F425984

General Info

Members Datasets Scaffolds Average Seq Length
372 210 353 364

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100000807|Ga0068853_10000080725
Length 386
Sequence MGHFGLPRNAKWTSFPKRMNKADFTETTQADDRSILLTGSLSLSCLGDVPGRLEALDGRVTRIDLSQVEHIDTVGAWIVRRTADRLDAQVVGAGEDAGRLLEVIGRVDEPAEKPQPPQHPVFRILDQVGFAVSATGHTLVGLVGFLGAVLVSAFALIRHPSRFRINAVVQRFEVVGVSALAIIGLMSFLIGIVIAQQGSVQLEQFGMEVLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLNEEVDAMRTIGVSPMEALVMPRIIAAVVMMPLLGFYASILSIIGGGFLCAIALDIPPVTFVQRLREVVPLTDIWIGLIKAPVFGLIIGMAGCYQGLQVEGNAEEVGLRTTAAVVQAIFLVIVIDSVFAVFFTWLGWK

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
5 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
8 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
9 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
10 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
11 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
12 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
13 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
14 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
15 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
16 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
17 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
18 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
87 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
140 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
187 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
188 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
189 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
195 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
198 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
201 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
207 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
208 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.62
Metatranscriptomes 0.27
Isolates 5.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.28
Nodule 0
Rhizoplane 2.15
Rhizosphere 70.16
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000458 3300001976 Bacteria 5505
2 JGI24752J21851_1000516 3300001976 Bacteria 5180
3 JGI24748J21848_1000034 3300002074 Bacteria 74812
4 JGI24749J21850_1000890 3300002076 Bacteria 4305
5 JGI24749J21850_1001907 3300002076 Bacteria 2945
6 JGI24034J26672_10000018 3300002239 Bacteria 130180
7 JGI24751J29686_10000752 3300002459 Bacteria 7718
8 JGI25150J39212_1000098 3300002774 Bacteria 50282
9 JGI25153J46596_10000055 3300003215 Bacteria 135518
10 Ga0055526_1005096 3300003771 Bacteria 7665
11 Ga0055537_1001256 3300003773 Bacteria 10590
12 Ga0055536_1001153 3300003781 Bacteria 16531
13 Ga0055536_1002497 3300003781 Bacteria 10322
14 Ga0055536_1011531 3300003781 Bacteria 3378
15 Ga0055530_10000217 3300003791 Bacteria 51317
16 Ga0055530_10036446 3300003791 Bacteria 1237
17 Ga0055540_1001240 3300003792 Bacteria 15690
18 Ga0055531_10000571 3300003794 Bacteria 32223
19 Ga0065165_1002026 3300005262 Bacteria 18863
20 Ga0065165_1011279 3300005262 Bacteria 3751
21 Ga0065704_10079766 3300005289 Bacteria 4086
22 Ga0065707_10083008 3300005295 Bacteria 10896
23 Ga0065707_10090665 3300005295 Bacteria 4094
24 Ga0070690_100000008 3300005330 Bacteria 118441
25 Ga0070670_100000024 3300005331 Bacteria 189811
26 Ga0070670_100000280 3300005331 Bacteria 44818
27 Ga0070670_100009036 3300005331 Bacteria 8514
28 Ga0070670_100030553 3300005331 Bacteria 4639
29 Ga0070670_100397432 3300005331 Bacteria 1216
30 Ga0070677_10000880 3300005333 Bacteria 9899
31 Ga0070666_10000032 3300005335 Bacteria 129142
32 Ga0068868_100000019 3300005338 Bacteria 92673
33 Ga0070660_100010294 3300005339 Bacteria 6603
34 Ga0070689_100031480 3300005340 Bacteria 4031
35 Ga0070668_100000015 3300005347 Bacteria 106650
36 Ga0070669_100000031 3300005353 Bacteria 154042
37 Ga0070669_100000211 3300005353 Bacteria 48717
38 Ga0070669_100008139 3300005353 Bacteria 7489
39 Ga0070671_100000382 3300005355 Bacteria 30575
40 Ga0070671_100002103 3300005355 Bacteria 15362
41 Ga0070671_100045002 3300005355 Bacteria 3668
42 Ga0070688_100000278 3300005365 Bacteria 26547
43 Ga0070659_100000009 3300005366 Bacteria 203891
44 Ga0070667_100000017 3300005367 Bacteria 230531
45 Ga0070667_100000423 3300005367 Bacteria 44812
46 Ga0070667_100001630 3300005367 Bacteria 20097
47 Ga0070667_100098019 3300005367 Bacteria 2529
48 Ga0070667_100211123 3300005367 Bacteria 1725
49 Ga0070678_100121031 3300005456 Bacteria 2064
50 Ga0070685_10000046 3300005466 Bacteria 73999
51 Ga0068853_100000807 3300005539 Bacteria 21805
52 Ga0068853_100080312 3300005539 Bacteria 2853
53 Ga0068853_100101438 3300005539 Bacteria 2545
54 Ga0070686_100000030 3300005544 Bacteria 118308
55 Ga0070686_100000059 3300005544 Bacteria 84781
56 Ga0070665_100000056 3300005548 Bacteria 242622
57 Ga0070665_100000541 3300005548 Bacteria 53057
58 Ga0068855_100097202 3300005563 Bacteria 3392
59 Ga0068857_100031949 3300005577 Bacteria 4653
60 Ga0068854_100004487 3300005578 Bacteria 8800
61 Ga0068854_100009869 3300005578 Bacteria 6175
62 Ga0068854_100102846 3300005578 Bacteria 2144
63 Ga0068859_100002489 3300005617 Bacteria 18745
64 Ga0068859_100014948 3300005617 Bacteria 7790
65 Ga0068859_100021467 3300005617 Bacteria 6481
66 Ga0068859_100027950 3300005617 Bacteria 5655
67 Ga0068859_100055639 3300005617 Bacteria 3981
