F426837

General Info

Members Datasets Scaffolds Average Seq Length
374 238 748 188

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0034591|Ga0495669_0034591_1311_1997
Length 228
Sequence MRAWRADLSFGLAMNKKGTQQPSPVKDKRARPVEISHSRAMTDTPAVRVLGVAGSLRQGSFNRALLRTAVELAPPGMTLVTFDLIDVPLYNGDVEAGGDPPAVAAFKQAIREADAVLFVTPEYNHGVPGVMKNAVDWASRPPRDAPLGAKPVGVIGASPGQTGSARGQSQLRQAFEFTNSYCMPQPEILVFRAHEKFDAEGRLIDEATAKYLRAYLEAFAAWTLRFKA

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
221 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
222 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
223 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
227 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
228 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
229 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
230 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
235 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
236 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
237 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
238 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0
Isolates 0.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.5
Nodule 0
Rhizoplane 4.55
Rhizosphere 78.61
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0034591 3300046684 Bacteria 2228
2 JGI24752J21851_1001823 3300001976 Bacteria 2850
3 JGI24739J22299_10058448 3300001989 Bacteria 1224
4 JGI24751J29686_10016315 3300002459 Bacteria 1532
5 Ga0055530_10000579 3300003791 Bacteria 31675
6 Ga0055531_10001275 3300003794 Bacteria 18993
7 Ga0065165_1000459 3300005262 Bacteria 63870
8 Ga0065712_10209954 3300005290 Bacteria 1076
9 Ga0065707_10246781 3300005295 Bacteria 1138
10 Ga0070658_10602006 3300005327 Bacteria 952
11 Ga0070670_100020256 3300005331 Bacteria 5715
12 Ga0070670_100232955 3300005331 Bacteria 1603
13 Ga0070666_10000098 3300005335 Bacteria 59878
14 Ga0070666_10716759 3300005335 Bacteria 734
15 Ga0070680_100003908 3300005336 Bacteria 11137
16 Ga0070682_101001275 3300005337 Bacteria 694
17 Ga0070660_100017881 3300005339 Bacteria 5172
18 Ga0070661_100341820 3300005344 Bacteria 1173
19 Ga0070692_10207490 3300005345 Bacteria 1151
20 Ga0070668_100006410 3300005347 Bacteria 8721
21 Ga0070668_100025188 3300005347 Bacteria 4510
22 Ga0070669_100000029 3300005353 Bacteria 163005
23 Ga0070675_101414987 3300005354 Bacteria 641
24 Ga0070671_100000016 3300005355 Bacteria 156166
25 Ga0070671_100055031 3300005355 Bacteria 3309
26 Ga0070671_100283107 3300005355 Bacteria 1410
27 Ga0070671_100359852 3300005355 Bacteria 1242
28 Ga0070667_100003029 3300005367 Bacteria 14448
29 Ga0070667_100011641 3300005367 Bacteria 7273
30 Ga0070667_100499789 3300005367 Bacteria 1115
31 Ga0070714_101321183 3300005435 Unclassified 704
32 Ga0070705_100590521 3300005440 Bacteria 858
33 Ga0070663_100338435 3300005455 Bacteria 1215
34 Ga0070678_100173854 3300005456 Bacteria 1757
35 Ga0070662_100046037 3300005457 Bacteria 3133
36 Ga0070662_100817228 3300005457 Bacteria 793
37 Ga0070681_10046601 3300005458 Bacteria 4334
38 Ga0070681_10068624 3300005458 Bacteria 3512
39 Ga0070685_10001766 3300005466 Bacteria 11316
40 Ga0070685_10008033 3300005466 Bacteria 5409
41 Ga0070706_100643038 3300005467 Unclassified 985
42 Ga0070679_100000015 3300005530 Bacteria 142672
43 Ga0070679_100363842 3300005530 Bacteria 1394
44 Ga0070686_100002624 3300005544 Bacteria 9911
45 Ga0070686_100250949 3300005544 Bacteria 1292
46 Ga0070665_100002021 3300005548 Bacteria 22808
47 Ga0070665_100007953 3300005548 Bacteria 10750
48 Ga0070665_100268671 3300005548 Bacteria 1707
49 Ga0068855_100002131 3300005563 Bacteria 24489
