F426892

General Info

Members Datasets Scaffolds Average Seq Length
374 238 748 208

Family's Representative Sequence

Representative Sequence 3300053729|Ga0500625_002650|Ga0500625_002650_2270_2926
Length 205
Sequence MLFMRKTTALPSAATTHFVNGAKLQPPYPAGLEQAMFGLGCFWGAERKFWELGDGVYATAVGYAGGHTPNPTYEETCSGRTGHTEVVLVVFDPKKISYEKLLKLFWESHNPTQGMRQGNDVGTQYRSAIYTYSDAQKKAADQSKALYQKALAAKGLGAITTEIAPAGEFYFAEDYHQQYLAKNPAGYCGLGGTGVSCPIGVGVSA

Samples

Sample ID Description Type Environment
1 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
187 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
188 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
189 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
236 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
237 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
238 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.34
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0.27
Rhizoplane 2.41
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500625_002650 3300053729 Bacteria 6780
2 JGI24034J26672_10035183 3300002239 Bacteria 827
3 Ga0065715_10135109 3300005293 Bacteria 1943
4 Ga0065715_10557325 3300005293 Bacteria 713
5 Ga0065707_10204834 3300005295 Bacteria 1293
6 Ga0070658_10002784 3300005327 Bacteria 14531
7 Ga0070683_100002358 3300005329 Bacteria 14998
8 Ga0070683_100031971 3300005329 Bacteria 4789
9 Ga0070690_100001372 3300005330 Bacteria 12670
10 Ga0070690_100009629 3300005330 Bacteria 5602
11 Ga0070690_100197164 3300005330 Bacteria 1399
12 Ga0070690_100305431 3300005330 Bacteria 1142
13 Ga0070670_100055328 3300005331 Bacteria 3406
14 Ga0070677_10008191 3300005333 Bacteria 3513
15 Ga0068869_100000950 3300005334 Bacteria 16797
16 Ga0070666_10172213 3300005335 Bacteria 1516
17 Ga0070666_10448056 3300005335 Bacteria 932
18 Ga0070680_100042197 3300005336 Bacteria 3700
19 Ga0070689_100029845 3300005340 Bacteria 4133
20 Ga0070691_10029128 3300005341 Bacteria 2583
21 Ga0070687_100025735 3300005343 Bacteria 2827
22 Ga0070661_100022806 3300005344 Bacteria 4482
23 Ga0070692_10044018 3300005345 Bacteria 2298
24 Ga0070668_100049093 3300005347 Bacteria 3247
25 Ga0070675_100003828 3300005354 Bacteria 11421
26 Ga0070675_100039070 3300005354 Bacteria 3870
27 Ga0070675_100460197 3300005354 Bacteria 1142
28 Ga0070675_100758341 3300005354 Bacteria 886
29 Ga0070671_100047997 3300005355 Bacteria 3550
30 Ga0070674_100000057 3300005356 Bacteria 49618
31 Ga0070674_100037597 3300005356 Bacteria 3257
32 Ga0070674_100128031 3300005356 Bacteria 1889
33 Ga0070673_100010518 3300005364 Bacteria 6264
34 Ga0070659_100026910 3300005366 Bacteria 4427
35 Ga0070659_100543656 3300005366 Bacteria 994
36 Ga0070667_100216700 3300005367 Bacteria 1703
37 Ga0070667_100256358 3300005367 Bacteria 1565
38 Ga0070667_100866909 3300005367 Bacteria 840
39 Ga0070713_100060122 3300005436 Bacteria 3176
40 Ga0070701_10390972 3300005438 Bacteria 879
41 Ga0070705_100042555 3300005440 Bacteria 2598
42 Ga0070700_100028167 3300005441 Bacteria 3338
43 Ga0070700_100174988 3300005441 Bacteria 1489
44 Ga0070694_100017424 3300005444 Bacteria 4541
45 Ga0070708_100504156 3300005445 Bacteria 1142
46 Ga0070663_100036585 3300005455 Bacteria 3411
47 Ga0070678_100028412 3300005456 Bacteria 3814
48 Ga0070678_100202191 3300005456 Bacteria 1640
49 Ga0070678_100357065 3300005456 Bacteria 1258
50 Ga0070662_100402198 3300005457 Bacteria 1130
51 Ga0070662_100689421 3300005457 Bacteria 864
52 Ga0070681_10135597 3300005458 Bacteria 2392
53 Ga0070681_10196260 3300005458 Bacteria 1937
54 Ga0068867_100002018 3300005459 Bacteria 14188
55 Ga0070707_100113985 3300005468 Bacteria 2623
