ga0495680_0033737 3300047322 Bacteria 4141
256 Ga0495680_0464603 3300047322 Bacteria 864
257 Ga0495675_0035257 3300047444 Bacteria 3196
258 Ga0495675_0063253 3300047444 Bacteria 2341
259 Ga0495684_0072017 3300047471 Bacteria 2626
260 Ga0495686_0000319 3300047472 Bacteria 79929
261 Ga0495686_0136389 3300047472 Bacteria 1451
262 Ga0495686_0167015 3300047472 Bacteria 1282
263 Ga0495602_0213762 3300048088 Bacteria 1461
264 Ga0496102_0573709 3300048905 Bacteria 1051
265 Ga0496115_0211245 3300048918 Bacteria 1603
266 Ga0496115_0266887 3300048918 Bacteria 1407
267 Ga0496116_0084025 3300048919 Bacteria 1962
268 Ga0496117_0358251 3300048920 Bacteria 751
269 Ga0496119_0068146 3300048922 Bacteria 2096
270 Ga0496120_0024786 3300048923 Bacteria 3734
271 Ga0496121_0114906 3300048924 Bacteria 2045
272 Ga0496121_0205006 3300048924 Bacteria 1402
273 Ga0496121_0397974 3300048924 Bacteria 903
274 Ga0496122_0082734 3300048925 Bacteria 2228
275 Ga0496124_0004774 3300048927 Bacteria 15599
276 Ga0496124_0441061 3300048927 Bacteria 891
277 Ga0496125_0054659 3300048928 Bacteria 3260
278 Ga0496126_0001365 3300048929 Bacteria 38656
279 Ga0496126_0020377 3300048929 Bacteria 6503
280 Ga0496126_0292953 3300048929 Bacteria 1345
281 Ga0496126_0365482 3300048929 Bacteria 1178
282 Ga0501337_002432 3300049553 Bacteria 1139
283 Ga0501034_0084836 3300049571 Bacteria 3169
284 nmdc:mga0n895_19507_c1 3300050512 Bacteria 6304
285 nmdc:mga0rr50_62791_c1 3300050513 Bacteria 2804
286 nmdc:mga08x19_20512_c1 3300050514 Bacteria 4069
287 nmdc:mga0a205_1660_c1 3300050515 Bacteria 19154
288 Ga0500652_000230 3300053131 Bacteria 21302
289 Ga0500568_0000005 3300053139 Bacteria 614296
290 Ga0587067_008785 3300059640 Bacteria 1487
291 Ga0466962_0329071 3300061719 Bacteria 759

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2821443989 2821445744 170
2 3300042139 Ga0450904_001194 Ga0450904_001194_1390_1932 175
3 3300005841 Ga0068863_100004607 Ga0068863_1000046078 176
4 3300005843 Ga0068860_100001647 Ga0068860_1000016474 176
5 3300005844 Ga0068862_100000032 Ga0068862_1000000329 176
6 3300009553 Ga0105249_10000017 Ga0105249_10000017263 176
7 3300014326 Ga0157380_10207969 Ga0157380_102079692 176
8 3300025961 Ga0207712_10000012 Ga0207712_1000001288 176
9 3300026088 Ga0207641_10002117 Ga0207641_100021178 176
10 3300028380 Ga0268265_10000081 Ga0268265_10000081100 176
11 3300028381 Ga0268264_10003030 Ga0268264_100030305 176
12 iso_pu_bacteria 2643221729 2644707703 176
13 iso_pu_bacteria 2643221730 2644712264 176
14 iso_pu_bacteria 2684622632 2685149140 176
15 iso_pu_bacteria 2695420987 2698324038 176
16 iso_pu_bacteria 2703719227 2705993185 176
17 iso_pu_bacteria 2718218445 2721504522 176
18 iso_pu_bacteria 2738541358 2739156531 176
19 iso_pu_bacteria 2738543006 2739210132 176
20 iso_pu_bacteria 2818991443 2819582959 176
21 iso_pu_bacteria 2929233124 2929234411 176
22 iso_pu_bacteria 2938917290 2938918593 176
23 iso_pu_bacteria 2947426588 2947427939 176
24 iso_pu_bacteria 2965761152 2965762435 176
25 iso_pu_bacteria 2979083700 2979084845 176
26 iso_pu_bacteria 8022621104 8022622357 176