68 Ga0068859_100076705 3300005617 Bacteria 3383
69 Ga0068864_100000036 3300005618 Bacteria 189811
70 Ga0068864_100000264 3300005618 Bacteria 46968
71 Ga0068864_100000601 3300005618 Bacteria 30536
72 Ga0068864_100015745 3300005618 Bacteria 6290
73 Ga0068864_100016732 3300005618 Bacteria 6111
74 Ga0068861_100002677 3300005719 Bacteria 11668
75 Ga0068861_100027776 3300005719 Bacteria 4125
76 Ga0068863_100000065 3300005841 Bacteria 117925
77 Ga0068863_100000385 3300005841 Bacteria 44821
78 Ga0068863_100008224 3300005841 Bacteria 10193
79 Ga0068863_100017154 3300005841 Bacteria 6944
80 Ga0068858_100000170 3300005842 Bacteria 69171
81 Ga0068858_100001965 3300005842 Bacteria 20997
82 Ga0068858_100002781 3300005842 Bacteria 17585
83 Ga0068858_100005370 3300005842 Bacteria 12561
84 Ga0068858_100087864 3300005842 Bacteria 2891
85 Ga0068860_100000056 3300005843 Bacteria 202751
86 Ga0068860_100000132 3300005843 Bacteria 120657
87 Ga0068860_100001855 3300005843 Bacteria 22486
88 Ga0068860_100059203 3300005843 Bacteria 3642
89 Ga0068860_100347181 3300005843 Bacteria 1460
90 Ga0068862_100000043 3300005844 Bacteria 164356
91 Ga0068862_100000108 3300005844 Bacteria 99413
92 Ga0068862_100000193 3300005844 Bacteria 67697
93 Ga0068862_100000356 3300005844 Bacteria 49670
94 Ga0068862_100000398 3300005844 Bacteria 46968
95 Ga0068862_100010131 3300005844 Bacteria 7780
96 Ga0068862_100063650 3300005844 Bacteria 3173
97 Ga0081455_10001853 3300005937 Bacteria 25446
98 Ga0075366_10004887 3300006195 Bacteria 7230
99 Ga0075434_100137421 3300006871 Bacteria 2463
100 Ga0097620_100002489 3300006931 Bacteria 18745
101 Ga0097620_100014948 3300006931 Bacteria 7790
102 Ga0097620_100021468 3300006931 Bacteria 6481
103 Ga0097620_100027948 3300006931 Bacteria 5655
104 Ga0097620_100055641 3300006931 Bacteria 3981
105 Ga0097620_100076703 3300006931 Bacteria 3383
106 Ga0105251_10000522 3300009011 Bacteria 36283
107 Ga0105240_10403567 3300009093 Bacteria 1539
108 Ga0105245_10001533 3300009098 Bacteria 20938
109 Ga0105245_10002368 3300009098 Bacteria 17040
110 Ga0105247_10001277 3300009101 Bacteria 18591
111 Ga0105247_10002857 3300009101 Bacteria 11515
112 Ga0105247_10047984 3300009101 Bacteria 2623
113 Ga0105248_10000029 3300009177 Bacteria 223366
114 Ga0105248_10000081 3300009177 Bacteria 111105
115 Ga0105248_10039068 3300009177 Bacteria 5314
116 Ga0105248_10041961 3300009177 Bacteria 5130
117 Ga0105248_10052155 3300009177 Bacteria 4591
118 Ga0105237_10076139 3300009545 Bacteria 3346
119 Ga0105238_10069309 3300009551 Bacteria 3527
120 Ga0105238_10153595 3300009551 Bacteria 2277
121 Ga0105249_10000002 3300009553 Bacteria 376207
122 Ga0105249_10000024 3300009553 Bacteria 232947
123 Ga0105239_10422282 3300010375 Bacteria 1511
124 Ga0157371_10041572 3300013102 Bacteria 3280
125 Ga0163162_10009197 3300013306 Bacteria 9617
126 Ga0163162_10010243 3300013306 Bacteria 9107
127 Ga0163162_10065021 3300013306 Bacteria 3693
128 Ga0163162_10099728 3300013306 Bacteria 2995
129 Ga0163163_10022162 3300014325 Bacteria 6009
130 Ga0163163_10035614 3300014325 Bacteria 4829
131 Ga0163163_10237554 3300014325 Bacteria 1872
132 Ga0157380_10000193 3300014326 Bacteria 35569
133 Ga0157380_10001148 3300014326 Bacteria 17105
134 Ga0157380_10065351 3300014326 Bacteria 2924
135 Ga0157379_10013958 3300014968 Bacteria 7041
136 Ga0157379_10028400 3300014968 Bacteria 4975
137 Ga0157379_10032968 3300014968 Bacteria 4619
138 Ga0163161_10000084 3300017792 Bacteria 93742
139 Ga0213875_10000290 3300021388 Bacteria 48577
140 Ga0207672_1000296 3300025223 Bacteria 6734
141 Ga0209437_104896 3300025233 Bacteria 2323
142 Ga0207425_1000005 3300025245 Bacteria 900502
143 Ga0209129_1002908 3300025258 Bacteria 7867
144 Ga0209233_1000107 3300025261 Bacteria 267399
145 Ga0209565_1000052 3300025263 Bacteria 212056
146 Ga0209675_1000082 3300025291 Bacteria 153550
147 Ga0209676_1000372 3300025292 Bacteria 83114
148 Ga0209676_1000424 3300025292 Bacteria 74314
149 Ga0209676_1000670 3300025292 Bacteria 48733
150 Ga0209676_1013087 3300025292 Bacteria 3210
151 Ga0209676_1041437 3300025292 Bacteria 1287
152 Ga0209025_1000873 3300025294 Bacteria 47373
153 Ga0209564_1000697 3300025295 Bacteria 49186
154 Ga0209758_1000002 3300025297 Bacteria 1400310
155 Ga0209758_1043527 3300025297 Bacteria 1653
156 Ga0209050_1000001 3300025298 Bacteria 3563507
157 Ga0209050_1000017 3300025298 Bacteria 728928
158 Ga0209050_1000166 3300025298 Bacteria 152073
159 Ga0209050_1001081 3300025298 Bacteria 33282
160 Ga0209050_1035052 3300025298 Bacteria 1490
161 Ga0209051_1001966 3300025303 Bacteria 15798
162 Ga0209257_1000151 3300025304 Bacteria 191408
163 Ga0209257_1000202 3300025304 Bacteria 147246
164 Ga0209257_1002495 3300025304 Bacteria 18169
165 Ga0209257_1011818 3300025304 Bacteria 4138
166 Ga0207656_10055681 3300025321 Bacteria 1722
167 Ga0207713_1012760 3300025735 Bacteria 4469
168 Ga0207682_10000110 3300025893 Bacteria 37556
169 Ga0207710_10002031 3300025900 Bacteria 9617
170 Ga0207710_10007307 3300025900 Bacteria 4680
171 Ga0207680_10000009 3300025903 Bacteria 464571
172 Ga0207645_10065873 3300025907 Bacteria 2315
173 Ga0207671_10001674 3300025914 Bacteria 25176
174 Ga0207657_10006324 3300025919 Bacteria 12306
175 Ga0207681_10000014 3300025923 Bacteria 353422
176 Ga0207681_10000965 3300025923 Bacteria 18765
177 Ga0207681_10006149 3300025923 Bacteria 7365
178 Ga0207650_10000015 3300025925 Bacteria 369173