50 Ga0068854_100121458 3300005578 Bacteria 1984
51 Ga0068856_100109892 3300005614 Bacteria 2754
52 Ga0068856_101559647 3300005614 Bacteria 674
53 Ga0068852_101018499 3300005616 Bacteria 847
54 Ga0068859_100003218 3300005617 Bacteria 16624
55 Ga0068859_100006011 3300005617 Bacteria 12332
56 Ga0068859_100030856 3300005617 Bacteria 5378
57 Ga0068859_100448509 3300005617 Bacteria 1386
58 Ga0068859_100800385 3300005617 Bacteria 1030
59 Ga0068864_100007265 3300005618 Bacteria 9110
60 Ga0068864_100117864 3300005618 Bacteria 2370
61 Ga0068864_100282149 3300005618 Bacteria 1551
62 Ga0068861_100017081 3300005719 Bacteria 5146
63 Ga0068861_100342543 3300005719 Bacteria 1309
64 Ga0068863_100000076 3300005841 Bacteria 109412
65 Ga0068863_100017119 3300005841 Bacteria 6953
66 Ga0068863_100104519 3300005841 Bacteria 2694
67 Ga0068863_100423169 3300005841 Bacteria 1305
68 Ga0068863_101071937 3300005841 Bacteria 810
69 Ga0068858_100000079 3300005842 Bacteria 100753
70 Ga0068858_100007702 3300005842 Bacteria 10395
71 Ga0068858_100037803 3300005842 Bacteria 4476
72 Ga0068860_100012790 3300005843 Bacteria 8251
73 Ga0068860_100103069 3300005843 Bacteria 2723
74 Ga0068860_101296225 3300005843 Bacteria 749
75 Ga0068862_100000606 3300005844 Bacteria 37254
76 Ga0068862_100028138 3300005844 Bacteria 4733
77 Ga0068862_100061023 3300005844 Bacteria 3240
78 Ga0068862_100567450 3300005844 Bacteria 1086
79 Ga0075366_10099141 3300006195 Bacteria 1748
80 Ga0075366_10182230 3300006195 Bacteria 1276
81 Ga0075370_10003675 3300006353 Bacteria 7340
82 Ga0075370_10403599 3300006353 Bacteria 820
83 Ga0075428_100197065 3300006844 Bacteria 2178
84 Ga0075428_101174255 3300006844 Archaea 809
85 Ga0075431_100001930 3300006847 Bacteria 19744
86 Ga0075429_100007682 3300006880 Bacteria 9363
87 Ga0097620_100003218 3300006931 Bacteria 16624
88 Ga0097620_100006011 3300006931 Bacteria 12332
89 Ga0097620_100030858 3300006931 Bacteria 5378
90 Ga0097620_100448511 3300006931 Bacteria 1386
91 Ga0097620_100800447 3300006931 Bacteria 1030
92 Ga0105251_10083172 3300009011 Bacteria 1478
93 Ga0105250_10003149 3300009092 Bacteria 7916
94 Ga0105240_10001734 3300009093 Bacteria 36806
95 Ga0105240_10028073 3300009093 Bacteria 7358
96 Ga0105240_10320350 3300009093 Bacteria 1767
97 Ga0105240_11185906 3300009093 Bacteria 809
98 Ga0111539_11474838 3300009094 Unclassified 789
99 Ga0105247_10000521 3300009101 Bacteria 31494
100 Ga0114129_10069180 3300009147 Bacteria 4921
101 Ga0114129_10673621 3300009147 Archaea 1333
102 Ga0114129_11398926 3300009147 Bacteria 863
103 Ga0105243_10172039 3300009148 Bacteria 1877
104 Ga0105248_10001802 3300009177 Bacteria 23825
105 Ga0105248_10016007 3300009177 Bacteria 8256
106 Ga0105248_10043520 3300009177 Bacteria 5034
107 Ga0105248_10079570 3300009177 Bacteria 3684
108 Ga0105248_10110540 3300009177 Bacteria 3099
109 Ga0105248_10115019 3300009177 Bacteria 3034
110 Ga0105248_10433145 3300009177 Bacteria 1481
111 Ga0105238_10000043 3300009551 Bacteria 154120
112 Ga0105238_10070001 3300009551 Bacteria 3508
113 Ga0105238_10137788 3300009551 Bacteria 2418
114 Ga0105238_10428746 3300009551 Bacteria 1318
115 Ga0105238_10592836 3300009551 Bacteria 1116
116 Ga0105249_10034658 3300009553 Bacteria 4575
117 Ga0105249_10138320 3300009553 Bacteria 2333
118 Ga0105249_10775603 3300009553 Bacteria 1022
119 Ga0105239_10045145 3300010375 Bacteria 4829
120 Ga0105239_10775055 3300010375 Bacteria 1098
121 Ga0105239_11855386 3300010375 Bacteria 699
122 Ga0157373_10488279 3300013100 Bacteria 889
123 Ga0157369_10060658 3300013105 Bacteria 4079
124 Ga0163162_10307636 3300013306 Bacteria 1717
125 Ga0157375_10840972 3300013308 Bacteria 1065