27 iso_pu_bacteria 8023444577 8023449433 176
28 iso_pu_bacteria 8056533031 8056533176 176
29 3300009098 Ga0105245_10385403 Ga0105245_103854032 177
30 3300025927 Ga0207687_10307152 Ga0207687_103071522 177
31 iso_pu_bacteria 2821111986 2821118167 177
32 iso_pu_bacteria 2885526491 2885529869 177
33 iso_pu_bacteria 2888578766 2888579631 177
34 iso_pu_bacteria 2889042446 2889048060 177
35 iso_pu_bacteria 2904162308 2904168098 177
36 iso_pu_bacteria 2931384279 2931385166 177
37 iso_pu_bacteria 2600255067 2600812696 178
38 iso_pu_bacteria 2816332256 2817277832 178
39 iso_pu_bacteria 2889049205 2889051748 178
40 iso_pu_bacteria 8055301274 8055305112 178
41 iso_pu_bacteria 2513237090 2513608182 179
42 iso_pu_bacteria 2693429783 2694632542 179
43 iso_pu_bacteria 2693429784 2694639729 179
44 iso_pu_bacteria 2791355222 2793181986 179
45 iso_pu_bacteria 2841734538 2841734990 179
46 iso_pu_bacteria 2847670302 2847672054 179
47 iso_pu_bacteria 2856314179 2856318209 179
48 iso_pu_bacteria 2856364286 2856364894 179
49 iso_pu_bacteria 2869285874 2869289657 179
50 iso_pu_bacteria 2871429161 2871431723 179
51 iso_pu_bacteria 2871444079 2871445540 179
52 iso_pu_bacteria 2871474448 2871478143 179
53 iso_pu_bacteria 2874146452 2874155401 179
54 iso_pu_bacteria 2874155637 2874162258 179
55 iso_pu_bacteria 2876369609 2876377161 179
56 iso_pu_bacteria 2876392853 2876398842 179
57 iso_pu_bacteria 2876413966 2876420746 179
58 iso_pu_bacteria 2878035449 2878037521 179
59 iso_pu_bacteria 2878745973 2878748329 179
60 iso_pu_bacteria 2878788777 2878792793 179
61 iso_pu_bacteria 2881147464 2881154935 179
62 iso_pu_bacteria 2881161766 2881163055 179
63 iso_pu_bacteria 2885305155 2885311995 179
64 iso_pu_bacteria 2903492973 2903506006 179
65 iso_pu_bacteria 2904659560 2904665374 179
66 iso_pu_bacteria 2906308376 2906311946 179
67 iso_pu_bacteria 2906321335 2906323683 179
68 iso_pu_bacteria 2906328253 2906331527 179
69 iso_pu_bacteria 2906414383 2906418246 179
70 iso_pu_bacteria 2924726620 2924729783 179
71 iso_pu_bacteria 2937813078 2937818231 179
72 iso_pu_bacteria 2937836603 2937838593 179
73 iso_pu_bacteria 2937891427 2937895426 179
74 iso_pu_bacteria 2958041894 2958042702 179
75 iso_pu_bacteria 2958071322 2958074575 179
76 iso_pu_bacteria 2958130278 2958134030 179
77 iso_pu_bacteria 2958179912 2958183676 179
78 iso_pu_bacteria 2961077736 2961081642 179
79 iso_pu_bacteria 2961114664 2961120374 179
80 iso_pu_bacteria 2968091066 2968095677 179
81 iso_pu_bacteria 2968110612 2968116841 179
82 iso_pu_bacteria 2977843712 2977851327 179
83 iso_pu_bacteria 2996341866 2996348466 179
84 iso_pu_bacteria 8004387939 8004391535 179
85 iso_pu_bacteria 8004633249 8004635862 179
86 iso_pu_bacteria 8004714634 8004716904 179
87 3300003322 rootL2_10053563 rootL2_100535634 180
88 3300005330 Ga0070690_100125879 Ga0070690_1001258792 180
89 3300005334 Ga0068869_100065015 Ga0068869_1000650152 180
90 3300005334 Ga0068869_100785027 Ga0068869_1007850271 180
91 3300005336 Ga0070680_100906565 Ga0070680_1009065652 180
92 3300005337 Ga0070682_100106728 Ga0070682_1001067283 180
