F425148

General Info

Members Datasets Scaffolds Average Seq Length
369 236 349 141

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0711245|Ga0466967_0711245_71_490
Length 139
Sequence MKIFQQQLRLEERSRGFHLITEEVVRAMPELKEIKTGVCQVFIQHTSASLTMNEDASPAVRKDFETYFNKVVPENFGYSHNDEGADDMPAHLKTSLLGNSVMIPVRNGELALGTWQGIYLCEHRNHARQRTIIITAWGE

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541302 Pedobacter sp. CF074 Isolate Unclassified
3 2739367651 Pedobacter sp. OK291 Isolate Unclassified
4 2739367663 Pedobacter sp. YR510 Isolate Unclassified
5 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
6 2818991437 Pedobacter terrae 518 Isolate Unclassified
7 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
10 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
11 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
12 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
15 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
16 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
17 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
18 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
19 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
33 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
144 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
145 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
209 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
212 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
213 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
214 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
221 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
222 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
223 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
224 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
225 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
226 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
232 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.31
Metatranscriptomes 0.27
Isolates 5.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.74
Nodule 0
Rhizoplane 0.81
Rhizosphere 78.32
Stem 0
Stem Tuber 0
Unclassified 8.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010495 3300001979 Bacteria 3561
2 JGI24739J22299_10007197 3300001989 Unclassified 4187
3 JGI24737J22298_10000118 3300001990 Bacteria 24147
4 JGI24735J21928_10000010 3300002067 Bacteria 237152
5 JGI25157J39369_1014654 3300002741 Unclassified 971
6 JGI25157J39369_1018598 3300002741 Bacteria 837
7 JGI25153J46596_10010610 3300003215 Bacteria 4149
8 JGI25153J46596_10012946 3300003215 Unclassified 3560
9 rootH1_10073312 3300003316 Bacteria 1534
10 rootL2_10070038 3300003322 Bacteria 6402
11 rootL2_10123235 3300003322 Bacteria 1113
12 rootH1_10144841 3300003323 Bacteria 2119
13 JGI25160J50197_1002925 3300003354 Bacteria 7812
14 JGI25160J50197_1010139 3300003354 Bacteria 3430
15 Ga0055526_1009487 3300003771 Bacteria 4671
16 Ga0055526_1018184 3300003771 Unclassified 2637