126 Ga0163163_10006188 3300014325 Bacteria 10436
127 Ga0163163_10047914 3300014325 Bacteria 4201
128 Ga0163163_10151376 3300014325 Bacteria 2364
129 Ga0163163_10487329 3300014325 Bacteria 1294
130 Ga0157380_10600286 3300014326 Bacteria 1089
131 Ga0182008_10197640 3300014497 Archaea 1022
132 Ga0157379_10004503 3300014968 Bacteria 11951
133 Ga0157379_10011790 3300014968 Bacteria 7634
134 Ga0157379_10058572 3300014968 Bacteria 3445
135 Ga0157379_10216964 3300014968 Bacteria 1733
136 Ga0157376_10858144 3300014969 Bacteria 924
137 Ga0163161_10818291 3300017792 Bacteria 784
138 Ga0213873_10000019 3300021358 Bacteria 122085
139 Ga0213876_10000075 3300021384 Bacteria 120068
140 Ga0213876_10482966 3300021384 Archaea 659
141 Ga0213875_10000996 3300021388 Bacteria 20184
142 Ga0213875_10140785 3300021388 Bacteria 1129
143 Ga0213871_10005739 3300021441 Bacteria 2584
144 Ga0209758_1000924 3300025297 Bacteria 39688
145 Ga0209050_1000049 3300025298 Bacteria 364096
146 Ga0209257_1000692 3300025304 Bacteria 52346
147 Ga0207697_10000164 3300025315 Bacteria 33417
148 Ga0207696_1066920 3300025711 Bacteria 1003
149 Ga0207710_10002428 3300025900 Bacteria 8663
150 Ga0207680_10000130 3300025903 Bacteria 35102
151 Ga0207680_10523069 3300025903 Bacteria 846
152 Ga0207705_10420829 3300025909 Bacteria 1034
153 Ga0207707_10032346 3300025912 Bacteria 4578
154 Ga0207707_10052372 3300025912 Bacteria 3554
155 Ga0207695_10009149 3300025913 Bacteria 12293
156 Ga0207695_10063225 3300025913 Bacteria 3817
157 Ga0207695_10543395 3300025913 Bacteria 1043
158 Ga0207695_10700990 3300025913 Bacteria 893
159 Ga0207660_10005109 3300025917 Bacteria 8543
160 Ga0207657_10045144 3300025919 Bacteria 3869
161 Ga0207649_10328144 3300025920 Bacteria 1126
162 Ga0207652_10000021 3300025921 Bacteria 159712
163 Ga0207681_10000040 3300025923 Bacteria 147547
164 Ga0207681_10707503 3300025923 Bacteria 838
165 Ga0207694_10000065 3300025924 Bacteria 131061
166 Ga0207694_10046522 3300025924 Bacteria 3354
167 Ga0207694_10174090 3300025924 Bacteria 1743
168 Ga0207694_10662469 3300025924 Bacteria 880
169 Ga0207650_10008678 3300025925 Bacteria 6943
170 Ga0207650_10194870 3300025925 Bacteria 1620
171 Ga0207659_11164668 3300025926 Bacteria 663
172 Ga0207664_10132033 3300025929 Bacteria 2103
173 Ga0207644_10000023 3300025931 Bacteria 156180
174 Ga0207644_10020086 3300025931 Bacteria 4538
175 Ga0207644_10096393 3300025931 Bacteria 2214
176 Ga0207706_10139590 3300025933 Bacteria 2132
177 Ga0207711_10000979 3300025941 Bacteria 27387
178 Ga0207711_10010458 3300025941 Bacteria 7704
179 Ga0207711_10055342 3300025941 Bacteria 3406
180 Ga0207711_10070373 3300025941 Bacteria 3034
181 Ga0207711_10270425 3300025941 Bacteria 1563
182 Ga0207711_10496927 3300025941 Bacteria 1137
183 Ga0207679_10162694 3300025945 Bacteria 1829
184 Ga0207667_10002254 3300025949 Bacteria 24231
185 Ga0207712_10018578 3300025961 Bacteria 4530
186 Ga0207712_10020808 3300025961 Bacteria 4302
187 Ga0207668_10006336 3300025972 Bacteria 6996
188 Ga0207668_10387891 3300025972 Bacteria 1177
189 Ga0207640_10094665 3300025981 Bacteria 2078
190 Ga0207658_10021286 3300025986 Bacteria 4499
191 Ga0207658_10049853 3300025986 Bacteria 3078
192 Ga0207658_10142518 3300025986 Bacteria 1941
193 Ga0207658_10317731 3300025986 Bacteria 1347
194 Ga0207658_10896148 3300025986 Bacteria 807
195 Ga0207703_10000051 3300026035 Bacteria 145390
196 Ga0207703_10003651 3300026035 Bacteria 12827
197 Ga0207703_10012656 3300026035 Bacteria 6579
198 Ga0207678_10166706 3300026067 Bacteria 1881
199 Ga0207678_10220384 3300026067 Bacteria 1624
200 Ga0207702_10080984 3300026078 Bacteria 2819
201 Ga0207641_10000003 3300026088 Bacteria 496984