179 Ga0207650_10000162 3300025925 Bacteria 81071
180 Ga0207687_10026036 3300025927 Bacteria 3916
181 Ga0207644_10000066 3300025931 Bacteria 76450
182 Ga0207644_10022796 3300025931 Bacteria 4280
183 Ga0207690_10000022 3300025932 Bacteria 215772
184 Ga0207711_10000004 3300025941 Bacteria 870636
185 Ga0207711_10001781 3300025941 Bacteria 19721
186 Ga0207711_10003444 3300025941 Bacteria 13689
187 Ga0207711_10004477 3300025941 Bacteria 11910
188 Ga0207711_10038588 3300025941 Bacteria 4062
189 Ga0207689_10207048 3300025942 Bacteria 1620
190 Ga0207661_10192666 3300025944 Bacteria 1788
191 Ga0207667_10129047 3300025949 Bacteria 2604
192 Ga0207712_10000002 3300025961 Bacteria 706628
193 Ga0207712_10000034 3300025961 Bacteria 202320
194 Ga0207712_10000046 3300025961 Bacteria 162468
195 Ga0207668_10000012 3300025972 Bacteria 182541
196 Ga0207640_10002624 3300025981 Bacteria 9637
197 Ga0207640_10035346 3300025981 Bacteria 3126
198 Ga0207658_10000011 3300025986 Bacteria 239620
199 Ga0207658_10000436 3300025986 Bacteria 39447
200 Ga0207658_10000784 3300025986 Bacteria 27123
201 Ga0207677_10000124 3300026023 Bacteria 63564
202 Ga0207703_10000474 3300026035 Bacteria 42009
203 Ga0207703_10000897 3300026035 Bacteria 29134
204 Ga0207703_10001742 3300026035 Bacteria 19487
205 Ga0207703_10005251 3300026035 Bacteria 10446
206 Ga0207703_10183169 3300026035 Bacteria 1849
207 Ga0207639_10006353 3300026041 Bacteria 8027
208 Ga0207639_10089874 3300026041 Bacteria 2455
209 Ga0207639_10093627 3300026041 Bacteria 2410
210 Ga0207639_10217172 3300026041 Bacteria 1649
211 Ga0207641_10000063 3300026088 Bacteria 159283
212 Ga0207641_10000228 3300026088 Bacteria 72357
213 Ga0207641_10000479 3300026088 Bacteria 45166
214 Ga0207641_10003880 3300026088 Bacteria 13083
215 Ga0207641_10006104 3300026088 Bacteria 10196
216 Ga0207676_10000021 3300026095 Bacteria 296572
217 Ga0207676_10000036 3300026095 Bacteria 198447
218 Ga0207676_10000198 3300026095 Bacteria 52610
219 Ga0207676_10003249 3300026095 Bacteria 11573
220 Ga0207676_10004785 3300026095 Bacteria 9604
221 Ga0207674_10012874 3300026116 Bacteria 9334
222 Ga0207674_10014244 3300026116 Bacteria 8788
223 Ga0207674_10020376 3300026116 Bacteria 7164
224 Ga0207674_10043138 3300026116 Bacteria 4653
225 Ga0207675_100000126 3300026118 Bacteria 63505
226 Ga0207675_100000167 3300026118 Bacteria 58637
227 Ga0207675_100008464 3300026118 Bacteria 9691
228 Ga0207683_10155898 3300026121 Bacteria 2063
229 Ga0207698_10295280 3300026142 Bacteria 1506
230 Ga0268266_10000066 3300028379 Bacteria 242637
231 Ga0268266_10043581 3300028379 Bacteria 3835
232 Ga0268266_10173822 3300028379 Bacteria 1957
233 Ga0268265_10000013 3300028380 Bacteria 341536
234 Ga0268265_10000048 3300028380 Bacteria 178523
235 Ga0268265_10000129 3300028380 Bacteria 96060
236 Ga0268265_10000386 3300028380 Bacteria 46975
237 Ga0268265_10000442 3300028380 Bacteria 43732
238 Ga0268265_10002972 3300028380 Bacteria 12401
239 Ga0268264_10000089 3300028381 Bacteria 234760
240 Ga0268264_10000130 3300028381 Bacteria 181732
241 Ga0268264_10001096 3300028381 Bacteria 26739
242 Ga0268264_10320686 3300028381 Bacteria 1465
243 Ga0307513_10008536 3300031456 Bacteria 13092
244 Ga0307509_10020309 3300031507 Bacteria 7537
245 Ga0307508_10000286 3300031616 Bacteria 62006
246 Ga0316579_10026379 3300031691 Bacteria 2631
247 Ga0307406_10165924 3300031901 Bacteria 1593
248 Ga0307412_10000289 3300031911 Bacteria 31935
249 Ga0307412_10019289 3300031911 Bacteria 4125
250 Ga0307412_10045819 3300031911 Bacteria 2861
251 Ga0307412_10076292 3300031911 Bacteria 2302
252 Ga0307414_10060420 3300032004 Bacteria 2680
253 Ga0307510_10003983 3300033180 Bacteria 17300
254 Ga0307510_10029376 3300033180 Bacteria 6259
255 Ga0316582_0015883 3300036647 Bacteria 4318
256 Ga0237819_01101 3300038705 Bacteria 7913
257 Ga0237816_00448 3300039145 Bacteria 3502
258 Ga0439461_0000078 3300041410 Bacteria 12801
259 Ga0439461_0010533 3300041410 Bacteria 1699
260 Ga0439465_0010359 3300041413 Bacteria 2930
261 Ga0439445_0016442 3300042004 Bacteria 1819
262 Ga0439452_010969 3300042010 Bacteria 2618
263 Ga0439434_0015182 3300042435 Bacteria 2296
264 Ga0495627_015192 3300046453 Bacteria 2663
265 Ga0495638_0000048 3300046460 Bacteria 209787
266 Ga0495583_0003966 3300046506 Bacteria 10930
267 Ga0495668_0000031 3300046616 Bacteria 256576
268 Ga0495668_0037578 3300046616 Bacteria 2709
269 Ga0495668_0040014 3300046616 Bacteria 2616
270 Ga0495625_0000031 3300046660 Bacteria 238193
271 Ga0495625_0000115 3300046660 Bacteria 122861
272 Ga0495625_0012573 3300046660 Bacteria 6851
273 Ga0495625_0087453 3300046660 Bacteria 2160
274 Ga0495670_0000047 3300046691 Bacteria 65608
275 Ga0495671_0005608 3300046692 Bacteria 7325
276 Ga0495649_0154662 3300046694 Bacteria 1204
277 Ga0495677_0001119 3300047445 Bacteria 10726
278 Ga0495673_0009065 3300047469 Bacteria 5529
279 Ga0495681_0030968 3300047470 Bacteria 2716
280 Ga0495686_0000342 3300047472 Bacteria 76743
281 Ga0496101_0123295 3300048904 Bacteria 1961
282 Ga0496102_0133284 3300048905 Bacteria 2327
283 Ga0496103_0000788 3300048906 Bacteria 23326
284 Ga0496104_0034967 3300048907 Bacteria 4689
285 Ga0496105_0026161 3300048908 Bacteria 4757
286 Ga0496115_0000333 3300048918 Bacteria 40158
287 Ga0496116_0070867 3300048919 Bacteria 2210
288 Ga0496117_0002815 3300048920 Bacteria 21183
289 Ga0496117_0010678 3300048920 Bacteria 8316