17 Ga0055528_1000758 3300003790 Bacteria 22545
18 Ga0055530_10003301 3300003791 Bacteria 9337
19 Ga0055540_1060357 3300003792 Unclassified 760
20 Ga0055531_10021376 3300003794 Bacteria 2512
21 Ga0065165_1000009 3300005262 Bacteria 327432
22 Ga0065165_1042148 3300005262 Bacteria 1349
23 Ga0065714_10006163 3300005288 Bacteria 6310
24 Ga0065714_10008472 3300005288 Bacteria 4194
25 Ga0065714_10064556 3300005288 Bacteria 36513
26 Ga0065714_10067664 3300005288 Bacteria 5300
27 Ga0065714_10087740 3300005288 Bacteria 2038
28 Ga0065714_10387231 3300005288 Bacteria 601
29 Ga0065707_10653200 3300005295 Bacteria 662
30 Ga0070658_10044140 3300005327 Bacteria 3601
31 Ga0070658_10076944 3300005327 Bacteria 2737
32 Ga0070658_10563127 3300005327 Bacteria 986
33 Ga0070670_100027083 3300005331 Unclassified 4930
34 Ga0068869_100108567 3300005334 Bacteria 2108
35 Ga0068869_100254049 3300005334 Bacteria 1405
36 Ga0070680_100009784 3300005336 Bacteria 7379
37 Ga0070680_100037473 3300005336 Bacteria 3918
38 Ga0070682_100115445 3300005337 Bacteria 1795
39 Ga0070682_100134871 3300005337 Bacteria 1676
40 Ga0068868_100008647 3300005338 Bacteria 7290
41 Ga0068868_100762408 3300005338 Bacteria 870
42 Ga0070660_100041043 3300005339 Bacteria 3525
43 Ga0070660_100192218 3300005339 Bacteria 1654
44 Ga0070691_10513880 3300005341 Bacteria 694
45 Ga0070671_100011391 3300005355 Bacteria 7149
46 Ga0070673_100513065 3300005364 Bacteria 1085
47 Ga0070659_100003971 3300005366 Bacteria 10528
48 Ga0070667_100456601 3300005367 Bacteria 1168
49 Ga0070681_10016865 3300005458 Bacteria 7296
50 Ga0070679_100013479 3300005530 Bacteria 7828
51 Ga0070684_100032625 3300005535 Bacteria 4439
52 Ga0068853_100028680 3300005539 Bacteria 4684
53 Ga0068853_100101882 3300005539 Bacteria 2540
54 Ga0068853_101466581 3300005539 Bacteria 660
55 Ga0070672_100745771 3300005543 Bacteria 859
56 Ga0068855_100008910 3300005563 Bacteria 12130
57 Ga0068857_100024689 3300005577 Bacteria 5294
58 Ga0068854_100116959 3300005578 Unclassified 2018
59 Ga0068859_100002456 3300005617 Bacteria 18871
60 Ga0068859_100243551 3300005617 Bacteria 1888
61 Ga0068864_100214101 3300005618 Bacteria 1775
62 Ga0068864_100544436 3300005618 Bacteria 1121
63 Ga0068866_10091185 3300005718 Bacteria 1660
64 Ga0068851_10011157 3300005834 Bacteria 4208
65 Ga0068863_100389462 3300005841 Bacteria 1362
66 Ga0068863_100829012 3300005841 Bacteria 923
67 Ga0068858_100038722 3300005842 Bacteria 4423
68 Ga0068858_100303725 3300005842 Bacteria 1523
69 Ga0068860_100003506 3300005843 Bacteria 16150
70 Ga0068862_100128842 3300005844 Bacteria 2237
71 Ga0068862_100142642 3300005844 Bacteria 2127
72 Ga0075363_100174118 3300006048 Bacteria 1222
73 Ga0075364_10233679 3300006051 Bacteria 1248
74 Ga0070716_100779059 3300006173 Bacteria 738
75 Ga0075367_10015438 3300006178 Bacteria 4151
76 Ga0075366_10098176 3300006195 Bacteria 1757
77 Ga0097621_100112518 3300006237 Bacteria 2302
78 Ga0097620_100002456 3300006931 Bacteria 18871
79 Ga0097620_100243552 3300006931 Bacteria 1888