202 Ga0207641_10270634 3300026088 Bacteria 1594
203 Ga0207641_10392273 3300026088 Bacteria 1331
204 Ga0207676_10000223 3300026095 Bacteria 48952
205 Ga0207676_10002964 3300026095 Bacteria 12109
206 Ga0207676_10003035 3300026095 Bacteria 11983
207 Ga0207674_10600694 3300026116 Bacteria 1063
208 Ga0207675_100000582 3300026118 Bacteria 35705
209 Ga0207675_100035760 3300026118 Bacteria 4633
210 Ga0207698_11057084 3300026142 Bacteria 824
211 Ga0207698_11525554 3300026142 Bacteria 683
212 Ga0268266_10000003 3300028379 Bacteria 1701703
213 Ga0268266_10006204 3300028379 Bacteria 10975
214 Ga0268265_10000098 3300028380 Bacteria 110108
215 Ga0268265_10221657 3300028380 Bacteria 1655
216 Ga0268265_10225679 3300028380 Bacteria 1642
217 Ga0268264_10000141 3300028381 Bacteria 170966
218 Ga0268264_10366820 3300028381 Bacteria 1375
219 Ga0307511_10042662 3300030521 Bacteria 3806
220 Ga0265327_10002316 3300031251 Bacteria 20363
221 Ga0307513_10000082 3300031456 Bacteria 131779
222 Ga0307513_10000649 3300031456 Bacteria 50063
223 Ga0316579_10278780 3300031691 Unclassified 808
224 Ga0307516_10000001 3300031730 Bacteria 510338
225 Ga0307413_10194933 3300031824 Bacteria 1458
226 Ga0307406_10114808 3300031901 Bacteria 1861
227 Ga0307414_11223031 3300032004 Bacteria 696
228 Ga0307415_100487366 3300032126 Bacteria 1075
229 Ga0307415_100746885 3300032126 Bacteria 888
230 Ga0307510_10018167 3300033180 Bacteria 8278
231 Ga0373959_0000363 3300034820 Bacteria 9041
232 Ga0373944_0008891 3300035089 Bacteria 2716
233 Ga0373941_0131428 3300035115 Bacteria 902
234 Ga0373943_0181505 3300035170 Bacteria 1157
235 Ga0373946_0131346 3300035171 Bacteria 1152
236 Ga0373927_0058247 3300035695 Bacteria 2498
237 Ga0373925_0000199 3300037068 Bacteria 65400
238 Ga0395900_0314625 3300037418 Bacteria 1548
239 Ga0395905_0531041 3300037471 Bacteria 1077
240 Ga0436364_0212998 3300037853 Bacteria 1136
241 Ga0436364_0730168 3300037853 Bacteria 28599
242 Ga0395901_0092213 3300038443 Bacteria 3171
243 Ga0395901_0374212 3300038443 Bacteria 1467
244 Ga0436365_1185447 3300039437 Archaea 1064
245 Ga0436365_1455572 3300039437 Bacteria 1005
246 Ga0436365_1650613 3300039437 Bacteria 78818
247 Ga0436360_0627673 3300039438 Bacteria 3019
248 Ga0436360_0887996 3300039438 Bacteria 1023
249 Ga0436362_0592983 3300039453 Bacteria 296966
250 Ga0436362_0680284 3300039453 Archaea 1635
251 Ga0439462_0009305 3300042015 Bacteria 2485
252 Ga0451577_0104899 3300042876 Bacteria 2526
253 Ga0439440_0040958 3300042993 Unclassified 1129
254 Ga0466968_0344949 3300044735 Unclassified 723
255 Ga0495638_0131219 3300046460 Bacteria 1471
256 Ga0495583_0178415 3300046506 Bacteria 870
257 Ga0495610_0052313 3300046512 Bacteria 1983
258 Ga0495620_0024003 3300046515 Bacteria 2906
259 Ga0495631_0183972 3300046518 Bacteria 895
260 Ga0495642_0041129 3300046528 Bacteria 1879
261 Ga0495609_0045382 3300046538 Bacteria 1969
262 Ga0495621_0110859 3300046539 Bacteria 1052
263 Ga0495597_0002136 3300046542 Bacteria 13092
264 Ga0495645_0029498 3300046543 Bacteria 3990
265 Ga0495622_0000663 3300046557 Bacteria 19486
266 Ga0495668_0040881 3300046616 Bacteria 2585
267 Ga0495668_0043206 3300046616 Bacteria 2508
268 Ga0495668_0055677 3300046616 Bacteria 2184
269 Ga0495668_0111750 3300046616 Bacteria 1494
270 Ga0495668_0223597 3300046616 Bacteria 1031
271 Ga0495625_0154736 3300046660 Bacteria 1539
272 Ga0495625_0443608 3300046660 Bacteria 803
273 Ga0495588_0094302 3300046674 Bacteria 1569
274 Ga0495658_0000556 3300046683 Bacteria 20391
275 Ga0495669_0000202 3300046684 Bacteria 36374
276 Ga0495624_0251680 3300046690 Bacteria 1068
277 Ga0495672_0055534 3300047320 Bacteria 2311