56 Ga0070698_100111027 3300005471 Bacteria 2707
57 Ga0070699_100019015 3300005518 Bacteria 5907
58 Ga0070699_100059073 3300005518 Bacteria 3323
59 Ga0070679_100008040 3300005530 Bacteria 9910
60 Ga0070679_100178788 3300005530 Bacteria 2094
61 Ga0070679_100208502 3300005530 Bacteria 1918
62 Ga0070684_100001373 3300005535 Bacteria 17492
63 Ga0070684_100198584 3300005535 Bacteria 1827
64 Ga0070697_100212616 3300005536 Bacteria 1647
65 Ga0068853_100241273 3300005539 Bacteria 1656
66 Ga0068853_100940658 3300005539 Bacteria 831
67 Ga0070672_100024205 3300005543 Bacteria 4484
68 Ga0070672_100063865 3300005543 Bacteria 2908
69 Ga0070672_100108465 3300005543 Bacteria 2260
70 Ga0070686_100225929 3300005544 Bacteria 1355
71 Ga0070695_100119381 3300005545 Bacteria 1802
72 Ga0070665_100010233 3300005548 Bacteria 9489
73 Ga0070665_100049079 3300005548 Bacteria 4236
74 Ga0068855_100046358 3300005563 Bacteria 5139
75 Ga0068855_100210432 3300005563 Bacteria 2185
76 Ga0068855_100304764 3300005563 Bacteria 1763
77 Ga0070664_100008591 3300005564 Bacteria 8263
78 Ga0070664_100030510 3300005564 Bacteria 4498
79 Ga0070664_100426139 3300005564 Bacteria 1216
80 Ga0068856_100239978 3300005614 Bacteria 1828
81 Ga0068852_100039483 3300005616 Bacteria 3974
82 Ga0068859_100025263 3300005617 Bacteria 5960
83 Ga0068859_100140392 3300005617 Bacteria 2489
84 Ga0068859_101388490 3300005617 Bacteria 775
85 Ga0068864_100160441 3300005618 Bacteria 2044
86 Ga0068864_100465697 3300005618 Bacteria 1211
87 Ga0068864_101104986 3300005618 Bacteria 789
88 Ga0068866_10008742 3300005718 Bacteria 4279
89 Ga0068861_100418266 3300005719 Bacteria 1194
90 Ga0068851_10209476 3300005834 Bacteria 1091
91 Ga0068863_100072125 3300005841 Bacteria 3268
92 Ga0068863_100214962 3300005841 Bacteria 1851
93 Ga0068863_100271759 3300005841 Bacteria 1641
94 Ga0068858_100014296 3300005842 Bacteria 7484
95 Ga0068858_101196495 3300005842 Bacteria 747
96 Ga0068862_100177445 3300005844 Bacteria 1910
97 Ga0081455_10004726 3300005937 Bacteria 15138
98 Ga0081455_10137818 3300005937 Bacteria 1899
99 Ga0081540_1048250 3300005983 Bacteria 2134
100 Ga0081539_10012018 3300005985 Bacteria 6740
101 Ga0075365_10277906 3300006038 Bacteria 1178
102 Ga0075365_10286988 3300006038 Bacteria 1158
103 Ga0075369_10220946 3300006186 Bacteria 877
104 Ga0075366_10004155 3300006195 Bacteria 7755
105 Ga0075428_100034327 3300006844 Bacteria 5597
106 Ga0075428_100240531 3300006844 Bacteria 1953
107 Ga0075433_10093894 3300006852 Bacteria 2654
108 Ga0075434_100000595 3300006871 Bacteria 27967
109 Ga0075434_100080169 3300006871 Bacteria 3261
110 Ga0075429_100155269 3300006880 Bacteria 2004
111 Ga0097620_100025263 3300006931 Bacteria 5960
112 Ga0097620_100140386 3300006931 Bacteria 2489
113 Ga0097620_101388451 3300006931 Bacteria 775
114 Ga0105240_10295168 3300009093 Bacteria 1856
115 Ga0111539_10044591 3300009094 Bacteria 5312
116 Ga0111539_10183327 3300009094 Bacteria 2445
117 Ga0111539_10205819 3300009094 Bacteria 2294
118 Ga0105245_10000074 3300009098 Bacteria 103733
119 Ga0105245_10382815 3300009098 Bacteria 1401
120 Ga0105245_11094850 3300009098 Bacteria 843
121 Ga0114129_10012111 3300009147 Bacteria 12280
122 Ga0114129_10019881 3300009147 Bacteria 9557
123 Ga0114129_10053101 3300009147 Bacteria 5684
124 Ga0114129_10079722 3300009147 Bacteria 4552
125 Ga0105243_10678586 3300009148 Bacteria 1002
126 Ga0105242_10334534 3300009176 Bacteria 1394
127 Ga0105248_10331289 3300009177 Bacteria 1714
128 Ga0105248_10517714 3300009177 Bacteria 1345
129 Ga0105249_10021412 3300009553 Bacteria 5787
130 Ga0105035_102123 3300009988 Bacteria 1437