290 Ga0496118_0000335 3300048921 Bacteria 80253
291 Ga0496118_0008568 3300048921 Bacteria 10533
292 Ga0496119_0005963 3300048922 Bacteria 11457
293 Ga0496120_0037400 3300048923 Bacteria 2881
294 Ga0496122_0265652 3300048925 Bacteria 949
295 Ga0496123_0028537 3300048926 Bacteria 4128
296 Ga0496123_0107935 3300048926 Bacteria 1600
297 Ga0496124_0000116 3300048927 Bacteria 164788
298 Ga0496124_0002381 3300048927 Bacteria 24765
299 Ga0496124_0009859 3300048927 Bacteria 9769
300 Ga0496125_0025306 3300048928 Bacteria 5438
301 Ga0496125_0103991 3300048928 Bacteria 2082
302 Ga0496125_0129766 3300048928 Bacteria 1777
303 Ga0501307_003534 3300049162 Bacteria 1538
304 Ga0501300_010108 3300049523 Bacteria 1377
305 Ga0501031_0028191 3300049568 Bacteria 3661
306 Ga0501032_0055559 3300049569 Bacteria 2663
307 Ga0501033_0098920 3300049570 Bacteria 2130
308 Ga0501034_0045002 3300049571 Bacteria 4461
309 Ga0501036_0013341 3300049572 Bacteria 6825
310 Ga0501037_0043909 3300049573 Bacteria 3284
311 Ga0501038_0019210 3300049574 Bacteria 6163
312 Ga0501039_0034502 3300049575 Bacteria 3904
313 Ga0501043_0023322 3300049579 Bacteria 4853
314 Ga0501043_0024044 3300049579 Bacteria 4781
315 Ga0501043_0026143 3300049579 Bacteria 4579
316 Ga0501047_0009300 3300049581 Bacteria 9281
317 Ga0501047_0049414 3300049581 Bacteria 4061
318 Ga0501048_0021911 3300049582 Bacteria 4677
319 Ga0501223_010468 3300049663 Bacteria 1865
320 Ga0501249_001689 3300049679 Bacteria 4501
321 Ga0501257_000048 3300049686 Bacteria 33778
322 Ga0501241_008852 3300049758 Bacteria 1835
323 Ga0501035_0077534 3300049822 Bacteria 2936
324 Ga0501044_0029416 3300049823 Bacteria 5793
325 nmdc:mga0k408_155694_c1 3300050493 Bacteria 1361
326 Ga0500643_000788 3300053087 Bacteria 20556
327 Ga0500643_003060 3300053087 Bacteria 8241
328 Ga0500643_003694 3300053087 Bacteria 7214
329 Ga0500643_008453 3300053087 Bacteria 4041
330 Ga0500646_0011612 3300053090 Bacteria 2266
331 Ga0500566_0000089 3300053094 Bacteria 45622
332 Ga0500556_0000217 3300053104 Bacteria 46762
333 Ga0500592_000609 3300053116 Bacteria 5867
334 Ga0500592_000617 3300053116 Bacteria 5821
335 Ga0500594_0014218 3300053118 Bacteria 1903
336 Ga0500595_000642 3300053119 Bacteria 20986
337 Ga0500642_0000001 3300053130 Bacteria 1468402
338 Ga0500559_0002376 3300053136 Bacteria 9811
339 Ga0500568_0001346 3300053139 Bacteria 16031
340 Ga0500568_0006051 3300053139 Bacteria 6141
341 Ga0500568_0008976 3300053139 Bacteria 4777
342 Ga0500573_0000010 3300053140 Bacteria 210704
343 Ga0500604_0000007 3300053151 Bacteria 115773
344 Ga0500604_0022742 3300053151 Bacteria 1783
345 Ga0500616_0000080 3300053153 Bacteria 200381
346 Ga0500616_0006010 3300053153 Bacteria 8078
347 Ga0500616_0058741 3300053153 Bacteria 2000
348 Ga0500624_000375 3300053157 Bacteria 14328
349 Ga0500627_0000003 3300053158 Bacteria 178186
350 Ga0500636_0004435 3300053177 Bacteria 7942
351 Ga0500636_0017112 3300053177 Bacteria 4276
352 Ga0500645_000148 3300053730 Bacteria 54683
353 Ga0500645_000329 3300053730 Bacteria 33762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0265652 Ga0496122_0265652_20_934 286
2 3300032004 Ga0307414_10060420 Ga0307414_100604202 324
3 3300025907 Ga0207645_10065873 Ga0207645_100658732 329
4 3300031507 Ga0307509_10020309 Ga0307509_100203095 331
5 3300031616 Ga0307508_10000286 Ga0307508_1000028617 332
6 3300048905 Ga0496102_0133284 Ga0496102_0133284_1086_2093 332
7 3300005577 Ga0068857_100031949 Ga0068857_1000319494 335
8 3300009551 Ga0105238_10153595 Ga0105238_101535951 335
9 3300026116 Ga0207674_10043138 Ga0207674_100431383 335
10 3300049579 Ga0501043_0023322 Ga0501043_0023322_635_1702 336
11 3300048928 Ga0496125_0103991 Ga0496125_0103991_886_1911 339
12 3300009551 Ga0105238_10069309 Ga0105238_100693093 341
13 3300025942 Ga0207689_10207048 Ga0207689_102070482 342
14 3300006195 Ga0075366_10004887 Ga0075366_100048873 344
15 3300049523 Ga0501300_010108 Ga0501300_010108_205_1305 344
16 3300049663 Ga0501223_010468 Ga0501223_010468_21_1121 344
17 3300049686 Ga0501257_000048 Ga0501257_000048_2417_3517 344
18 3300050493 nmdc:mga0k408_155694_c1 nmdc:mga0k408_155694_c1_92_1189 344
19 3300053087 Ga0500643_000788 Ga0500643_000788_18662_19759 344
20 3300048928 Ga0496125_0129766 Ga0496125_0129766_627_1670 345
21 3300005331 Ga0070670_100009036 Ga0070670_1000090365 346
22 3300005347 Ga0070668_100000015 Ga0070668_100000015118 346
23 3300005355 Ga0070671_100000382 Ga0070671_10000038231 346
24 3300005367 Ga0070667_100000017 Ga0070667_100000017148 346
25 3300005617 Ga0068859_100076705 Ga0068859_1000767054 346
26 3300005618 Ga0068864_100000601 Ga0068864_10000060127 346
27 3300005841 Ga0068863_100017154 Ga0068863_1000171545 346
28 3300005842 Ga0068858_100001965 Ga0068858_1000019657 346
29 3300005843 Ga0068860_100000056 Ga0068860_10000005696 346
30 3300005844 Ga0068862_100000108 Ga0068862_1000001083 346
31 3300006931 Ga0097620_100076703 Ga0097620_1000767034 346
32 3300025931 Ga0207644_10000066 Ga0207644_1000006624 346
33 3300025972 Ga0207668_10000012 Ga0207668_1000001294 346
34 3300025986 Ga0207658_10000011 Ga0207658_1000001195 346
35 3300026035 Ga0207703_10000474 Ga0207703_1000047439 346
36 3300026088 Ga0207641_10000228 Ga0207641_1000022812 346
37 3300026088 Ga0207641_10003880 Ga0207641_100038801 346
38 3300026095 Ga0207676_10004785 Ga0207676_100047856 346
39 3300028380 Ga0268265_10000442 Ga0268265_100004427 346