278 Ga0495676_0443552 3300047321 Bacteria 857
279 Ga0495680_0531288 3300047322 Unclassified 795
280 Ga0495687_146986 3300047443 Bacteria 811
281 Ga0495677_0010203 3300047445 Bacteria 3454
282 Ga0495677_0063107 3300047445 Bacteria 1376
283 Ga0495684_0080086 3300047471 Bacteria 2480
284 Ga0495686_0017477 3300047472 Bacteria 4831
285 Ga0495593_0133918 3300047673 Bacteria 1257
286 Ga0495602_0106095 3300048088 Bacteria 2294
287 Ga0496101_0115235 3300048904 Bacteria 2027
288 Ga0496102_0003298 3300048905 Bacteria 13683
289 Ga0496102_0140295 3300048905 Bacteria 2266
290 Ga0496103_0711784 3300048906 Bacteria 636
291 Ga0496104_0550796 3300048907 Bacteria 1064
292 Ga0496106_0063935 3300048909 Bacteria 2798
293 Ga0496107_0029308 3300048910 Bacteria 3915
294 Ga0496108_0036030 3300048911 Bacteria 4115
295 Ga0496109_0106204 3300048912 Bacteria 2608
296 Ga0496110_0308574 3300048913 Bacteria 1441
297 Ga0496111_0253526 3300048914 Bacteria 1306
298 Ga0496112_0015115 3300048915 Bacteria 7191
299 Ga0496112_0020562 3300048915 Bacteria 6258
300 Ga0496113_0044630 3300048916 Bacteria 3285
301 Ga0496115_0006365 3300048918 Bacteria 8648
302 Ga0496115_0053548 3300048918 Bacteria 3238
303 Ga0496117_0006324 3300048920 Bacteria 12051
304 Ga0496118_0010751 3300048921 Bacteria 9023
305 Ga0496119_0010638 3300048922 Bacteria 7712
306 Ga0496120_0230901 3300048923 Bacteria 879
307 Ga0496121_0000874 3300048924 Bacteria 54498
308 Ga0501031_0059710 3300049568 Unclassified 2485
309 Ga0501031_0077686 3300049568 Bacteria 2162
310 Ga0501032_0032338 3300049569 Bacteria 3585
311 Ga0501032_0122103 3300049569 Bacteria 1722
312 Ga0501034_0050562 3300049571 Bacteria 4192
313 Ga0501034_0671843 3300049571 Bacteria 936
314 Ga0501039_0162334 3300049575 Bacteria 1756
315 Ga0501039_0192219 3300049575 Unclassified 1605
316 Ga0501040_0728616 3300049576 Bacteria 717
317 Ga0501046_0053861 3300049580 Bacteria 3167
318 Ga0501047_0000933 3300049581 Bacteria 29666
319 Ga0501047_0048145 3300049581 Bacteria 4117
320 Ga0501047_0146376 3300049581 Bacteria 2239
321 Ga0501067_0119682 3300049583 Bacteria 1465
322 Ga0501068_0409558 3300049584 Bacteria 875
323 Ga0501069_0214845 3300049585 Bacteria 1117
324 Ga0501071_0320127 3300049587 Bacteria 1178
325 Ga0501073_0479384 3300049589 Bacteria 860
326 Ga0501075_0417369 3300049591 Unclassified 1023
327 Ga0501076_0056372 3300049592 Bacteria 3119
328 Ga0501076_0460307 3300049592 Unclassified 1047
329 Ga0501079_0151894 3300049741 Bacteria 1805
330 Ga0501079_0501341 3300049741 Bacteria 954
331 Ga0501080_0375114 3300049742 Unclassified 1282
332 Ga0501044_0064302 3300049823 Bacteria 3746
333 Ga0501045_0039637 3300049824 Bacteria 3428
334 nmdc:mga0k408_78816_c1 3300050493 Bacteria 1927
335 nmdc:mga0k408_83860_c1 3300050493 Bacteria 1869
336 nmdc:mga07m45_1096_c1 3300050496 Bacteria 12085
337 nmdc:mga05p37_1355349_c1 3300050507 Bacteria 720
338 nmdc:mga09592_5357_c1 3300050508 Bacteria 10426
339 nmdc:mga06r32_1271511_c1 3300050510 Archaea 680
340 nmdc:mga06r32_1872_c1 3300050510 Bacteria 18756
341 Ga0500635_0000297 3300053080 Bacteria 17607
342 Ga0500578_0078148 3300053086 Bacteria 2106
343 Ga0500643_004459 3300053087 Bacteria 6327
344 Ga0500647_0108547 3300053091 Bacteria 1321
345 Ga0500651_0024900 3300053093 Bacteria 3753
346 Ga0500641_0001162 3300053096 Bacteria 9380
347 Ga0500641_0041622 3300053096 Bacteria 1859
348 Ga0500555_033640 3300053103 Bacteria 1444
349 Ga0500556_0043884 3300053104 Bacteria 1589
350 Ga0500562_001120 3300053108 Bacteria 6593
351 Ga0500569_006794 3300053109 Bacteria 2532
352 Ga0500595_028510 3300053119 Bacteria 1903
353 Ga0500597_137653 3300053120 Bacteria 1053
354 Ga0500607_046364 3300053121 Bacteria 2330