131 Ga0105239_10046229 3300010375 Bacteria 4770
132 Ga0105239_10147781 3300010375 Bacteria 2622
133 Ga0105239_10624493 3300010375 Bacteria 1230
134 Ga0157373_10460858 3300013100 Bacteria 915
135 Ga0157370_10191758 3300013104 Bacteria 1897
136 Ga0157374_10043025 3300013296 Bacteria 4170
137 Ga0157374_10061735 3300013296 Bacteria 3511
138 Ga0157378_10583528 3300013297 Bacteria 1127
139 Ga0157378_10625347 3300013297 Bacteria 1090
140 Ga0163162_10140284 3300013306 Bacteria 2530
141 Ga0163162_11060192 3300013306 Bacteria 918
142 Ga0157375_10001192 3300013308 Bacteria 22410
143 Ga0163163_10318457 3300014325 Bacteria 1609
144 Ga0157380_10015394 3300014326 Bacteria 5621
145 Ga0182008_10073663 3300014497 Bacteria 1680
146 Ga0157377_10538273 3300014745 Bacteria 823
147 Ga0157379_10033405 3300014968 Bacteria 4588
148 Ga0157379_10212163 3300014968 Bacteria 1753
149 Ga0197907_10482289 3300020069 Bacteria 765
150 Ga0206349_1320450 3300020075 Bacteria 771
151 Ga0213872_10073167 3300021361 Bacteria 1544
152 Ga0213871_10000661 3300021441 Bacteria 4958
153 Ga0224712_10179211 3300022467 Bacteria 954
154 Ga0207656_10057862 3300025321 Bacteria 1692
155 Ga0207656_10180503 3300025321 Bacteria 1013
156 Ga0207656_10241560 3300025321 Bacteria 883
157 Ga0207682_10021242 3300025893 Bacteria 2553
158 Ga0207680_10050763 3300025903 Bacteria 2477
159 Ga0207699_10312664 3300025906 Bacteria 1100
160 Ga0207645_10047794 3300025907 Bacteria 2732
161 Ga0207645_10188133 3300025907 Bacteria 1356
162 Ga0207705_10021949 3300025909 Bacteria 4555
163 Ga0207707_10010978 3300025912 Bacteria 7880
164 Ga0207707_10442220 3300025912 Bacteria 1113
165 Ga0207707_10529052 3300025912 Bacteria 1003
166 Ga0207695_10195764 3300025913 Bacteria 1937
167 Ga0207695_10264250 3300025913 Bacteria 1618
168 Ga0207660_10542147 3300025917 Bacteria 946
169 Ga0207662_10009769 3300025918 Bacteria 5292
170 Ga0207662_10038346 3300025918 Bacteria 2807
171 Ga0207662_10044371 3300025918 Bacteria 2625
172 Ga0207649_10100597 3300025920 Bacteria 1912
173 Ga0207649_10153117 3300025920 Bacteria 1590
174 Ga0207652_10073816 3300025921 Bacteria 2969
175 Ga0207652_10310882 3300025921 Bacteria 1422
176 Ga0207646_10044446 3300025922 Bacteria 3987
177 Ga0207681_10043525 3300025923 Bacteria 3005
178 Ga0207694_10103863 3300025924 Bacteria 2254
179 Ga0207650_10030293 3300025925 Bacteria 3896
180 Ga0207650_10179865 3300025925 Bacteria 1685
181 Ga0207659_10049512 3300025926 Bacteria 2981
182 Ga0207659_10161993 3300025926 Bacteria 1757
183 Ga0207659_10250133 3300025926 Bacteria 1438
184 Ga0207659_10735551 3300025926 Bacteria 846
185 Ga0207687_10000139 3300025927 Bacteria 48406
186 Ga0207700_10354383 3300025928 Bacteria 1278
187 Ga0207644_10106875 3300025931 Bacteria 2110
188 Ga0207644_10116318 3300025931 Bacteria 2029
189 Ga0207690_10015229 3300025932 Bacteria 4656
190 Ga0207690_10891153 3300025932 Bacteria 738
191 Ga0207706_10158504 3300025933 Bacteria 1990
192 Ga0207706_10203060 3300025933 Bacteria 1738
193 Ga0207686_10252676 3300025934 Bacteria 1289
194 Ga0207670_10106567 3300025936 Bacteria 2011
195 Ga0207670_10605705 3300025936 Bacteria 900
196 Ga0207669_10241976 3300025937 Bacteria 1338
197 Ga0207691_10083192 3300025940 Bacteria 2874
198 Ga0207711_10139930 3300025941 Bacteria 2177
199 Ga0207711_10230518 3300025941 Bacteria 1696
200 Ga0207711_10263634 3300025941 Bacteria 1584
201 Ga0207689_10000802 3300025942 Bacteria 30304
202 Ga0207689_10431834 3300025942 Bacteria 1100
203 Ga0207661_10009574 3300025944 Bacteria 6955
204 Ga0207661_10026968 3300025944 Bacteria 4384
205 Ga0207679_10006506 3300025945 Bacteria 7386
206 Ga0207679_10164059 3300025945 Bacteria 1822