40 3300028381 Ga0268264_10000089 Ga0268264_10000089155 346
41 3300046694 Ga0495649_0154662 Ga0495649_0154662_62_1177 346
42 3300049162 Ga0501307_003534 Ga0501307_003534_26_1123 346
43 3300049581 Ga0501047_0009300 Ga0501047_0009300_4724_5821 346
44 3300049679 Ga0501249_001689 Ga0501249_001689_2639_3772 346
45 3300053177 Ga0500636_0004435 Ga0500636_0004435_2726_3841 347
46 3300003781 Ga0055536_1011531 Ga0055536_10115313 348
47 3300005578 Ga0068854_100004487 Ga0068854_1000044874 348
48 3300025292 Ga0209676_1000670 Ga0209676_10006708 348
49 3300025981 Ga0207640_10035346 Ga0207640_100353464 348
50 3300031911 Ga0307412_10019289 Ga0307412_100192894 348
51 3300048918 Ga0496115_0000333 Ga0496115_0000333_17357_18469 349
52 3300053116 Ga0500592_000609 Ga0500592_000609_3513_4619 353
53 3300053151 Ga0500604_0022742 Ga0500604_0022742_488_1594 353
54 3300053158 Ga0500627_0000003 Ga0500627_0000003_65556_66662 353
55 3300005262 Ga0065165_1002026 Ga0065165_100202612 357
56 3300028379 Ga0268266_10173822 Ga0268266_101738222 357
57 3300041410 Ga0439461_0000078 Ga0439461_0000078_2574_3683 357
58 3300048926 Ga0496123_0107935 Ga0496123_0107935_112_1221 357
59 3300053094 Ga0500566_0000089 Ga0500566_0000089_42369_43478 357
60 3300005842 Ga0068858_100000170 Ga0068858_10000017014 358
61 3300026035 Ga0207703_10000897 Ga0207703_1000089714 358
62 3300041410 Ga0439461_0010533 Ga0439461_0010533_73_1182 358
63 3300041413 Ga0439465_0010359 Ga0439465_0010359_572_1681 358
64 3300042004 Ga0439445_0016442 Ga0439445_0016442_23_1132 358
65 3300042010 Ga0439452_010969 Ga0439452_010969_690_1799 358
66 3300042435 Ga0439434_0015182 Ga0439434_0015182_988_2097 358
67 3300046453 Ga0495627_015192 Ga0495627_015192_180_1289 358
68 3300047470 Ga0495681_0030968 Ga0495681_0030968_564_1682 358
69 3300048928 Ga0496125_0025306 Ga0496125_0025306_2054_3163 358
70 3300053119 Ga0500595_000642 Ga0500595_000642_8896_10008 358
71 3300053140 Ga0500573_0000010 Ga0500573_0000010_89450_90559 358
72 3300002774 JGI25150J39212_1000098 JGI25150J39212_100009819 360
73 3300003215 JGI25153J46596_10000055 JGI25153J46596_10000055117 360
74 3300003771 Ga0055526_1005096 Ga0055526_10050966 360
75 3300003773 Ga0055537_1001256 Ga0055537_10012566 360
76 3300003791 Ga0055530_10036446 Ga0055530_100364461 360
77 3300003792 Ga0055540_1001240 Ga0055540_10012404 360
78 3300005617 Ga0068859_100002489 Ga0068859_1000024894 360
79 3300006931 Ga0097620_100002489 Ga0097620_1000024894 360
80 3300014968 Ga0157379_10032968 Ga0157379_100329684 360
81 3300025245 Ga0207425_1000005 Ga0207425_1000005584 360
82 3300025258 Ga0209129_1002908 Ga0209129_10029082 360
83 3300025263 Ga0209565_1000052 Ga0209565_100005236 360
84 3300025292 Ga0209676_1013087 Ga0209676_10130873 360
85 3300025294 Ga0209025_1000873 Ga0209025_100087344 360
86 3300025295 Ga0209564_1000697 Ga0209564_10006978 360
87 3300025297 Ga0209758_1000002 Ga0209758_1000002760 360
88 3300025297 Ga0209758_1043527 Ga0209758_10435272 360
89 3300025298 Ga0209050_1000001 Ga0209050_1000001745 360
90 3300025298 Ga0209050_1000166 Ga0209050_100016692 360
91 3300025303 Ga0209051_1001966 Ga0209051_100196614 360
92 3300025304 Ga0209257_1011818 Ga0209257_10118184 360
93 3300025941 Ga0207711_10038588 Ga0207711_100385882 360
94 3300005719 Ga0068861_100002677 Ga0068861_1000026777 361
95 3300026118 Ga0207675_100000126 Ga0207675_1000001267 361
96 iso_pu_bacteria 2643221541 2643730709 361
97 iso_pu_bacteria 2643221605 2644040363 361
98 iso_pu_bacteria 2643221606 2644044637 361
99 iso_pu_bacteria 2643221671 2644391438 361
100 iso_pu_bacteria 2885429604 2885432784 361
101 iso_pu_bacteria 8057101203 8057102040 361
102 3300038705 Ga0237819_01101 Ga0237819_01101_2246_3355 362
103 3300039145 Ga0237816_00448 Ga0237816_00448_892_2001 362
104 iso_pu_bacteria 2643221563 2643834007 363
105 iso_pu_bacteria 2643221608 2644054933 363
106 iso_pu_bacteria 2852653556 2852654541 363
107 iso_pu_bacteria 2852680915 2852684045 363
108 3300002076 JGI24749J21850_1000890 JGI24749J21850_10008905 364
109 3300002459 JGI24751J29686_10000752 JGI24751J29686_100007526 364
110 3300005295 Ga0065707_10090665 Ga0065707_100906654 364
111 3300005331 Ga0070670_100000024 Ga0070670_100000024129 364
112 3300005353 Ga0070669_100000031 Ga0070669_10000003110 364
113 3300005367 Ga0070667_100001630 Ga0070667_10000163018 364
114 3300005617 Ga0068859_100014948 Ga0068859_1000149483 364
115 3300005618 Ga0068864_100000036 Ga0068864_100000036130 364
116 3300005844 Ga0068862_100000043 Ga0068862_10000004327 364
117 3300006931 Ga0097620_100014948 Ga0097620_1000149483 364
118 3300009177 Ga0105248_10000081 Ga0105248_10000081105 364
119 3300014325 Ga0163163_10022162 Ga0163163_100221625 364
120 3300014326 Ga0157380_10000193 Ga0157380_1000019312 364
121 3300021388 Ga0213875_10000290 Ga0213875_1000029033 364
122 3300025923 Ga0207681_10000014 Ga0207681_10000014215 364
123 3300025925 Ga0207650_10000015 Ga0207650_10000015230 364
124 3300025941 Ga0207711_10003444 Ga0207711_100034449 364
125 3300026095 Ga0207676_10000021 Ga0207676_10000021172 364
126 3300026118 Ga0207675_100008464 Ga0207675_1000084643 364
127 3300028380 Ga0268265_10000013 Ga0268265_10000013143 364
128 3300046692 Ga0495671_0005608 Ga0495671_0005608_3399_4496 364
129 3300047469 Ga0495673_0009065 Ga0495673_0009065_3695_4795 364
130 3300047472 Ga0495686_0000342 Ga0495686_0000342_43523_44623 364