93 3300005338 Ga0068868_100576390 Ga0068868_1005763902 180
94 3300005340 Ga0070689_100258007 Ga0070689_1002580072 180
95 3300005340 Ga0070689_100463037 Ga0070689_1004630372 180
96 3300005345 Ga0070692_10003609 Ga0070692_100036096 180
97 3300005440 Ga0070705_100460625 Ga0070705_1004606252 180
98 3300005440 Ga0070705_101105408 Ga0070705_1011054081 180
99 3300005444 Ga0070694_100054059 Ga0070694_1000540592 180
100 3300005530 Ga0070679_100606780 Ga0070679_1006067802 180
101 3300005536 Ga0070697_100746160 Ga0070697_1007461602 180
102 3300005544 Ga0070686_100241859 Ga0070686_1002418592 180
103 3300005546 Ga0070696_100196845 Ga0070696_1001968452 180
104 3300005547 Ga0070693_100059889 Ga0070693_1000598893 180
105 3300005615 Ga0070702_100629397 Ga0070702_1006293972 180
106 3300005617 Ga0068859_100152687 Ga0068859_1001526872 180
107 3300005617 Ga0068859_101513954 Ga0068859_1015139542 180
108 3300005719 Ga0068861_100136074 Ga0068861_1001360742 180
109 3300005840 Ga0068870_10153166 Ga0068870_101531662 180
110 3300005842 Ga0068858_100495920 Ga0068858_1004959202 180
111 3300005844 Ga0068862_100360726 Ga0068862_1003607262 180
112 3300006358 Ga0068871_100933349 Ga0068871_1009333492 180
113 3300006852 Ga0075433_10028145 Ga0075433_100281455 180
114 3300006871 Ga0075434_100001167 Ga0075434_10000116721 180
115 3300006914 Ga0075436_100114349 Ga0075436_1001143492 180
116 3300006931 Ga0097620_100152687 Ga0097620_1001526872 180
117 3300006931 Ga0097620_101513934 Ga0097620_1015139342 180
118 3300007076 Ga0075435_100013421 Ga0075435_1000134215 180
119 3300009036 Ga0105244_10001504 Ga0105244_1000150417 180
120 3300009036 Ga0105244_10055582 Ga0105244_100555823 180
121 3300009036 Ga0105244_10061020 Ga0105244_100610202 180
122 3300009092 Ga0105250_10007553 Ga0105250_100075534 180
123 3300009092 Ga0105250_10119365 Ga0105250_101193652 180
124 3300009092 Ga0105250_10124223 Ga0105250_101242231 180
125 3300009174 Ga0105241_10435409 Ga0105241_104354092 180
126 3300009176 Ga0105242_10545094 Ga0105242_105450941 180
127 3300009553 Ga0105249_10588348 Ga0105249_105883482 180
128 3300011119 Ga0105246_10364407 Ga0105246_103644071 180
129 3300013105 Ga0157369_10128823 Ga0157369_101288232 180
130 3300014969 Ga0157376_10148620 Ga0157376_101486203 180
131 3300025229 Ga0209147_104011 Ga0209147_1040113 180
132 3300025256 Ga0209759_1050898 Ga0209759_10508981 180
133 3300025284 Ga0209130_1000852 Ga0209130_100085211 180
134 3300025284 Ga0209130_1005441 Ga0209130_10054413 180
135 3300025291 Ga0209675_1023884 Ga0209675_10238842 180
136 3300025294 Ga0209025_1000482 Ga0209025_100048233 180
137 3300025294 Ga0209025_1005261 Ga0209025_100526110 180
138 3300025294 Ga0209025_1005317 Ga0209025_10053173 180
139 3300025294 Ga0209025_1012823 Ga0209025_10128234 180
140 3300025294 Ga0209025_1065500 Ga0209025_10655002 180
141 3300025711 Ga0207696_1001998 Ga0207696_10019989 180
142 3300025728 Ga0207655_1001723 Ga0207655_10017237 180
143 3300025728 Ga0207655_1045587 Ga0207655_10455872 180
144 3300025728 Ga0207655_1108174 Ga0207655_11081742 180
145 3300025908 Ga0207643_10155796 Ga0207643_101557962 180