207 Ga0207667_10063775 3300025949 Bacteria 3850
208 Ga0207667_10108842 3300025949 Bacteria 2858
209 Ga0207667_10533523 3300025949 Bacteria 1188
210 Ga0207651_10011819 3300025960 Bacteria 4903
211 Ga0207651_10021911 3300025960 Bacteria 3893
212 Ga0207651_10437617 3300025960 Bacteria 1119
213 Ga0207712_10033740 3300025961 Bacteria 3462
214 Ga0207668_10049356 3300025972 Bacteria 2893
215 Ga0207640_10013554 3300025981 Bacteria 4679
216 Ga0207640_10195127 3300025981 Bacteria 1529
217 Ga0207658_10079804 3300025986 Bacteria 2505
218 Ga0207658_10199868 3300025986 Bacteria 1668
219 Ga0207658_10822801 3300025986 Bacteria 844
220 Ga0207677_10301936 3300026023 Bacteria 1323
221 Ga0207703_10229581 3300026035 Bacteria 1663
222 Ga0207703_10345837 3300026035 Bacteria 1368
223 Ga0207639_10633813 3300026041 Bacteria 988
224 Ga0207639_10757762 3300026041 Bacteria 903
225 Ga0207678_10053925 3300026067 Bacteria 3464
226 Ga0207708_10022633 3300026075 Bacteria 4746
227 Ga0207708_10202358 3300026075 Bacteria 1585
228 Ga0207702_10473996 3300026078 Bacteria 1217
229 Ga0207641_10273319 3300026088 Bacteria 1586
230 Ga0207648_10000987 3300026089 Bacteria 32110
231 Ga0207648_10152601 3300026089 Bacteria 2039
232 Ga0207676_10358316 3300026095 Bacteria 1351
233 Ga0207676_10369805 3300026095 Bacteria 1331
234 Ga0207676_10760732 3300026095 Bacteria 943
235 Ga0207676_11106495 3300026095 Bacteria 783
236 Ga0207674_10081553 3300026116 Bacteria 3237
237 Ga0207675_100005723 3300026118 Bacteria 11892
238 Ga0207683_10005546 3300026121 Bacteria 10807
239 Ga0207683_10199122 3300026121 Bacteria 1820
240 Ga0207683_10230205 3300026121 Bacteria 1690
241 Ga0207683_10713170 3300026121 Bacteria 930
242 Ga0207698_10010246 3300026142 Bacteria 6010
243 Ga0209588_1034094 3300027671 Bacteria 1634
244 Ga0268266_10038998 3300028379 Bacteria 4045
245 Ga0268266_10200223 3300028379 Bacteria 1827
246 Ga0268266_10792084 3300028379 Bacteria 915
247 Ga0268265_10882799 3300028380 Bacteria 877
248 Ga0268264_10024687 3300028381 Bacteria 4909
249 Ga0268264_10674719 3300028381 Bacteria 1025
250 Ga0265334_10012179 3300028573 Bacteria 3614
251 Ga0265338_10098776 3300028800 Bacteria 2387
252 Ga0265332_10117929 3300031238 Bacteria 1115
253 Ga0265340_10027777 3300031247 Bacteria 2851
254 Ga0307408_100277425 3300031548 Bacteria 1394
255 Ga0307405_10027422 3300031731 Bacteria 3302
256 Ga0307413_10087236 3300031824 Bacteria 2020
257 Ga0307413_10178630 3300031824 Bacteria 1511
258 Ga0307410_10035207 3300031852 Bacteria 3249
259 Ga0307410_10451356 3300031852 Bacteria 1049
260 Ga0307406_10594736 3300031901 Bacteria 911
261 Ga0307407_10010854 3300031903 Bacteria 4313
262 Ga0307407_10483221 3300031903 Bacteria 905
263 Ga0307412_10010790 3300031911 Bacteria 5272
264 Ga0307412_10384775 3300031911 Bacteria 1137
265 Ga0307409_100107602 3300031995 Bacteria 2330
266 Ga0307409_100151773 3300031995 Bacteria 2012
267 Ga0307416_100034024 3300032002 Bacteria 3872
268 Ga0307414_10032467 3300032004 Bacteria 3438
269 Ga0307414_10876859 3300032004 Bacteria 822
270 Ga0307411_10019221 3300032005 Bacteria 3942
271 Ga0307411_10029420 3300032005 Bacteria 3354
272 Ga0307415_100339875 3300032126 Bacteria 1259
273 Ga0316593_10113440 3300032168 Bacteria 969
274 Ga0316588_1026940 3300033528 Bacteria 1333
275 Ga0373946_0449180 3300035171 Bacteria 656
276 Ga0373961_0258617 3300035241 Bacteria 632
277 Ga0316574_0017515 3300035398 Bacteria 4194
278 Ga0316574_0169607 3300035398 Bacteria 1405
279 Ga0373924_0234762 3300035410 Bacteria 811
280 Ga0373935_0893986 3300035692 Bacteria 658
281 Ga0373937_0030437 3300036401 Bacteria 4889
282 Ga0373937_0769018 3300036401 Bacteria 911