131 3300048922 Ga0496119_0005963 Ga0496119_0005963_4553_5653 364
132 3300049570 Ga0501033_0098920 Ga0501033_0098920_455_1555 364
133 3300049579 Ga0501043_0024044 Ga0501043_0024044_2366_3466 364
134 3300049582 Ga0501048_0021911 Ga0501048_0021911_1309_2406 364
135 3300049823 Ga0501044_0029416 Ga0501044_0029416_4608_5708 364
136 3300053118 Ga0500594_0014218 Ga0500594_0014218_592_1689 364
137 iso_pu_bacteria 2599185359 2600227214 364
138 iso_pu_bacteria 2643221622 2644127541 364
139 iso_pu_bacteria 2751185897 2753766896 364
140 iso_pu_bacteria 2818991466 2819715292 364
141 iso_pu_bacteria 2848297114 2848297639 364
142 iso_pu_bacteria 2879163058 2879163204 364
143 iso_pu_bacteria 2928526807 2928530728 364
144 iso_pu_bacteria 2928968154 2928972497 364
145 3300003781 Ga0055536_1001153 Ga0055536_10011531 366
146 3300003781 Ga0055536_1002497 Ga0055536_10024978 366
147 3300003791 Ga0055530_10000217 Ga0055530_1000021728 366
148 3300003794 Ga0055531_10000571 Ga0055531_1000057117 366
149 3300009098 Ga0105245_10002368 Ga0105245_1000236811 366
150 3300025233 Ga0209437_104896 Ga0209437_1048963 366
151 3300025261 Ga0209233_1000107 Ga0209233_100010723 366
152 3300025291 Ga0209675_1000082 Ga0209675_100008268 366
153 3300025292 Ga0209676_1000372 Ga0209676_100037228 366
154 3300025292 Ga0209676_1000424 Ga0209676_10004249 366
155 3300025292 Ga0209676_1041437 Ga0209676_10414372 366
156 3300025298 Ga0209050_1000017 Ga0209050_1000017610 366
157 3300025298 Ga0209050_1001081 Ga0209050_100108111 366
158 3300025298 Ga0209050_1035052 Ga0209050_10350522 366
159 3300025304 Ga0209257_1000151 Ga0209257_1000151108 366
160 3300025304 Ga0209257_1000202 Ga0209257_10002029 366
161 3300025304 Ga0209257_1002495 Ga0209257_10024956 366
162 3300031901 Ga0307406_10165924 Ga0307406_101659242 366
163 3300031911 Ga0307412_10076292 Ga0307412_100762923 366
164 3300046460 Ga0495638_0000048 Ga0495638_0000048_40505_41623 366
165 3300046616 Ga0495668_0000031 Ga0495668_0000031_123354_124460 366
166 3300046660 Ga0495625_0000031 Ga0495625_0000031_189534_190652 366
167 3300046660 Ga0495625_0000115 Ga0495625_0000115_120149_121255 366
168 3300049568 Ga0501031_0028191 Ga0501031_0028191_681_1787 366
169 3300049569 Ga0501032_0055559 Ga0501032_0055559_69_1175 366
170 3300049571 Ga0501034_0045002 Ga0501034_0045002_2578_3684 366
171 3300049572 Ga0501036_0013341 Ga0501036_0013341_4703_5809 366
172 3300049573 Ga0501037_0043909 Ga0501037_0043909_14_1120 366
173 3300049575 Ga0501039_0034502 Ga0501039_0034502_317_1423 366
174 3300049579 Ga0501043_0026143 Ga0501043_0026143_682_1788 366
175 3300049581 Ga0501047_0049414 Ga0501047_0049414_697_1803 366
176 3300049822 Ga0501035_0077534 Ga0501035_0077534_65_1171 366
177 3300053139 Ga0500568_0001346 Ga0500568_0001346_4865_5971 366
178 3300053139 Ga0500568_0006051 Ga0500568_0006051_3505_4623 366
179 3300053153 Ga0500616_0058741 Ga0500616_0058741_406_1524 366
180 3300001976 JGI24752J21851_1000458 JGI24752J21851_10004582 367
181 3300001976 JGI24752J21851_1000516 JGI24752J21851_10005164 367
182 3300002074 JGI24748J21848_1000034 JGI24748J21848_100003423 367
183 3300002076 JGI24749J21850_1001907 JGI24749J21850_10019073 367
184 3300002239 JGI24034J26672_10000018 JGI24034J26672_1000001829 367
185 3300005262 Ga0065165_1011279 Ga0065165_10112793 367
186 3300005289 Ga0065704_10079766 Ga0065704_100797663 367
187 3300005295 Ga0065707_10083008 Ga0065707_100830088 367
188 3300005330 Ga0070690_100000008 Ga0070690_10000000830 367
189 3300005331 Ga0070670_100000280 Ga0070670_10000028015 367
190 3300005331 Ga0070670_100030553 Ga0070670_1000305534 367
191 3300005331 Ga0070670_100397432 Ga0070670_1003974321 367
192 3300005333 Ga0070677_10000880 Ga0070677_100008806 367
193 3300005335 Ga0070666_10000032 Ga0070666_1000003293 367
194 3300005338 Ga0068868_100000019 Ga0068868_1000000198 367
195 3300005339 Ga0070660_100010294 Ga0070660_1000102943 367
196 3300005340 Ga0070689_100031480 Ga0070689_1000314804 367
197 3300005353 Ga0070669_100000211 Ga0070669_10000021137 367
198 3300005353 Ga0070669_100008139 Ga0070669_1000081392 367
199 3300005355 Ga0070671_100002103 Ga0070671_10000210311 367
200 3300005355 Ga0070671_100045002 Ga0070671_1000450024 367
201 3300005365 Ga0070688_100000278 Ga0070688_1000002789 367
202 3300005366 Ga0070659_100000009 Ga0070659_10000000963 367
203 3300005367 Ga0070667_100000423 Ga0070667_10000042315 367
204 3300005367 Ga0070667_100098019 Ga0070667_1000980191 367
205 3300005367 Ga0070667_100211123 Ga0070667_1002111231 367
206 3300005456 Ga0070678_100121031 Ga0070678_1001210312 367
207 3300005466 Ga0070685_10000046 Ga0070685_100000464 367
208 3300005539 Ga0068853_100000807 Ga0068853_10000080725 367
209 3300005539 Ga0068853_100080312 Ga0068853_1000803122 367
210 3300005539 Ga0068853_100101438 Ga0068853_1001014382 367
211 3300005544 Ga0070686_100000030 Ga0070686_10000003095 367
212 3300005544 Ga0070686_100000059 Ga0070686_10000005926 367
213 3300005548 Ga0070665_100000056 Ga0070665_100000056165 367
214 3300005548 Ga0070665_100000541 Ga0070665_1000005417 367
215 3300005563 Ga0068855_100097202 Ga0068855_1000972023 367
216 3300005578 Ga0068854_100009869 Ga0068854_1000098695 367
217 3300005578 Ga0068854_100102846 Ga0068854_1001028462 367
218 3300005617 Ga0068859_100021467 Ga0068859_1000214674 367
219 3300005617 Ga0068859_100027950 Ga0068859_1000279503 367
220 3300005617 Ga0068859_100055639 Ga0068859_1000556393 367