80 Ga0105240_10000126 3300009093 Bacteria 157403
81 Ga0105241_10464726 3300009174 Bacteria 1122
82 Ga0105241_10542224 3300009174 Bacteria 1043
83 Ga0105241_10674995 3300009174 Bacteria 941
84 Ga0105242_10296721 3300009176 Bacteria 1473
85 Ga0105237_10001804 3300009545 Bacteria 27639
86 Ga0105237_10205888 3300009545 Bacteria 1968
87 Ga0105238_10306330 3300009551 Bacteria 1573
88 Ga0105249_10438655 3300009553 Bacteria 1343
89 Ga0105249_11386183 3300009553 Unclassified 775
90 Ga0105239_10000026 3300010375 Bacteria 248302
91 Ga0105239_10002186 3300010375 Bacteria 25152
92 Ga0105239_10049636 3300010375 Bacteria 4601
93 Ga0105239_10243011 3300010375 Bacteria 2021
94 Ga0105239_12176635 3300010375 Bacteria 645
95 Ga0105246_10467336 3300011119 Bacteria 1064
96 Ga0157373_10000692 3300013100 Bacteria 26430
97 Ga0157373_10001120 3300013100 Bacteria 20583
98 Ga0157373_10001134 3300013100 Bacteria 20490
99 Ga0157373_10100717 3300013100 Bacteria 2033
100 Ga0157373_10109895 3300013100 Bacteria 1938
101 Ga0157373_10131710 3300013100 Bacteria 1758
102 Ga0157373_10188482 3300013100 Unclassified 1453
103 Ga0157371_10000041 3300013102 Bacteria 203957
104 Ga0157371_10004623 3300013102 Bacteria 11936
105 Ga0157371_10008340 3300013102 Bacteria 8268
106 Ga0157371_10042807 3300013102 Unclassified 3227
107 Ga0157371_10224480 3300013102 Bacteria 1349
108 Ga0157371_10344859 3300013102 Bacteria 1084
109 Ga0157371_10706705 3300013102 Bacteria 755
110 Ga0157370_10002503 3300013104 Bacteria 22150
111 Ga0157370_10002602 3300013104 Bacteria 21689
112 Ga0157370_10005781 3300013104 Bacteria 13819
113 Ga0157370_10011513 3300013104 Bacteria 9242
114 Ga0157370_10013598 3300013104 Bacteria 8375
115 Ga0157370_10024650 3300013104 Bacteria 5958
116 Ga0157370_10084384 3300013104 Unclassified 2986
117 Ga0157370_10089977 3300013104 Bacteria 2882
118 Ga0157370_10309180 3300013104 Bacteria 1458
119 Ga0157370_11404951 3300013104 Bacteria 628
120 Ga0157369_10000016 3300013105 Bacteria 257827
121 Ga0157369_10013161 3300013105 Bacteria 9363
122 Ga0157369_10092049 3300013105 Bacteria 3236
123 Ga0157369_10593917 3300013105 Bacteria 1143
124 Ga0157374_10195897 3300013296 Bacteria 1977
125 Ga0157374_10486488 3300013296 Bacteria 1237
126 Ga0157378_10007241 3300013297 Bacteria 9688
127 Ga0157378_10060441 3300013297 Bacteria 3382
128 Ga0157378_10080039 3300013297 Bacteria 2951
129 Ga0163162_10000165 3300013306 Bacteria 60772
130 Ga0163162_10015953 3300013306 Bacteria 7341
131 Ga0163162_10069643 3300013306 Bacteria 3570
132 Ga0163162_11727584 3300013306 Bacteria 715
133 Ga0157372_10000118 3300013307 Bacteria 84096
134 Ga0157372_10001626 3300013307 Bacteria 24372
135 Ga0157372_10049518 3300013307 Bacteria 4671
136 Ga0157372_10093091 3300013307 Bacteria 3429
137 Ga0157372_10146118 3300013307 Bacteria 2726
138 Ga0157372_10158965 3300013307 Bacteria 2611
139 Ga0157372_10643406 3300013307 Bacteria 1235
140 Ga0157375_10305482 3300013308 Bacteria 1755