283 Ga0316582_0313014 3300036647 Bacteria 1079
284 Ga0316584_0623784 3300036712 Bacteria 745
285 Ga0373925_0042002 3300037068 Bacteria 3392
286 Ga0395899_0046515 3300037312 Bacteria 3232
287 Ga0395899_0069434 3300037312 Bacteria 2580
288 Ga0395900_0004486 3300037418 Bacteria 14782
289 Ga0395900_0014278 3300037418 Bacteria 8107
290 Ga0395900_0300818 3300037418 Bacteria 1590
291 Ga0395898_0025316 3300037466 Bacteria 5981
292 Ga0395898_0034556 3300037466 Bacteria 5036
293 Ga0395905_0410072 3300037471 Bacteria 1250
294 Ga0395901_0011599 3300038443 Bacteria 8928
295 Ga0395901_0025966 3300038443 Bacteria 6014
296 Ga0395901_0227610 3300038443 Bacteria 1947
297 Ga0436365_0299553 3300039437 Bacteria 1500
298 Ga0436365_1831203 3300039437 Bacteria 3769
299 Ga0436360_0150887 3300039438 Bacteria 8910
300 Ga0436360_1226964 3300039438 Bacteria 952
301 Ga0436361_0039427 3300039447 Bacteria 2398
302 Ga0436362_0228468 3300039453 Bacteria 3415
303 Ga0436362_0973385 3300039453 Bacteria 820
304 Ga0439448_0018850 3300042005 Bacteria 2119
305 Ga0439455_0029681 3300042012 Bacteria 1353
306 Ga0450923_071873 3300042125 Bacteria 768
307 Ga0450900_029845 3300042136 Bacteria 789
308 Ga0439464_0102849 3300042439 Bacteria 869
309 Ga0466969_0076613 3300044656 Bacteria 1601
310 Ga0453683_0190388 3300044673 Bacteria 1302
311 Ga0466959_0206463 3300045049 Bacteria 1366
312 Ga0451576_0005338 3300045051 Bacteria 16152
313 Ga0451576_0019689 3300045051 Bacteria 7364
314 Ga0495582_0159426 3300046473 Bacteria 1283
315 Ga0495598_0181475 3300046537 Bacteria 751
316 Ga0495621_0062578 3300046539 Bacteria 1354
317 Ga0495621_0226042 3300046539 Bacteria 759
318 Ga0495669_0011647 3300046684 Bacteria 3738
319 Ga0495670_0014483 3300046691 Bacteria 3877
320 Ga0495672_0001847 3300047320 Bacteria 20192
321 Ga0495676_0067660 3300047321 Bacteria 2763
322 Ga0496104_0004986 3300048907 Bacteria 11589
323 Ga0496104_0214504 3300048907 Bacteria 1837
324 Ga0496108_0053090 3300048911 Bacteria 3398
325 Ga0496109_0023214 3300048912 Bacteria 5503
326 Ga0496109_0023238 3300048912 Bacteria 5500
327 Ga0496110_0000256 3300048913 Bacteria 34589
328 Ga0496111_0002116 3300048914 Bacteria 11862
329 Ga0496112_0000239 3300048915 Bacteria 35278
330 Ga0496114_0024982 3300048917 Bacteria 4879
331 Ga0501034_0008173 3300049571 Bacteria 11094
332 Ga0501034_0045287 3300049571 Bacteria 4446
333 Ga0501038_0674024 3300049574 Bacteria 777
334 Ga0501039_0164671 3300049575 Bacteria 1743
335 Ga0501047_0141106 3300049581 Bacteria 2288
336 Ga0501048_0086367 3300049582 Bacteria 2213
337 Ga0501068_0088722 3300049584 Bacteria 1905
338 Ga0501071_0990224 3300049587 Bacteria 649
339 Ga0501073_0141982 3300049589 Bacteria 1664
340 Ga0501075_0165215 3300049591 Bacteria 1689
341 Ga0501075_0572186 3300049591 Bacteria 862
342 Ga0501075_0575962 3300049591 Bacteria 859
343 Ga0501077_0212960 3300049593 Bacteria 1228
344 Ga0501080_0142237 3300049742 Bacteria 2218
345 Ga0501035_0594950 3300049822 Bacteria 902
346 Ga0501044_0029445 3300049823 Bacteria 5790
347 Ga0501045_0650152 3300049824 Bacteria 779
348 nmdc:mga03683_81898_c1 3300050489 Bacteria 1395
349 nmdc:mga03n38_228152_c1 3300050490 Bacteria 975
350 nmdc:mga0yw44_156317_c1 3300050492 Bacteria 1490
351 nmdc:mga0k408_7797_c1 3300050493 Bacteria 5724
352 nmdc:mga05p37_10739_c2 3300050507 Bacteria 7626
353 nmdc:mga05p37_1606283_c1 3300050507 Bacteria 640
354 nmdc:mga05p37_800_c1 3300050507 Bacteria 35071
355 nmdc:mga09592_24378_c1 3300050508 Bacteria 5003
356 nmdc:mga09592_46798_c1 3300050508 Bacteria 3644
357 nmdc:mga0qj67_227579_c1 3300050509 Bacteria 1513
358 nmdc:mga08y16_1423642_c1 3300050511 Bacteria 656