355 Ga0500607_048060 3300053121 Bacteria 2283
356 Ga0500608_001672 3300053122 Bacteria 7950
357 Ga0500614_004086 3300053123 Bacteria 3104
358 Ga0500658_0092828 3300053134 Bacteria 1308
359 Ga0500559_0044219 3300053136 Bacteria 1948
360 Ga0500559_0087922 3300053136 Bacteria 1420
361 Ga0500590_025148 3300053148 Bacteria 3091
362 Ga0500603_013205 3300053150 Bacteria 1912
363 Ga0500604_0210002 3300053151 Bacteria 670
364 Ga0500638_083299 3300053162 Bacteria 1516
365 Ga0500636_0032671 3300053177 Bacteria 3080
366 Ga0500637_0017682 3300053178 Bacteria 3820
367 Ga0500637_0020235 3300053178 Bacteria 3601
368 Ga0500625_006690 3300053729 Bacteria 4935
369 Ga0500645_001636 3300053730 Bacteria 11047
370 Ga0500596_013992 3300053735 Bacteria 1208
371 Ga0501084_0099575 3300054114 Bacteria 2441
372 2554816528 2554235132 Bacteria 6772433
373 2608380159 2606217733 Bacteria 6360972
374 2808941851 2808606379 Bacteria 5022697
375 Ga0495669_0034591
376 JGI24752J21851_1001823
377 JGI24739J22299_10058448
378 JGI24751J29686_10016315
379 Ga0055530_10000579
380 Ga0055531_10001275
381 Ga0065165_1000459
382 Ga0065712_10209954
383 Ga0065707_10246781
384 Ga0070658_10602006
385 Ga0070670_100020256
386 Ga0070670_100232955
387 Ga0070666_10000098
388 Ga0070666_10716759
389 Ga0070680_100003908
390 Ga0070682_101001275
391 Ga0070660_100017881
392 Ga0070661_100341820
393 Ga0070692_10207490
394 Ga0070668_100006410
395 Ga0070668_100025188
396 Ga0070669_100000029
397 Ga0070675_101414987
398 Ga0070671_100000016
399 Ga0070671_100055031
400 Ga0070671_100283107
401 Ga0070671_100359852
402 Ga0070667_100003029
403 Ga0070667_100011641
404 Ga0070667_100499789
405 Ga0070714_101321183
406 Ga0070705_100590521
407 Ga0070663_100338435
408 Ga0070678_100173854
409 Ga0070662_100046037
410 Ga0070662_100817228
411 Ga0070681_10046601
412 Ga0070681_10068624
413 Ga0070685_10001766
414 Ga0070685_10008033
415 Ga0070706_100643038
416 Ga0070679_100000015
417 Ga0070679_100363842
418 Ga0070686_100002624
419 Ga0070686_100250949
420 Ga0070665_100002021
421 Ga0070665_100007953
422 Ga0070665_100268671
423 Ga0068855_100002131
424 Ga0068854_100121458
425 Ga0068856_100109892
426 Ga0068856_101559647
427 Ga0068852_101018499
428 Ga0068859_100003218
429 Ga0068859_100006011
430 Ga0068859_100030856
431 Ga0068859_100448509
432 Ga0068859_100800385
433 Ga0068864_100007265
434 Ga0068864_100117864
435 Ga0068864_100282149
436 Ga0068861_100017081
437 Ga0068861_100342543
438 Ga0068863_100000076
439 Ga0068863_100017119
440 Ga0068863_100104519
441 Ga0068863_100423169
442 Ga0068863_101071937
443 Ga0068858_100000079
444 Ga0068858_100007702
445 Ga0068858_100037803
446 Ga0068860_100012790
447 Ga0068860_100103069
448 Ga0068860_101296225
449 Ga0068862_100000606
450 Ga0068862_100028138
451 Ga0068862_100061023
452 Ga0068862_100567450
453 Ga0075366_10099141
454 Ga0075366_10182230
455 Ga0075370_10003675
456 Ga0075370_10403599
457 Ga0075428_100197065
458 Ga0075428_101174255
459 Ga0075431_100001930
460 Ga0075429_100007682
461 Ga0097620_100003218
462 Ga0097620_100006011
463 Ga0097620_100030858
464 Ga0097620_100448511
465 Ga0097620_100800447
466 Ga0105251_10083172
467 Ga0105250_10003149
468 Ga0105240_10001734
469 Ga0105240_10028073
470 Ga0105240_10320350
471 Ga0105240_11185906
472 Ga0111539_11474838
473 Ga0105247_10000521
474 Ga0114129_10069180
475 Ga0114129_10673621
476 Ga0114129_11398926
477 Ga0105243_10172039
478 Ga0105248_10001802
479 Ga0105248_10016007
480 Ga0105248_10043520
481 Ga0105248_10079570
482 Ga0105248_10110540
483 Ga0105248_10115019
484 Ga0105248_10433145
485 Ga0105238_10000043
486 Ga0105238_10070001
487 Ga0105238_10137788
488 Ga0105238_10428746