141 Ga0157375_10745438 3300013308 Bacteria 1131
142 Ga0157375_11969407 3300013308 Bacteria 694
143 Ga0182008_10004146 3300014497 Bacteria 8534
144 Ga0157377_10380199 3300014745 Bacteria 956
145 Ga0182006_1000295 3300015261 Bacteria 43826
146 Ga0182006_1000453 3300015261 Bacteria 32451
147 Ga0182007_10000002 3300015262 Bacteria 564661
148 Ga0183373_1004 3300015682 Bacteria 537398
149 Ga0163161_10000212 3300017792 Bacteria 52935
150 Ga0163161_10002968 3300017792 Bacteria 12021
151 Ga0163161_10102543 3300017792 Bacteria 2131
152 Ga0206353_10694834 3300020082 Bacteria 677
153 Ga0213872_10033173 3300021361 Unclassified 2365
154 Ga0209258_122884 3300025242 Bacteria 635
155 Ga0209646_1000003 3300025246 Bacteria 1160860
156 Ga0209026_1000166 3300025250 Bacteria 101237
157 Ga0209026_1001152 3300025250 Bacteria 12400
158 Ga0209026_1059992 3300025250 Bacteria 535
159 Ga0209129_1021156 3300025258 Bacteria 1198
160 Ga0209673_1000147 3300025273 Bacteria 149397
161 Ga0209673_1112134 3300025273 Bacteria 569
162 Ga0209564_1000636 3300025295 Bacteria 53372
163 Ga0209564_1016407 3300025295 Bacteria 2951
164 Ga0209564_1029513 3300025295 Bacteria 1724
165 Ga0209758_1003212 3300025297 Bacteria 15230
166 Ga0209758_1004087 3300025297 Bacteria 12523
167 Ga0209758_1007470 3300025297 Bacteria 7423
168 Ga0209050_1000669 3300025298 Bacteria 52066
169 Ga0207426_1000720 3300025302 Bacteria 38303
170 Ga0207426_1001483 3300025302 Bacteria 19241
171 Ga0207426_1005913 3300025302 Bacteria 5437
172 Ga0209051_1057062 3300025303 Bacteria 1254
173 Ga0209257_1006187 3300025304 Bacteria 7869
174 Ga0207656_10112642 3300025321 Bacteria 1259
175 Ga0207696_1000222 3300025711 Bacteria 82527
176 Ga0207642_10026816 3300025899 Bacteria 2350
177 Ga0207705_10098199 3300025909 Bacteria 2151
178 Ga0207705_10156241 3300025909 Bacteria 1711
179 Ga0207705_10335013 3300025909 Bacteria 1164
180 Ga0207654_10019178 3300025911 Bacteria 3605
181 Ga0207707_10012073 3300025912 Bacteria 7513
182 Ga0207707_10325033 3300025912 Bacteria 1328
183 Ga0207695_10000013 3300025913 Bacteria 821265
184 Ga0207695_10529986 3300025913 Bacteria 1059
185 Ga0207671_10001978 3300025914 Bacteria 22600
186 Ga0207671_10356586 3300025914 Bacteria 1160
187 Ga0207660_10016475 3300025917 Bacteria 4893
188 Ga0207660_10186577 3300025917 Bacteria 1613
189 Ga0207657_10007780 3300025919 Bacteria 10941
190 Ga0207657_10040183 3300025919 Bacteria 4147
191 Ga0207657_10263156 3300025919 Bacteria 1372
192 Ga0207652_10087028 3300025921 Bacteria 2740
193 Ga0207681_11220908 3300025923 Unclassified 632
194 Ga0207694_10070487 3300025924 Bacteria 2731
195 Ga0207650_10016845 3300025925 Bacteria 5112
196 Ga0207644_10031218 3300025931 Bacteria 3710
197 Ga0207690_10010574 3300025932 Bacteria 5491
198 Ga0207665_10267362 3300025939 Bacteria 1269
199 Ga0207691_11529603 3300025940 Bacteria 545
200 Ga0207689_10065645 3300025942 Bacteria 2985
201 Ga0207661_10042045 3300025944 Bacteria 3602
202 Ga0207667_10008558 3300025949 Bacteria 12142
203 Ga0207651_10614523 3300025960 Bacteria 951