221 3300005618 Ga0068864_100000264 Ga0068864_10000026415 367
222 3300005618 Ga0068864_100015745 Ga0068864_1000157457 367
223 3300005618 Ga0068864_100016732 Ga0068864_1000167323 367
224 3300005719 Ga0068861_100027776 Ga0068861_1000277764 367
225 3300005841 Ga0068863_100000065 Ga0068863_10000006532 367
226 3300005841 Ga0068863_100000385 Ga0068863_10000038515 367
227 3300005841 Ga0068863_100008224 Ga0068863_1000082247 367
228 3300005842 Ga0068858_100002781 Ga0068858_1000027813 367
229 3300005842 Ga0068858_100005370 Ga0068858_10000537011 367
230 3300005842 Ga0068858_100087864 Ga0068858_1000878642 367
231 3300005843 Ga0068860_100000132 Ga0068860_10000013234 367
232 3300005843 Ga0068860_100001855 Ga0068860_10000185520 367
233 3300005843 Ga0068860_100059203 Ga0068860_1000592034 367
234 3300005843 Ga0068860_100347181 Ga0068860_1003471812 367
235 3300005844 Ga0068862_100000193 Ga0068862_1000001934 367
236 3300005844 Ga0068862_100000356 Ga0068862_10000035632 367
237 3300005844 Ga0068862_100000398 Ga0068862_10000039833 367
238 3300005844 Ga0068862_100010131 Ga0068862_1000101311 367
239 3300005844 Ga0068862_100063650 Ga0068862_1000636502 367
240 3300005937 Ga0081455_10001853 Ga0081455_1000185325 367
241 3300006871 Ga0075434_100137421 Ga0075434_1001374212 367
242 3300006931 Ga0097620_100021468 Ga0097620_1000214684 367
243 3300006931 Ga0097620_100027948 Ga0097620_1000279483 367
244 3300006931 Ga0097620_100055641 Ga0097620_1000556413 367
245 3300009011 Ga0105251_10000522 Ga0105251_1000052210 367
246 3300009093 Ga0105240_10403567 Ga0105240_104035672 367
247 3300009098 Ga0105245_10001533 Ga0105245_1000153311 367
248 3300009101 Ga0105247_10001277 Ga0105247_100012775 367
249 3300009101 Ga0105247_10002857 Ga0105247_1000285710 367
250 3300009101 Ga0105247_10047984 Ga0105247_100479842 367
251 3300009177 Ga0105248_10000029 Ga0105248_10000029163 367
252 3300009177 Ga0105248_10039068 Ga0105248_100390685 367
253 3300009177 Ga0105248_10041961 Ga0105248_100419613 367
254 3300009177 Ga0105248_10052155 Ga0105248_100521552 367
255 3300009545 Ga0105237_10076139 Ga0105237_100761393 367
256 3300009553 Ga0105249_10000002 Ga0105249_1000000276 367
257 3300009553 Ga0105249_10000024 Ga0105249_10000024161 367
258 3300010375 Ga0105239_10422282 Ga0105239_104222821 367
259 3300013102 Ga0157371_10041572 Ga0157371_100415722 367
260 3300013306 Ga0163162_10009197 Ga0163162_100091978 367
261 3300013306 Ga0163162_10010243 Ga0163162_100102434 367
262 3300013306 Ga0163162_10065021 Ga0163162_100650214 367
263 3300013306 Ga0163162_10099728 Ga0163162_100997282 367
264 3300014325 Ga0163163_10035614 Ga0163163_100356142 367
265 3300014325 Ga0163163_10237554 Ga0163163_102375542 367
266 3300014326 Ga0157380_10001148 Ga0157380_100011483 367
267 3300014326 Ga0157380_10065351 Ga0157380_100653513 367
268 3300014968 Ga0157379_10013958 Ga0157379_100139587 367
269 3300014968 Ga0157379_10028400 Ga0157379_100284002 367
270 3300017792 Ga0163161_10000084 Ga0163161_1000008484 367
271 3300025223 Ga0207672_1000296 Ga0207672_10002962 367
272 3300025321 Ga0207656_10055681 Ga0207656_100556812 367
273 3300025735 Ga0207713_1012760 Ga0207713_10127602 367
274 3300025893 Ga0207682_10000110 Ga0207682_100001106 367
275 3300025900 Ga0207710_10002031 Ga0207710_1000203111 367
276 3300025900 Ga0207710_10007307 Ga0207710_100073072 367
277 3300025903 Ga0207680_10000009 Ga0207680_10000009356 367
278 3300025914 Ga0207671_10001674 Ga0207671_1000167421 367
279 3300025919 Ga0207657_10006324 Ga0207657_100063245 367
280 3300025923 Ga0207681_10000965 Ga0207681_1000096522 367
281 3300025923 Ga0207681_10006149 Ga0207681_100061494 367
282 3300025925 Ga0207650_10000162 Ga0207650_1000016268 367
283 3300025927 Ga0207687_10026036 Ga0207687_100260364 367
284 3300025931 Ga0207644_10022796 Ga0207644_100227964 367
285 3300025932 Ga0207690_10000022 Ga0207690_10000022182 367
286 3300025941 Ga0207711_10000004 Ga0207711_10000004344 367
287 3300025941 Ga0207711_10001781 Ga0207711_100017813 367
288 3300025941 Ga0207711_10004477 Ga0207711_100044772 367
289 3300025944 Ga0207661_10192666 Ga0207661_101926662 367
290 3300025949 Ga0207667_10129047 Ga0207667_101290473 367
291 3300025961 Ga0207712_10000002 Ga0207712_10000002448 367
292 3300025961 Ga0207712_10000034 Ga0207712_10000034161 367
293 3300025961 Ga0207712_10000046 Ga0207712_1000004644 367
294 3300025981 Ga0207640_10002624 Ga0207640_100026242 367
295 3300025986 Ga0207658_10000436 Ga0207658_100004367 367
296 3300025986 Ga0207658_10000784 Ga0207658_100007844 367
297 3300026023 Ga0207677_10000124 Ga0207677_100001248 367
298 3300026035 Ga0207703_10001742 Ga0207703_100017425 367
299 3300026035 Ga0207703_10005251 Ga0207703_1000525111 367
300 3300026035 Ga0207703_10183169 Ga0207703_101831691 367
301 3300026041 Ga0207639_10006353 Ga0207639_100063538 367
302 3300026041 Ga0207639_10089874 Ga0207639_100898742 367
303 3300026041 Ga0207639_10093627 Ga0207639_100936272 367
304 3300026041 Ga0207639_10217172 Ga0207639_102171722 367
305 3300026088 Ga0207641_10000063 Ga0207641_10000063129 367
306 3300026088 Ga0207641_10000479 Ga0207641_1000047931 367
307 3300026088 Ga0207641_10006104 Ga0207641_100061047 367
308 3300026095 Ga0207676_10000036 Ga0207676_1000003633 367
309 3300026095 Ga0207676_10000198 Ga0207676_1000019812 367
310 3300026095 Ga0207676_10003249 Ga0207676_100032496 367
311 3300026116 Ga0207674_10012874 Ga0207674_100128749 367