359 nmdc:mga08y16_3795_c1 3300050511 Bacteria 15733
360 nmdc:mga0n895_1285130_c1 3300050512 Bacteria 703
361 nmdc:mga0n895_283746_c1 3300050512 Bacteria 1679
362 nmdc:mga0n895_498_c1 3300050512 Bacteria 26602
363 nmdc:mga0n895_540518_c1 3300050512 Bacteria 1172
364 nmdc:mga0n895_632127_c1 3300050512 Bacteria 1071
365 nmdc:mga0rr50_445161_c1 3300050513 Bacteria 1098
366 nmdc:mga0a205_106165_c1 3300050515 Bacteria 2707
367 nmdc:mga0a205_86992_c1 3300050515 Bacteria 3019
368 Ga0500644_0007111 3300053088 Bacteria 2900
369 Ga0500568_0018790 3300053139 Bacteria 3016
370 Ga0500609_002990 3300053731 Bacteria 2404
371 Ga0500552_000299 3300053733 Bacteria 4509
372 Ga0530510_0052188 3300061734 Bacteria 2955
373 Ga0530510_1071505 3300061734 Bacteria 617
374 8002778641 8002775197 Bacteria 10728764
375 Ga0500625_002650
376 JGI24034J26672_10035183
377 Ga0065715_10135109
378 Ga0065715_10557325
379 Ga0065707_10204834
380 Ga0070658_10002784
381 Ga0070683_100002358
382 Ga0070683_100031971
383 Ga0070690_100001372
384 Ga0070690_100009629
385 Ga0070690_100197164
386 Ga0070690_100305431
387 Ga0070670_100055328
388 Ga0070677_10008191
389 Ga0068869_100000950
390 Ga0070666_10172213
391 Ga0070666_10448056
392 Ga0070680_100042197
393 Ga0070689_100029845
394 Ga0070691_10029128
395 Ga0070687_100025735
396 Ga0070661_100022806
397 Ga0070692_10044018
398 Ga0070668_100049093
399 Ga0070675_100003828
400 Ga0070675_100039070
401 Ga0070675_100460197
402 Ga0070675_100758341
403 Ga0070671_100047997
404 Ga0070674_100000057
405 Ga0070674_100037597
406 Ga0070674_100128031
407 Ga0070673_100010518
408 Ga0070659_100026910
409 Ga0070659_100543656
410 Ga0070667_100216700
411 Ga0070667_100256358
412 Ga0070667_100866909
413 Ga0070713_100060122
414 Ga0070701_10390972
415 Ga0070705_100042555
416 Ga0070700_100028167
417 Ga0070700_100174988
418 Ga0070694_100017424
419 Ga0070708_100504156
420 Ga0070663_100036585
421 Ga0070678_100028412
422 Ga0070678_100202191
423 Ga0070678_100357065
424 Ga0070662_100402198
425 Ga0070662_100689421
426 Ga0070681_10135597
427 Ga0070681_10196260
428 Ga0068867_100002018
429 Ga0070707_100113985
430 Ga0070698_100111027
431 Ga0070699_100019015
432 Ga0070699_100059073
433 Ga0070679_100008040
434 Ga0070679_100178788
435 Ga0070679_100208502
436 Ga0070684_100001373
437 Ga0070684_100198584
438 Ga0070697_100212616
439 Ga0068853_100241273
440 Ga0068853_100940658
441 Ga0070672_100024205
442 Ga0070672_100063865
443 Ga0070672_100108465
444 Ga0070686_100225929
445 Ga0070695_100119381
446 Ga0070665_100010233
447 Ga0070665_100049079
448 Ga0068855_100046358
449 Ga0068855_100210432
450 Ga0068855_100304764
451 Ga0070664_100008591
452 Ga0070664_100030510
453 Ga0070664_100426139
454 Ga0068856_100239978
455 Ga0068852_100039483
456 Ga0068859_100025263
457 Ga0068859_100140392
458 Ga0068859_101388490
459 Ga0068864_100160441
460 Ga0068864_100465697
461 Ga0068864_101104986
462 Ga0068866_10008742
463 Ga0068861_100418266
464 Ga0068851_10209476
465 Ga0068863_100072125
466 Ga0068863_100214962
467 Ga0068863_100271759
468 Ga0068858_100014296
469 Ga0068858_101196495
470 Ga0068862_100177445
471 Ga0081455_10004726
472 Ga0081455_10137818
473 Ga0081540_1048250
474 Ga0081539_10012018
475 Ga0075365_10277906
476 Ga0075365_10286988
477 Ga0075369_10220946
478 Ga0075366_10004155
479 Ga0075428_100034327
480 Ga0075428_100240531
481 Ga0075433_10093894
482 Ga0075434_100000595
483 Ga0075434_100080169
484 Ga0075429_100155269
485 Ga0097620_100025263
486 Ga0097620_100140386
487 Ga0097620_101388451
488 Ga0105240_10295168
489 Ga0111539_10044591
490 Ga0111539_10183327
491 Ga0111539_10205819
492 Ga0105245_10000074
493 Ga0105245_10382815