146 3300025912 Ga0207707_10248983 Ga0207707_102489832 180
147 3300025917 Ga0207660_10590285 Ga0207660_105902852 180
148 3300025918 Ga0207662_10044348 Ga0207662_100443482 180
149 3300025921 Ga0207652_10581393 Ga0207652_105813932 180
150 3300025934 Ga0207686_10263509 Ga0207686_102635092 180
151 3300025936 Ga0207670_11008689 Ga0207670_110086891 180
152 3300025942 Ga0207689_10002484 Ga0207689_1000248416 180
153 3300025981 Ga0207640_10457583 Ga0207640_104575832 180
154 3300026089 Ga0207648_10083137 Ga0207648_100831373 180
155 3300026118 Ga0207675_100002969 Ga0207675_1000029694 180
156 3300030083 Ga0237817_10007 Ga0237817_1000798 180
157 3300030083 Ga0237817_10107 Ga0237817_1010716 180
158 3300031911 Ga0307412_10000458 Ga0307412_1000045822 180
159 3300035691 Ga0373931_0051819 Ga0373931_0051819_201_746 180
160 3300035691 Ga0373931_0344177 Ga0373931_0344177_136_681 180
161 3300035725 Ga0373947_0043470 Ga0373947_0043470_1369_1914 180
162 3300035725 Ga0373947_0053966 Ga0373947_0053966_265_810 180
163 3300036647 Ga0316582_0120729 Ga0316582_0120729_15_560 180
164 3300038705 Ga0237819_00097 Ga0237819_00097_23402_23947 180
165 3300038705 Ga0237819_00453 Ga0237819_00453_10627_11172 180
166 3300038705 Ga0237819_17254 Ga0237819_17254_177_722 180
167 3300044684 Ga0466966_0115773 Ga0466966_0115773_73_624 180
168 3300045051 Ga0451576_0037900 Ga0451576_0037900_2469_3014 180
169 3300045051 Ga0451576_0046938 Ga0451576_0046938_829_1374 180
170 3300045976 Ga0466967_0000084 Ga0466967_0000084_25732_26277 180
171 3300046462 Ga0495651_0268604 Ga0495651_0268604_200_751 180
172 3300046472 Ga0495580_0235425 Ga0495580_0235425_436_981 180
173 3300046516 Ga0495628_0030511 Ga0495628_0030511_3657_4208 180
174 3300046517 Ga0495630_0362519 Ga0495630_0362519_383_934 180
175 3300046526 Ga0495666_0020285 Ga0495666_0020285_64_615 180
176 3300046536 Ga0495587_0125498 Ga0495587_0125498_110_661 180
177 3300046675 Ga0495657_0250514 Ga0495657_0250514_421_972 180
178 3300046678 Ga0495599_0035766 Ga0495599_0035766_147_698 180
179 3300046690 Ga0495624_0003216 Ga0495624_0003216_11466_12017 180
180 3300047317 Ga0495604_0250172 Ga0495604_0250172_594_1145 180
181 3300047322 Ga0495680_0033737 Ga0495680_0033737_778_1329 180
182 3300047322 Ga0495680_0464603 Ga0495680_0464603_19_570 180
183 3300047444 Ga0495675_0035257 Ga0495675_0035257_2450_3001 180
184 3300047444 Ga0495675_0063253 Ga0495675_0063253_1621_2172 180
185 3300047471 Ga0495684_0072017 Ga0495684_0072017_1481_2032 180
186 3300048088 Ga0495602_0213762 Ga0495602_0213762_337_888 180
187 3300048928 Ga0496125_0054659 Ga0496125_0054659_771_1400 180
188 3300048929 Ga0496126_0001365 Ga0496126_0001365_1496_2047 180
189 3300050512 nmdc:mga0n895_19507_c1 nmdc:mga0n895_19507_c1_1786_2331 180
190 3300050513 nmdc:mga0rr50_62791_c1 nmdc:mga0rr50_62791_c1_1171_1716 180
191 3300050514 nmdc:mga08x19_20512_c1 nmdc:mga08x19_20512_c1_267_812 180
192 3300050515 nmdc:mga0a205_1660_c1 nmdc:mga0a205_1660_c1_17844_18389 180
193 3300053139 Ga0500568_0000005 Ga0500568_0000005_425262_425813 180
194 iso_pu_bacteria 2643221564 2643839898 180