204 Ga0207712_10501155 3300025961 Bacteria 1038
205 Ga0207658_10925239 3300025986 Bacteria 794
206 Ga0207658_11661800 3300025986 Unclassified 584
207 Ga0207703_10099570 3300026035 Bacteria 2461
208 Ga0207639_10150832 3300026041 Bacteria 1946
209 Ga0207639_10448559 3300026041 Bacteria 1171
210 Ga0207639_10894193 3300026041 Bacteria 830
211 Ga0207639_12120637 3300026041 Bacteria 523
212 Ga0207641_10052449 3300026088 Bacteria 3454
213 Ga0207676_10466385 3300026095 Bacteria 1193
214 Ga0207674_10037085 3300026116 Bacteria 5073
215 Ga0207698_12032480 3300026142 Bacteria 589
216 Ga0268265_10186733 3300028380 Bacteria 1786
217 Ga0268264_10004732 3300028381 Bacteria 11562
218 Ga0307515_10262340 3300028794 Bacteria 1462
219 Ga0307511_10003744 3300030521 Bacteria 15550
220 Ga0316176_1126433 3300030732 Bacteria 30105
221 Ga0316181_1138860 3300030744 Bacteria 58548
222 Ga0316182_1132702 3300030745 Bacteria 1980
223 Ga0307513_10038752 3300031456 Bacteria 5290
224 Ga0307509_10113049 3300031507 Bacteria 2714
225 Ga0307509_10127720 3300031507 Bacteria 2505
226 Ga0307408_100004157 3300031548 Bacteria 9863
227 Ga0307516_10000322 3300031730 Bacteria 62349
228 Ga0307516_10039033 3300031730 Bacteria 4734
229 Ga0307405_10000006 3300031731 Bacteria 361477
230 Ga0307406_10002710 3300031901 Bacteria 9656
231 Ga0307406_10849417 3300031901 Unclassified 774
232 Ga0307407_10000003 3300031903 Bacteria 271723
233 Ga0307412_10000045 3300031911 Bacteria 165021
234 Ga0307412_10692029 3300031911 Bacteria 874
235 Ga0307409_100010563 3300031995 Bacteria 5752
236 Ga0307416_100000002 3300032002 Bacteria 509907
237 Ga0307416_100409767 3300032002 Bacteria 1396
238 Ga0307414_10000623 3300032004 Bacteria 18092
239 Ga0307414_10008909 3300032004 Bacteria 5731
240 Ga0307414_10087013 3300032004 Bacteria 2307
241 Ga0307414_10233617 3300032004 Bacteria 1518
242 Ga0307414_10332995 3300032004 Unclassified 1297
243 Ga0316583_10194032 3300032133 Bacteria 705
244 Ga0395899_0002054 3300037312 Bacteria 16582
245 Ga0395899_0055672 3300037312 Bacteria 2925
246 Ga0395899_0359813 3300037312 Bacteria 971
247 Ga0395900_0001991 3300037418 Bacteria 23068
248 Ga0395900_0021965 3300037418 Bacteria 6525
249 Ga0395900_0090106 3300037418 Bacteria 3152
250 Ga0395900_0267964 3300037418 Unclassified 1703
251 Ga0395900_0861709 3300037418 Bacteria 831
252 Ga0395898_0130418 3300037466 Bacteria 2408
253 Ga0395898_0299083 3300037466 Bacteria 1535
254 Ga0395898_0695629 3300037466 Bacteria 958
255 Ga0395905_0001254 3300037471 Bacteria 31416
256 Ga0395905_0005293 3300037471 Bacteria 13196
257 Ga0395905_0335970 3300037471 Bacteria 1402
258 Ga0395905_1216270 3300037471 Bacteria 657
259 Ga0395901_0000861 3300038443 Bacteria 33403
260 Ga0395901_0011134 3300038443 Bacteria 9118
261 Ga0395901_0989650 3300038443 Bacteria 817
262 Ga0436361_1134729 3300039447 Unclassified 2454
263 Ga0451807_2467709 3300041486 Bacteria 528
264 Ga0451847_0381287 3300041503 Bacteria 560
265 Ga0439449_0355032 3300042007 Bacteria 555