494 Ga0105245_11094850
495 Ga0114129_10012111
496 Ga0114129_10019881
497 Ga0114129_10053101
498 Ga0114129_10079722
499 Ga0105243_10678586
500 Ga0105242_10334534
501 Ga0105248_10331289
502 Ga0105248_10517714
503 Ga0105249_10021412
504 Ga0105035_102123
505 Ga0105239_10046229
506 Ga0105239_10147781
507 Ga0105239_10624493
508 Ga0157373_10460858
509 Ga0157370_10191758
510 Ga0157374_10043025
511 Ga0157374_10061735
512 Ga0157378_10583528
513 Ga0157378_10625347
514 Ga0163162_10140284
515 Ga0163162_11060192
516 Ga0157375_10001192
517 Ga0163163_10318457
518 Ga0157380_10015394
519 Ga0182008_10073663
520 Ga0157377_10538273
521 Ga0157379_10033405
522 Ga0157379_10212163
523 Ga0197907_10482289
524 Ga0206349_1320450
525 Ga0213872_10073167
526 Ga0213871_10000661
527 Ga0224712_10179211
528 Ga0207656_10057862
529 Ga0207656_10180503
530 Ga0207656_10241560
531 Ga0207682_10021242
532 Ga0207680_10050763
533 Ga0207699_10312664
534 Ga0207645_10047794
535 Ga0207645_10188133
536 Ga0207705_10021949
537 Ga0207707_10010978
538 Ga0207707_10442220
539 Ga0207707_10529052
540 Ga0207695_10195764
541 Ga0207695_10264250
542 Ga0207660_10542147
543 Ga0207662_10009769
544 Ga0207662_10038346
545 Ga0207662_10044371
546 Ga0207649_10100597
547 Ga0207649_10153117
548 Ga0207652_10073816
549 Ga0207652_10310882
550 Ga0207646_10044446
551 Ga0207681_10043525
552 Ga0207694_10103863
553 Ga0207650_10030293
554 Ga0207650_10179865
555 Ga0207659_10049512
556 Ga0207659_10161993
557 Ga0207659_10250133
558 Ga0207659_10735551
559 Ga0207687_10000139
560 Ga0207700_10354383
561 Ga0207644_10106875
562 Ga0207644_10116318
563 Ga0207690_10015229
564 Ga0207690_10891153
565 Ga0207706_10158504
566 Ga0207706_10203060
567 Ga0207686_10252676
568 Ga0207670_10106567
569 Ga0207670_10605705
570 Ga0207669_10241976
571 Ga0207691_10083192
572 Ga0207711_10139930
573 Ga0207711_10230518
574 Ga0207711_10263634
575 Ga0207689_10000802
576 Ga0207689_10431834
577 Ga0207661_10009574
578 Ga0207661_10026968
579 Ga0207679_10006506
580 Ga0207679_10164059
581 Ga0207667_10063775
582 Ga0207667_10108842
583 Ga0207667_10533523
584 Ga0207651_10011819
585 Ga0207651_10021911
586 Ga0207651_10437617
587 Ga0207712_10033740
588 Ga0207668_10049356
589 Ga0207640_10013554
590 Ga0207640_10195127
591 Ga0207658_10079804
592 Ga0207658_10199868
593 Ga0207658_10822801
594 Ga0207677_10301936
595 Ga0207703_10229581
596 Ga0207703_10345837
597 Ga0207639_10633813
598 Ga0207639_10757762
599 Ga0207678_10053925
600 Ga0207708_10022633
601 Ga0207708_10202358
602 Ga0207702_10473996
603 Ga0207641_10273319
604 Ga0207648_10000987
605 Ga0207648_10152601
606 Ga0207676_10358316
607 Ga0207676_10369805
608 Ga0207676_10760732
609 Ga0207676_11106495
610 Ga0207674_10081553
611 Ga0207675_100005723
612 Ga0207683_10005546
613 Ga0207683_10199122
614 Ga0207683_10230205
615 Ga0207683_10713170
616 Ga0207698_10010246
617 Ga0209588_1034094
618 Ga0268266_10038998
619 Ga0268266_10200223
620 Ga0268266_10792084
621 Ga0268265_10882799
622 Ga0268264_10024687
623 Ga0268264_10674719
624 Ga0265334_10012179
625 Ga0265338_10098776
626 Ga0265332_10117929
627 Ga0265340_10027777
628 Ga0307408_100277425
629 Ga0307405_10027422
630 Ga0307413_10087236
631 Ga0307413_10178630
632 Ga0307410_10035207
633 Ga0307410_10451356
634 Ga0307406_10594736
635 Ga0307407_10010854
636 Ga0307407_10483221
637 Ga0307412_10010790
638 Ga0307412_10384775
639 Ga0307409_100107602
640 Ga0307409_100151773
641 Ga0307416_100034024
642 Ga0307414_10032467
643 Ga0307414_10876859
644 Ga0307411_10019221
645 Ga0307411_10029420
646 Ga0307415_100339875
647 Ga0316593_10113440
648 Ga0316588_1026940
649 Ga0373946_0449180
650 Ga0373961_0258617