195 iso_pu_bacteria 2889010040 2889013237 180
196 iso_pu_bacteria 2968117919 2968118566 180
197 iso_pu_bacteria 2987636660 2987643452 180
198 iso_pu_bacteria 2987652177 2987652999 180
199 iso_pu_bacteria 3002141150 3002142753 180
200 iso_pu_bacteria 3004203850 3004206997 180
201 3300005471 Ga0070698_100015333 Ga0070698_1000153335 181
202 3300005844 Ga0068862_100057351 Ga0068862_1000573512 181
203 3300007788 Ga0099795_10003525 Ga0099795_100035253 181
204 3300009036 Ga0105244_10084364 Ga0105244_100843642 181
205 3300010159 Ga0099796_10002352 Ga0099796_100023524 181
206 3300011119 Ga0105246_10001767 Ga0105246_100017672 181
207 3300025728 Ga0207655_1039754 Ga0207655_10397543 181
208 3300032168 Ga0316593_10160980 Ga0316593_101609801 181
209 3300048919 Ga0496116_0084025 Ga0496116_0084025_257_805 181
210 3300048924 Ga0496121_0114906 Ga0496121_0114906_327_956 181
211 3300048924 Ga0496121_0397974 Ga0496121_0397974_270_818 181
212 3300048927 Ga0496124_0004774 Ga0496124_0004774_2764_3309 181
213 3300048927 Ga0496124_0441061 Ga0496124_0441061_10_558 181
214 iso_pu_bacteria 2643221623 2644131441 181
215 iso_pu_bacteria 2738543024 2739306185 181
216 iso_pu_bacteria 2844533157 2844538549 181
217 iso_pu_bacteria 8002285264 8002290651 181
218 3300002067 JGI24735J21928_10144681 JGI24735J21928_101446812 182
219 3300002741 JGI25157J39369_1001893 JGI25157J39369_10018933 182
220 3300003751 Ga0055538_1000329 Ga0055538_100032923 182
221 3300005327 Ga0070658_10003417 Ga0070658_100034178 182
222 3300005338 Ga0068868_100082970 Ga0068868_1000829703 182
223 3300005339 Ga0070660_100274062 Ga0070660_1002740622 182
224 3300005355 Ga0070671_100131635 Ga0070671_1001316351 182
225 3300005355 Ga0070671_100357278 Ga0070671_1003572782 182
226 3300005618 Ga0068864_100359305 Ga0068864_1003593052 182
227 3300005844 Ga0068862_100361135 Ga0068862_1003611352 182
228 3300005937 Ga0081455_10097959 Ga0081455_100979593 182
229 3300009093 Ga0105240_10103281 Ga0105240_101032812 182
230 3300009093 Ga0105240_10143330 Ga0105240_101433301 182
231 3300009093 Ga0105240_10349723 Ga0105240_103497231 182
232 3300009093 Ga0105240_10686217 Ga0105240_106862171 182
233 3300009174 Ga0105241_10456496 Ga0105241_104564962 182
234 3300009177 Ga0105248_10523622 Ga0105248_105236222 182
235 3300009545 Ga0105237_10000794 Ga0105237_1000079424 182
236 3300009551 Ga0105238_10642513 Ga0105238_106425131 182
237 3300010375 Ga0105239_10000049 Ga0105239_1000004916 182
238 3300010375 Ga0105239_10000086 Ga0105239_1000008699 182
239 3300013102 Ga0157371_10522105 Ga0157371_105221052 182
240 3300013104 Ga0157370_10368466 Ga0157370_103684662 182
241 3300013297 Ga0157378_10544881 Ga0157378_105448812 182
242 3300013307 Ga0157372_10201979 Ga0157372_102019792 182
243 3300013307 Ga0157372_10976978 Ga0157372_109769782 182
244 3300025224 Ga0209784_100038 Ga0209784_100038140 182
245 3300025246 Ga0209646_1030990 Ga0209646_10309901 182
246 3300025250 Ga0209026_1000005 Ga0209026_1000005252 182
247 3300025256 Ga0209759_1000106 Ga0209759_1000106135 182
248 3300025261 Ga0209233_1000068 Ga0209233_1000068145 182