266 Ga0451577_0106821 3300042876 Bacteria 2502
267 Ga0466972_0000035 3300044658 Bacteria 147516
268 Ga0453684_0085430 3300044712 Bacteria 3920
269 Ga0466968_0408013 3300044735 Bacteria 667
270 Ga0466970_0000119 3300044765 Bacteria 35288
271 Ga0451576_0192350 3300045051 Bacteria 2131
272 Ga0451576_0344699 3300045051 Bacteria 1560
273 Ga0466967_0711245 3300045976 Bacteria 995
274 Ga0495627_014539 3300046453 Bacteria 2744
275 Ga0495627_098367 3300046453 Bacteria 837
276 Ga0495638_0075971 3300046460 Bacteria 2047
277 Ga0495638_0291724 3300046460 Bacteria 882
278 Ga0495651_0793362 3300046462 Bacteria 585
279 Ga0495650_0000025 3300046471 Bacteria 486001
280 Ga0495585_0000164 3300046492 Bacteria 71539
281 Ga0495583_0117753 3300046506 Bacteria 1120
282 Ga0495606_0000035 3300046507 Bacteria 243820
283 Ga0495606_0173450 3300046507 Bacteria 1249
284 Ga0495606_0368270 3300046507 Bacteria 757
285 Ga0495606_0515399 3300046507 Bacteria 601
286 Ga0495610_0000785 3300046512 Bacteria 29795
287 Ga0495610_0001761 3300046512 Bacteria 18952
288 Ga0495610_0003232 3300046512 Bacteria 12886
289 Ga0495637_0007789 3300046520 Bacteria 5292
290 Ga0495648_0277575 3300046524 Bacteria 796
291 Ga0495609_0025981 3300046538 Bacteria 2682
292 Ga0495609_0053058 3300046538 Bacteria 1803
293 Ga0495633_0000101 3300046558 Bacteria 116147
294 Ga0495633_0003591 3300046558 Bacteria 10262
295 Ga0495668_0002709 3300046616 Bacteria 14211
296 Ga0495625_0000063 3300046660 Bacteria 176435
297 Ga0495661_0003891 3300046665 Bacteria 10914
298 Ga0495661_0076115 3300046665 Bacteria 1948
299 Ga0495671_0044393 3300046692 Bacteria 2229
300 Ga0495649_0000006 3300046694 Bacteria 542188
301 Ga0495589_0225229 3300046794 Bacteria 880
302 Ga0495660_0027688 3300046810 Bacteria 3206
303 Ga0495683_0129760 3300047323 Bacteria 1190
304 Ga0495687_000304 3300047443 Bacteria 64746
305 Ga0495673_0050774 3300047469 Bacteria 1819
306 Ga0495681_0092261 3300047470 Bacteria 1335
307 Ga0495686_0000113 3300047472 Bacteria 168307
308 Ga0496110_1002738 3300048913 Bacteria 742
309 Ga0496115_0604042 3300048918 Bacteria 872
310 Ga0496124_0007493 3300048927 Bacteria 11586
311 Ga0495678_174072 3300049459 Bacteria 679
312 Ga0501043_0058327 3300049579 Bacteria 3030
313 Ga0501047_0208524 3300049581 Bacteria 1813
314 Ga0501048_0478166 3300049582 Bacteria 893
315 Ga0501048_1170423 3300049582 Bacteria 553
316 Ga0501071_0334191 3300049587 Bacteria 1152
317 Ga0501072_0111793 3300049588 Bacteria 2175
318 Ga0501077_1060028 3300049593 Bacteria 522
319 Ga0501223_002488 3300049663 Bacteria 4084
320 Ga0501230_008116 3300049667 Bacteria 1579
321 Ga0501235_159484 3300049669 Unclassified 589
322 Ga0501240_051107 3300049673 Bacteria 709
323 Ga0501259_028407 3300049688 Bacteria 1041
324 Ga0501219_000390 3300049703 Bacteria 7334
325 Ga0501241_076652 3300049758 Bacteria 690
326 Ga0501035_0171420 3300049822 Bacteria 1875
327 Ga0501035_0192401 3300049822 Bacteria 1754
328 Ga0501044_0362296 3300049823 Bacteria 1368