651 Ga0316574_0017515
652 Ga0316574_0169607
653 Ga0373924_0234762
654 Ga0373935_0893986
655 Ga0373937_0030437
656 Ga0373937_0769018
657 Ga0316582_0313014
658 Ga0316584_0623784
659 Ga0373925_0042002
660 Ga0395899_0046515
661 Ga0395899_0069434
662 Ga0395900_0004486
663 Ga0395900_0014278
664 Ga0395900_0300818
665 Ga0395898_0025316
666 Ga0395898_0034556
667 Ga0395905_0410072
668 Ga0395901_0011599
669 Ga0395901_0025966
670 Ga0395901_0227610
671 Ga0436365_0299553
672 Ga0436365_1831203
673 Ga0436360_0150887
674 Ga0436360_1226964
675 Ga0436361_0039427
676 Ga0436362_0228468
677 Ga0436362_0973385
678 Ga0439448_0018850
679 Ga0439455_0029681
680 Ga0450923_071873
681 Ga0450900_029845
682 Ga0439464_0102849
683 Ga0466969_0076613
684 Ga0453683_0190388
685 Ga0466959_0206463
686 Ga0451576_0005338
687 Ga0451576_0019689
688 Ga0495582_0159426
689 Ga0495598_0181475
690 Ga0495621_0062578
691 Ga0495621_0226042
692 Ga0495669_0011647
693 Ga0495670_0014483
694 Ga0495672_0001847
695 Ga0495676_0067660
696 Ga0496104_0004986
697 Ga0496104_0214504
698 Ga0496108_0053090
699 Ga0496109_0023214
700 Ga0496109_0023238
701 Ga0496110_0000256
702 Ga0496111_0002116
703 Ga0496112_0000239
704 Ga0496114_0024982
705 Ga0501034_0008173
706 Ga0501034_0045287
707 Ga0501038_0674024
708 Ga0501039_0164671
709 Ga0501047_0141106
710 Ga0501048_0086367
711 Ga0501068_0088722
712 Ga0501071_0990224
713 Ga0501073_0141982
714 Ga0501075_0165215
715 Ga0501075_0572186
716 Ga0501075_0575962
717 Ga0501077_0212960
718 Ga0501080_0142237
719 Ga0501035_0594950
720 Ga0501044_0029445
721 Ga0501045_0650152
722 nmdc:mga03683_81898_c1
723 nmdc:mga03n38_228152_c1
724 nmdc:mga0yw44_156317_c1
725 nmdc:mga0k408_7797_c1
726 nmdc:mga05p37_10739_c2
727 nmdc:mga05p37_1606283_c1
728 nmdc:mga05p37_800_c1
729 nmdc:mga09592_24378_c1
730 nmdc:mga09592_46798_c1
731 nmdc:mga0qj67_227579_c1
732 nmdc:mga08y16_1423642_c1
733 nmdc:mga08y16_3795_c1
734 nmdc:mga0n895_1285130_c1
735 nmdc:mga0n895_283746_c1
736 nmdc:mga0n895_498_c1
737 nmdc:mga0n895_540518_c1
738 nmdc:mga0n895_632127_c1
739 nmdc:mga0rr50_445161_c1
740 nmdc:mga0a205_106165_c1
741 nmdc:mga0a205_86992_c1
742 Ga0500644_0007111
743 Ga0500568_0018790
744 Ga0500609_002990
745 Ga0500552_000299
746 Ga0530510_0052188
747 Ga0530510_1071505
748 8002778641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

34

189

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9892 1 174
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.988 1 186
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9831 15 170
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9754 1 183
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9717 1 169
ID Description Score Start End Superfamily
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.975 21 173 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9724 22 170 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9673 1 172 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9586 15 177 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.953 22 170 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.999 11 160 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A451CNZ6-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9978 1 184 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A8B0SL83-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9978 21 185 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A127F8A5-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9977 1 185 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A409V7B3-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9977 1 157 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map