249 3300025284 Ga0209130_1000537 Ga0209130_100053718 182
250 3300025294 Ga0209025_1000053 Ga0209025_10000536 182
251 3300025297 Ga0209758_1000847 Ga0209758_10008472 182
252 3300025302 Ga0207426_1000196 Ga0207426_100019696 182
253 3300025909 Ga0207705_10009851 Ga0207705_100098513 182
254 3300025911 Ga0207654_10342214 Ga0207654_103422142 182
255 3300025913 Ga0207695_10046308 Ga0207695_100463081 182
256 3300025913 Ga0207695_10299361 Ga0207695_102993613 182
257 3300025914 Ga0207671_10000888 Ga0207671_1000088829 182
258 3300025919 Ga0207657_10145586 Ga0207657_101455862 182
259 3300025919 Ga0207657_10522595 Ga0207657_105225951 182
260 3300025931 Ga0207644_10286276 Ga0207644_102862762 182
261 3300025981 Ga0207640_10039330 Ga0207640_100393302 182
262 3300026116 Ga0207674_10264671 Ga0207674_102646712 182
263 3300032002 Ga0307416_100168984 Ga0307416_1001689842 182
264 3300037312 Ga0395899_0307638 Ga0395899_0307638_250_804 182
265 3300037418 Ga0395900_0120776 Ga0395900_0120776_1496_2050 182
266 3300037471 Ga0395905_0036556 Ga0395905_0036556_1088_1642 182
267 3300037471 Ga0395905_0480246 Ga0395905_0480246_518_1072 182
268 3300038443 Ga0395901_0082499 Ga0395901_0082499_1494_2048 182
269 3300042007 Ga0439449_0128282 Ga0439449_0128282_220_771 182
270 3300042014 Ga0439457_034650 Ga0439457_034650_523_1074 182
271 3300044712 Ga0453684_0257778 Ga0453684_0257778_859_1413 182
272 3300044765 Ga0466970_0168548 Ga0466970_0168548_31_591 182
273 3300045049 Ga0466959_0144985 Ga0466959_0144985_728_1288 182
274 3300047472 Ga0495686_0000319 Ga0495686_0000319_42044_42592 182
275 3300047472 Ga0495686_0136389 Ga0495686_0136389_196_747 182
276 3300047472 Ga0495686_0167015 Ga0495686_0167015_377_925 182
277 3300048918 Ga0496115_0211245 Ga0496115_0211245_309_857 182
278 3300048920 Ga0496117_0358251 Ga0496117_0358251_140_697 182
279 3300048922 Ga0496119_0068146 Ga0496119_0068146_721_1275 182
280 3300048923 Ga0496120_0024786 Ga0496120_0024786_2289_2843 182
281 3300048925 Ga0496122_0082734 Ga0496122_0082734_1293_1883 182
282 3300048929 Ga0496126_0020377 Ga0496126_0020377_2385_2936 182
283 3300048929 Ga0496126_0292953 Ga0496126_0292953_646_1197 182
284 3300049553 Ga0501337_002432 Ga0501337_002432_346_906 182
285 3300059640 Ga0587067_008785 Ga0587067_008785_383_934 182
286 3300061719 Ga0466962_0329071 Ga0466962_0329071_168_728 182
287 3300005330 Ga0070690_100586806 Ga0070690_1005868061 183
288 3300009174 Ga0105241_10457131 Ga0105241_104571312 183
289 3300013105 Ga0157369_10376539 Ga0157369_103765391 183
290 3300013307 Ga0157372_10792177 Ga0157372_107921772 183
291 3300021377 Ga0213874_10007705 Ga0213874_100077052 183
292 3300021377 Ga0213874_10038581 Ga0213874_100385811 183
293 3300021384 Ga0213876_10000454 Ga0213876_100004545 183
294 3300021384 Ga0213876_10008149 Ga0213876_100081496 183
295 3300021388 Ga0213875_10003597 Ga0213875_100035974 183
296 3300021388 Ga0213875_10018154 Ga0213875_100181542 183
297 3300025913 Ga0207695_10395166 Ga0207695_103951662 183
298 3300025914 Ga0207671_10039289 Ga0207671_100392893 183
299 3300025924 Ga0207694_10185688 Ga0207694_101856881 183