312 3300026116 Ga0207674_10014244 Ga0207674_100142444 367
313 3300026116 Ga0207674_10020376 Ga0207674_100203766 367
314 3300026118 Ga0207675_100000167 Ga0207675_10000016722 367
315 3300026121 Ga0207683_10155898 Ga0207683_101558982 367
316 3300026142 Ga0207698_10295280 Ga0207698_102952801 367
317 3300028379 Ga0268266_10000066 Ga0268266_1000006689 367
318 3300028379 Ga0268266_10043581 Ga0268266_100435814 367
319 3300028380 Ga0268265_10000048 Ga0268265_10000048179 367
320 3300028380 Ga0268265_10000129 Ga0268265_1000012930 367
321 3300028380 Ga0268265_10000386 Ga0268265_1000038632 367
322 3300028380 Ga0268265_10002972 Ga0268265_1000297210 367
323 3300028381 Ga0268264_10000130 Ga0268264_1000013063 367
324 3300028381 Ga0268264_10001096 Ga0268264_100010966 367
325 3300028381 Ga0268264_10320686 Ga0268264_103206862 367
326 3300031456 Ga0307513_10008536 Ga0307513_100085366 367
327 3300031691 Ga0316579_10026379 Ga0316579_100263793 367
328 3300031911 Ga0307412_10000289 Ga0307412_1000028924 367
329 3300031911 Ga0307412_10045819 Ga0307412_100458193 367
330 3300033180 Ga0307510_10003983 Ga0307510_100039834 367
331 3300033180 Ga0307510_10029376 Ga0307510_100293765 367
332 3300036647 Ga0316582_0015883 Ga0316582_0015883_1941_3053 367
333 3300046506 Ga0495583_0003966 Ga0495583_0003966_998_2107 367
334 3300046616 Ga0495668_0037578 Ga0495668_0037578_719_1828 367
335 3300046616 Ga0495668_0040014 Ga0495668_0040014_745_1854 367
336 3300046660 Ga0495625_0012573 Ga0495625_0012573_1944_3053 367
337 3300046660 Ga0495625_0087453 Ga0495625_0087453_654_1763 367
338 3300046691 Ga0495670_0000047 Ga0495670_0000047_60754_61863 367
339 3300047445 Ga0495677_0001119 Ga0495677_0001119_7817_8926 367
340 3300048904 Ga0496101_0123295 Ga0496101_0123295_20_1135 367
341 3300048906 Ga0496103_0000788 Ga0496103_0000788_7722_8825 367
342 3300048907 Ga0496104_0034967 Ga0496104_0034967_2534_3637 367
343 3300048908 Ga0496105_0026161 Ga0496105_0026161_1845_2948 367
344 3300048919 Ga0496116_0070867 Ga0496116_0070867_538_1641 367
345 3300048920 Ga0496117_0002815 Ga0496117_0002815_4019_5134 367
346 3300048920 Ga0496117_0010678 Ga0496117_0010678_5920_7023 367
347 3300048921 Ga0496118_0000335 Ga0496118_0000335_1890_3005 367
348 3300048921 Ga0496118_0008568 Ga0496118_0008568_1724_2827 367
349 3300048923 Ga0496120_0037400 Ga0496120_0037400_1029_2138 367
350 3300048926 Ga0496123_0028537 Ga0496123_0028537_2323_3432 367
351 3300048927 Ga0496124_0000116 Ga0496124_0000116_103832_104941 367
352 3300048927 Ga0496124_0002381 Ga0496124_0002381_20214_21323 367
353 3300048927 Ga0496124_0009859 Ga0496124_0009859_5215_6324 367
354 3300049574 Ga0501038_0019210 Ga0501038_0019210_683_1801 367
355 3300049758 Ga0501241_008852 Ga0501241_008852_647_1756 367
356 3300053087 Ga0500643_003060 Ga0500643_003060_6929_8035 367
357 3300053087 Ga0500643_003694 Ga0500643_003694_4209_5318 367
358 3300053087 Ga0500643_008453 Ga0500643_008453_2178_3287 367
359 3300053090 Ga0500646_0011612 Ga0500646_0011612_708_1817 367
360 3300053104 Ga0500556_0000217 Ga0500556_0000217_22672_23781 367
361 3300053116 Ga0500592_000617 Ga0500592_000617_4226_5332 367
362 3300053130 Ga0500642_0000001 Ga0500642_0000001_427030_428139 367
363 3300053136 Ga0500559_0002376 Ga0500559_0002376_2457_3566 367
364 3300053139 Ga0500568_0008976 Ga0500568_0008976_2812_3921 367
365 3300053151 Ga0500604_0000007 Ga0500604_0000007_78430_79539 367
366 3300053153 Ga0500616_0000080 Ga0500616_0000080_157695_158804 367
367 3300053153 Ga0500616_0006010 Ga0500616_0006010_5234_6346 367
368 3300053157 Ga0500624_000375 Ga0500624_000375_9110_10270 367
369 3300053177 Ga0500636_0017112 Ga0500636_0017112_2357_3517 367
370 3300053730 Ga0500645_000148 Ga0500645_000148_20286_21395 367
371 3300053730 Ga0500645_000329 Ga0500645_000329_12415_13521 367
372 iso_pu_bacteria 2599185354 2600203937 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02405

MlaE

Permease MlaE

168

379

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.8968 117 365
7ch8-assembly1.cif.gz_H cryo-em structure of p.aeruginosa mlafebd with adp-v 0.8777 111 360
8fee-assembly1.cif.gz_I structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.8665 117 365
6z5u-assembly1.cif.gz_B cryo-em structure of the a. baumannii mlabdef complex bound to appnhp 0.8641 113 359
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.8621 111 359
ID Description Score Start End Superfamily
af_P64602_10_96_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8208 13 86 3.30.750.24
af_P64602_10_96_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.7037 13 86 3.30.750.24
af_Q7K155_460_563_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.6487 5 87 3.30.750.24
af_O33206_378_486_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.6362 1 85 3.30.750.24
3ny7A00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.5651 1 86 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A3N5YUI2-F1-model_v4 ABC transporter permease 0.9805 175 356 GO:0005548
GO:0043190
AF-A0A2C9KY74-F1-model_v4 ABC transporter permease 0.9774 145 334 GO:0005548
GO:0043190
AF-A0A7C1AJT4-F1-model_v4 ABC transporter permease 0.9755 145 364 GO:0005548
GO:0043190
AF-A0A1X7ME78-F1-model_v4 deleted 0.9752 144 278
AF-A0A2V6BWI7-F1-model_v4 ABC transporter permease 0.975 170 355 GO:0005548
GO:0043190

Feature Viewer

pLDDT pTM Quality
83.85 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map