329 Ga0501044_0401397 3300049823 Bacteria 1283
330 Ga0501044_0677850 3300049823 Bacteria 918
331 Ga0501045_0579623 3300049824 Bacteria 831
332 Ga0501284_00049 3300050005 Bacteria 44199
333 nmdc:mga00v17_623273_c1 3300050491 Bacteria 695
334 nmdc:mga0k408_131720_c1 3300050493 Bacteria 1484
335 nmdc:mga06z11_10329_c1 3300050494 Bacteria 3973
336 Ga0500644_0420040 3300053088 Bacteria 584
337 Ga0500647_0186022 3300053091 Bacteria 950
338 Ga0500583_0135047 3300053092 Bacteria 1225
339 Ga0500651_0000476 3300053093 Bacteria 21036
340 Ga0500618_000238 3300053125 Bacteria 43564
341 Ga0500642_0109247 3300053130 Unclassified 1291
342 Ga0500652_116443 3300053131 Bacteria 1116
343 Ga0500559_0059695 3300053136 Bacteria 1698
344 Ga0500568_0142449 3300053139 Unclassified 888
345 Ga0500604_0016100 3300053151 Bacteria 2056
346 Ga0500634_0310195 3300053161 Bacteria 621
347 Ga0500645_029918 3300053730 Bacteria 1642
348 Ga0501084_0321582 3300054114 Bacteria 1307
349 Ga0501082_0584733 3300060353 Bacteria 977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427687 2586211043 136
2 iso_pu_bacteria 2738541302 2738854515 136
3 iso_pu_bacteria 2739367651 2739588076 136
4 iso_pu_bacteria 2739367663 2739646991 136
5 iso_pu_bacteria 2775506987 2776613739 136
6 iso_pu_bacteria 2818991437 2819545966 136
7 iso_pu_bacteria 2842722452 2842724137 136
8 iso_pu_bacteria 2842909656 2842912135 136
9 iso_pu_bacteria 2852623160 2852623894 136
10 iso_pu_bacteria 2852627209 2852628426 136
11 iso_pu_bacteria 2857627736 2857631422 136
12 iso_pu_bacteria 2896085136 2896085547 136
13 iso_pu_bacteria 2904445276 2904446217 136
14 iso_pu_bacteria 2919186247 2919188460 136
15 iso_pu_bacteria 2929921140 2929926966 136
16 iso_pu_bacteria 2932082852 2932086836 136
17 iso_pu_bacteria 2939664404 2939667455 136
18 iso_pu_bacteria 2945997725 2945999045 136
19 iso_pu_bacteria 2954016120 2954021495 136
20 iso_pu_bacteria 8003151029 8003154476 136
21 3300002741 JGI25157J39369_1014654 JGI25157J39369_10146542 138
22 3300005539 Ga0068853_100028680 Ga0068853_1000286804 138
23 3300026041 Ga0207639_10894193 Ga0207639_108941931 138
24 3300005327 Ga0070658_10076944 Ga0070658_100769442 139
25 3300005337 Ga0070682_100115445 Ga0070682_1001154451 139
26 3300006048 Ga0075363_100174118 Ga0075363_1001741182 139
27 3300006051 Ga0075364_10233679 Ga0075364_102336792 139
28 3300006178 Ga0075367_10015438 Ga0075367_100154384 139
29 3300020082 Ga0206353_10694834 Ga0206353_106948342 139
30 3300025711 Ga0207696_1000222 Ga0207696_100022240 139
31 3300025909 Ga0207705_10098199 Ga0207705_100981992 139
32 3300031548 Ga0307408_100004157 Ga0307408_1000041573 139
33 3300031901 Ga0307406_10002710 Ga0307406_1000271010 139
34 3300042876 Ga0451577_0106821 Ga0451577_0106821_1427_1846 139
35 3300044712 Ga0453684_0085430 Ga0453684_0085430_1296_1715 139
36 3300045051 Ga0451576_0192350 Ga0451576_0192350_31_453 139
37 3300045051 Ga0451576_0344699 Ga0451576_0344699_291_710 139
38 3300045976 Ga0466967_0711245 Ga0466967_0711245_71_490 139