300 3300026041 Ga0207639_10054194 Ga0207639_100541943 183
301 3300037418 Ga0395900_0252161 Ga0395900_0252161_987_1559 183
302 3300037418 Ga0395900_1095705 Ga0395900_1095705_131_703 183
303 3300037853 Ga0436364_0308817 Ga0436364_0308817_18724_19296 183
304 3300037853 Ga0436364_1356743 Ga0436364_1356743_569_1132 183
305 3300038443 Ga0395901_0676347 Ga0395901_0676347_185_757 183
306 3300039437 Ga0436365_0499375 Ga0436365_0499375_24971_25543 183
307 3300039437 Ga0436365_1455305 Ga0436365_1455305_20696_21259 183
308 3300039438 Ga0436360_0072862 Ga0436360_0072862_147_710 183
309 3300039450 Ga0436363_0381103 Ga0436363_0381103_141_713 183
310 3300039450 Ga0436363_0720333 Ga0436363_0720333_4671_5234 183
311 3300039450 Ga0436363_1310672 Ga0436363_1310672_5123_5686 183
312 3300039453 Ga0436362_0608143 Ga0436362_0608143_8523_9095 183
313 3300039453 Ga0436362_0620166 Ga0436362_0620166_79_642 183
314 3300048905 Ga0496102_0573709 Ga0496102_0573709_283_855 183
315 3300048918 Ga0496115_0266887 Ga0496115_0266887_299_871 183
316 3300048929 Ga0496126_0365482 Ga0496126_0365482_138_710 183
317 3300049571 Ga0501034_0084836 Ga0501034_0084836_1445_2014 183
318 3300002067 JGI24735J21928_10002901 JGI24735J21928_100029011 184
319 3300003323 rootH1_10271230 rootH1_102712303 184
320 3300003354 JGI25160J50197_1031623 JGI25160J50197_10316232 184
321 3300005327 Ga0070658_10000002 Ga0070658_1000000264 184
322 3300005329 Ga0070683_100131466 Ga0070683_1001314663 184
323 3300005336 Ga0070680_100000186 Ga0070680_10000018612 184
324 3300005337 Ga0070682_100475801 Ga0070682_1004758012 184
325 3300005339 Ga0070660_100046753 Ga0070660_1000467533 184
326 3300005339 Ga0070660_100058445 Ga0070660_1000584453 184
327 3300005344 Ga0070661_100000003 Ga0070661_10000000374 184
328 3300005345 Ga0070692_10126072 Ga0070692_101260722 184
329 3300005366 Ga0070659_100001760 Ga0070659_1000017607 184
330 3300005366 Ga0070659_100319764 Ga0070659_1003197642 184
331 3300005530 Ga0070679_100000001 Ga0070679_100000001417 184
332 3300005539 Ga0068853_100374984 Ga0068853_1003749842 184
333 3300005563 Ga0068855_100880359 Ga0068855_1008803592 184
334 3300005577 Ga0068857_100108436 Ga0068857_1001084362 184
335 3300005616 Ga0068852_100003115 Ga0068852_1000031156 184
336 3300005937 Ga0081455_10209016 Ga0081455_102090161 184
337 3300009093 Ga0105240_10645208 Ga0105240_106452082 184
338 3300009551 Ga0105238_11736078 Ga0105238_117360781 184
339 3300013100 Ga0157373_10002483 Ga0157373_100024831 184
340 3300013102 Ga0157371_10000980 Ga0157371_100009803 184
341 3300013104 Ga0157370_10041395 Ga0157370_100413953 184
342 3300013105 Ga0157369_10028064 Ga0157369_100280645 184
343 3300013105 Ga0157369_10141021 Ga0157369_101410212 184
344 3300013307 Ga0157372_10008722 Ga0157372_100087223 184
345 3300014497 Ga0182008_10545793 Ga0182008_105457931 184
346 3300020081 Ga0206354_11418104 Ga0206354_114181049 184
347 3300020082 Ga0206353_11308154 Ga0206353_1130815412 184
348 3300021358 Ga0213873_10000016 Ga0213873_10000016129 184
349 3300021384 Ga0213876_10000056 Ga0213876_100000569 184