489 Ga0105238_10592836
490 Ga0105249_10034658
491 Ga0105249_10138320
492 Ga0105249_10775603
493 Ga0105239_10045145
494 Ga0105239_10775055
495 Ga0105239_11855386
496 Ga0157373_10488279
497 Ga0157369_10060658
498 Ga0163162_10307636
499 Ga0157375_10840972
500 Ga0163163_10006188
501 Ga0163163_10047914
502 Ga0163163_10151376
503 Ga0163163_10487329
504 Ga0157380_10600286
505 Ga0182008_10197640
506 Ga0157379_10004503
507 Ga0157379_10011790
508 Ga0157379_10058572
509 Ga0157379_10216964
510 Ga0157376_10858144
511 Ga0163161_10818291
512 Ga0213873_10000019
513 Ga0213876_10000075
514 Ga0213876_10482966
515 Ga0213875_10000996
516 Ga0213875_10140785
517 Ga0213871_10005739
518 Ga0209758_1000924
519 Ga0209050_1000049
520 Ga0209257_1000692
521 Ga0207697_10000164
522 Ga0207696_1066920
523 Ga0207710_10002428
524 Ga0207680_10000130
525 Ga0207680_10523069
526 Ga0207705_10420829
527 Ga0207707_10032346
528 Ga0207707_10052372
529 Ga0207695_10009149
530 Ga0207695_10063225
531 Ga0207695_10543395
532 Ga0207695_10700990
533 Ga0207660_10005109
534 Ga0207657_10045144
535 Ga0207649_10328144
536 Ga0207652_10000021
537 Ga0207681_10000040
538 Ga0207681_10707503
539 Ga0207694_10000065
540 Ga0207694_10046522
541 Ga0207694_10174090
542 Ga0207694_10662469
543 Ga0207650_10008678
544 Ga0207650_10194870
545 Ga0207659_11164668
546 Ga0207664_10132033
547 Ga0207644_10000023
548 Ga0207644_10020086
549 Ga0207644_10096393
550 Ga0207706_10139590
551 Ga0207711_10000979
552 Ga0207711_10010458
553 Ga0207711_10055342
554 Ga0207711_10070373
555 Ga0207711_10270425
556 Ga0207711_10496927
557 Ga0207679_10162694
558 Ga0207667_10002254
559 Ga0207712_10018578
560 Ga0207712_10020808
561 Ga0207668_10006336
562 Ga0207668_10387891
563 Ga0207640_10094665
564 Ga0207658_10021286
565 Ga0207658_10049853
566 Ga0207658_10142518
567 Ga0207658_10317731
568 Ga0207658_10896148
569 Ga0207703_10000051
570 Ga0207703_10003651
571 Ga0207703_10012656
572 Ga0207678_10166706
573 Ga0207678_10220384
574 Ga0207702_10080984
575 Ga0207641_10000003
576 Ga0207641_10270634
577 Ga0207641_10392273
578 Ga0207676_10000223
579 Ga0207676_10002964
580 Ga0207676_10003035
581 Ga0207674_10600694
582 Ga0207675_100000582
583 Ga0207675_100035760
584 Ga0207698_11057084
585 Ga0207698_11525554
586 Ga0268266_10000003
587 Ga0268266_10006204
588 Ga0268265_10000098
589 Ga0268265_10221657
590 Ga0268265_10225679
591 Ga0268264_10000141
592 Ga0268264_10366820
593 Ga0307511_10042662
594 Ga0265327_10002316
595 Ga0307513_10000082
596 Ga0307513_10000649
597 Ga0316579_10278780
598 Ga0307516_10000001
599 Ga0307413_10194933
600 Ga0307406_10114808
601 Ga0307414_11223031
602 Ga0307415_100487366
603 Ga0307415_100746885
604 Ga0307510_10018167
605 Ga0373959_0000363
606 Ga0373944_0008891
607 Ga0373941_0131428
608 Ga0373943_0181505
609 Ga0373946_0131346
610 Ga0373927_0058247
611 Ga0373925_0000199
612 Ga0395900_0314625
613 Ga0395905_0531041
614 Ga0436364_0212998
615 Ga0436364_0730168
616 Ga0395901_0092213
617 Ga0395901_0374212
618 Ga0436365_1185447
619 Ga0436365_1455572
620 Ga0436365_1650613
621 Ga0436360_0627673
622 Ga0436360_0887996
623 Ga0436362_0592983
624 Ga0436362_0680284
625 Ga0439462_0009305
626 Ga0451577_0104899
627 Ga0439440_0040958
628 Ga0466968_0344949
629 Ga0495638_0131219
630 Ga0495583_0178415
631 Ga0495610_0052313
632 Ga0495620_0024003
633 Ga0495631_0183972
634 Ga0495642_0041129
635 Ga0495609_0045382
636 Ga0495621_0110859
637 Ga0495597_0002136
638 Ga0495645_0029498
639 Ga0495622_0000663
640 Ga0495668_0040881
641 Ga0495668_0043206
642 Ga0495668_0055677
643 Ga0495668_0111750
644 Ga0495668_0223597
645 Ga0495625_0154736
646 Ga0495625_0443608
647 Ga0495588_0094302
648 Ga0495658_0000556