350 3300021384 Ga0213876_10001776 Ga0213876_100017765 184
351 3300025261 Ga0209233_1000520 Ga0209233_100052014 184
352 3300025904 Ga0207647_10000588 Ga0207647_100005887 184
353 3300025909 Ga0207705_10000005 Ga0207705_10000005511 184
354 3300025912 Ga0207707_10049504 Ga0207707_100495043 184
355 3300025917 Ga0207660_10001348 Ga0207660_1000134812 184
356 3300025919 Ga0207657_10000749 Ga0207657_1000074927 184
357 3300025919 Ga0207657_10047960 Ga0207657_100479603 184
358 3300025920 Ga0207649_10000027 Ga0207649_10000027128 184
359 3300025921 Ga0207652_10000003 Ga0207652_1000000313 184
360 3300025932 Ga0207690_10012764 Ga0207690_100127642 184
361 3300025932 Ga0207690_10039934 Ga0207690_100399343 184
362 3300026041 Ga0207639_10066396 Ga0207639_100663963 184
363 3300026116 Ga0207674_10107524 Ga0207674_101075243 184
364 3300026142 Ga0207698_10006046 Ga0207698_100060467 184
365 3300031251 Ga0265327_10027576 Ga0265327_100275762 184
366 3300038443 Ga0395901_0448286 Ga0395901_0448286_722_1276 184
367 3300039062 Ga0400483_040873 Ga0400483_040873_10796_11365 184
368 3300039437 Ga0436365_0372107 Ga0436365_0372107_37743_38378 184
369 3300039437 Ga0436365_0594533 Ga0436365_0594533_27907_28476 184
370 3300039437 Ga0436365_1335293 Ga0436365_1335293_377_934 184
371 3300039447 Ga0436361_0003380 Ga0436361_0003380_352_909 184
372 3300039453 Ga0436362_0580304 Ga0436362_0580304_114941_115510 184
373 3300046512 Ga0495610_0001719 Ga0495610_0001719_16756_17325 184
374 3300046694 Ga0495649_0083018 Ga0495649_0083018_1050_1619 184
375 3300048924 Ga0496121_0205006 Ga0496121_0205006_609_1178 184
376 3300053131 Ga0500652_000230 Ga0500652_000230_2975_3550 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

32

203

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9728 2 175
5buv-assembly2.cif.gz_B-2 x-ray structure of wbca from yersinia enterocolitica 0.9663 2 175
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.964 2 180
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9636 2 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9621 2 184
ID Description Score Start End Superfamily
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9663 2 175 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9618 1 177 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.954 1 177 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9473 2 180 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9446 2 175 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V9YSM8-F1-model_v4 deleted 0.9938 11 184
AF-A0A350MPY5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9937 2 147 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7V9RU57-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.992 1 139 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A2G6MV24-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9919 42 182 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A1T1CL82-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9918 1 182 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
97.4 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map