649 Ga0495669_0000202
650 Ga0495624_0251680
651 Ga0495672_0055534
652 Ga0495676_0443552
653 Ga0495680_0531288
654 Ga0495687_146986
655 Ga0495677_0010203
656 Ga0495677_0063107
657 Ga0495684_0080086
658 Ga0495686_0017477
659 Ga0495593_0133918
660 Ga0495602_0106095
661 Ga0496101_0115235
662 Ga0496102_0003298
663 Ga0496102_0140295
664 Ga0496103_0711784
665 Ga0496104_0550796
666 Ga0496106_0063935
667 Ga0496107_0029308
668 Ga0496108_0036030
669 Ga0496109_0106204
670 Ga0496110_0308574
671 Ga0496111_0253526
672 Ga0496112_0015115
673 Ga0496112_0020562
674 Ga0496113_0044630
675 Ga0496115_0006365
676 Ga0496115_0053548
677 Ga0496117_0006324
678 Ga0496118_0010751
679 Ga0496119_0010638
680 Ga0496120_0230901
681 Ga0496121_0000874
682 Ga0501031_0059710
683 Ga0501031_0077686
684 Ga0501032_0032338
685 Ga0501032_0122103
686 Ga0501034_0050562
687 Ga0501034_0671843
688 Ga0501039_0162334
689 Ga0501039_0192219
690 Ga0501040_0728616
691 Ga0501046_0053861
692 Ga0501047_0000933
693 Ga0501047_0048145
694 Ga0501047_0146376
695 Ga0501067_0119682
696 Ga0501068_0409558
697 Ga0501069_0214845
698 Ga0501071_0320127
699 Ga0501073_0479384
700 Ga0501075_0417369
701 Ga0501076_0056372
702 Ga0501076_0460307
703 Ga0501079_0151894
704 Ga0501079_0501341
705 Ga0501080_0375114
706 Ga0501044_0064302
707 Ga0501045_0039637
708 nmdc:mga0k408_78816_c1
709 nmdc:mga0k408_83860_c1
710 nmdc:mga07m45_1096_c1
711 nmdc:mga05p37_1355349_c1
712 nmdc:mga09592_5357_c1
713 nmdc:mga06r32_1271511_c1
714 nmdc:mga06r32_1872_c1
715 Ga0500635_0000297
716 Ga0500578_0078148
717 Ga0500643_004459
718 Ga0500647_0108547
719 Ga0500651_0024900
720 Ga0500641_0001162
721 Ga0500641_0041622
722 Ga0500555_033640
723 Ga0500556_0043884
724 Ga0500562_001120
725 Ga0500569_006794
726 Ga0500595_028510
727 Ga0500597_137653
728 Ga0500607_046364
729 Ga0500607_048060
730 Ga0500608_001672
731 Ga0500614_004086
732 Ga0500658_0092828
733 Ga0500559_0044219
734 Ga0500559_0087922
735 Ga0500590_025148
736 Ga0500603_013205
737 Ga0500604_0210002
738 Ga0500638_083299
739 Ga0500636_0032671
740 Ga0500637_0017682
741 Ga0500637_0020235
742 Ga0500625_006690
743 Ga0500645_001636
744 Ga0500596_013992
745 Ga0501084_0099575
746 2554816528
747 2608380159
748 2808941851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

47

195

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

47

217

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.9732 4 177
1x77-assembly1.cif.gz_B crystal structure of a nad(p)h-dependent fmn reductase complexed with fmn 0.9623 4 177
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.9584 2 180
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.9573 2 180
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.9572 2 180
ID Description Score Start End Superfamily
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9732 4 177 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9623 4 177 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9545 4 180 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.929 4 180 3.40.50.360
af_P95105_3_183_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9161 2 178 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A316TZH3-F1-model_v4 FMN reductase 0.9969 4 180 GO:0005829
GO:0010181
GO:0016491
AF-A0A8B5XFN3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9884 4 180 GO:0005829
GO:0010181
GO:0016491
AF-A0A6I6MWA1-F1-model_v4 NADPH azoreductase (EC 1.7.1.6) 0.9875 1 182 GO:0005829
GO:0010181
GO:0050446
AF-H5SSP8-F1-model_v4 Hypothetical conserved protein 0.9872 4 182 GO:0005829
GO:0010181
GO:0016491
AF-A0A3N5FUF9-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9868 46 180 GO:0005829
GO:0010181
GO:0016491

Map