39 3300048913 Ga0496110_1002738 Ga0496110_1002738_175_594 139
40 3300048927 Ga0496124_0007493 Ga0496124_0007493_7456_7875 139
41 3300049582 Ga0501048_0478166 Ga0501048_0478166_67_489 139
42 3300049588 Ga0501072_0111793 Ga0501072_0111793_1460_1882 139
43 3300049593 Ga0501077_1060028 Ga0501077_1060028_43_465 139
44 3300049667 Ga0501230_008116 Ga0501230_008116_37_462 139
45 3300049669 Ga0501235_159484 Ga0501235_159484_54_479 139
46 3300049688 Ga0501259_028407 Ga0501259_028407_175_600 139
47 3300049822 Ga0501035_0192401 Ga0501035_0192401_237_656 139
48 3300049823 Ga0501044_0362296 Ga0501044_0362296_389_808 139
49 3300050491 nmdc:mga00v17_623273_c1 nmdc:mga00v17_623273_c1_23_442 139
50 3300050494 nmdc:mga06z11_10329_c1 nmdc:mga06z11_10329_c1_402_821 139
51 3300054114 Ga0501084_0321582 Ga0501084_0321582_254_676 139
52 3300001979 JGI24740J21852_10010495 JGI24740J21852_100104952 140
53 3300001989 JGI24739J22299_10007197 JGI24739J22299_100071972 140
54 3300001990 JGI24737J22298_10000118 JGI24737J22298_1000011816 140
55 3300002067 JGI24735J21928_10000010 JGI24735J21928_10000010137 140
56 3300002741 JGI25157J39369_1018598 JGI25157J39369_10185981 140
57 3300003215 JGI25153J46596_10010610 JGI25153J46596_100106102 140
58 3300003215 JGI25153J46596_10012946 JGI25153J46596_100129462 140
59 3300003316 rootH1_10073312 rootH1_100733122 140
60 3300003322 rootL2_10070038 rootL2_1007003811 140
61 3300003322 rootL2_10123235 rootL2_101232351 140
62 3300003323 rootH1_10144841 rootH1_101448412 140
63 3300003354 JGI25160J50197_1002925 JGI25160J50197_10029256 140
64 3300003354 JGI25160J50197_1010139 JGI25160J50197_10101392 140
65 3300003771 Ga0055526_1009487 Ga0055526_10094873 140
66 3300003771 Ga0055526_1018184 Ga0055526_10181842 140
67 3300003790 Ga0055528_1000758 Ga0055528_10007589 140
68 3300003791 Ga0055530_10003301 Ga0055530_100033012 140
69 3300003792 Ga0055540_1060357 Ga0055540_10603572 140
70 3300003794 Ga0055531_10021376 Ga0055531_100213762 140
71 3300005262 Ga0065165_1000009 Ga0065165_10000094 140
72 3300005262 Ga0065165_1042148 Ga0065165_10421482 140
73 3300005288 Ga0065714_10006163 Ga0065714_100061638 140
74 3300005288 Ga0065714_10008472 Ga0065714_100084721 140
75 3300005288 Ga0065714_10064556 Ga0065714_1006455613 140
76 3300005288 Ga0065714_10067664 Ga0065714_100676643 140
77 3300005288 Ga0065714_10087740 Ga0065714_100877403 140
78 3300005288 Ga0065714_10387231 Ga0065714_103872311 140
79 3300005295 Ga0065707_10653200 Ga0065707_106532002 140
80 3300005327 Ga0070658_10044140 Ga0070658_100441403 140
81 3300005327 Ga0070658_10563127 Ga0070658_105631272 140
82 3300005331 Ga0070670_100027083 Ga0070670_1000270832 140
83 3300005334 Ga0068869_100108567 Ga0068869_1001085672 140
84 3300005334 Ga0068869_100254049 Ga0068869_1002540491 140
85 3300005336 Ga0070680_100009784 Ga0070680_1000097845 140
86 3300005336 Ga0070680_100037473 Ga0070680_1000374733 140
87 3300005337 Ga0070682_100134871 Ga0070682_1001348712 140
88 3300005338 Ga0068868_100008647 Ga0068868_1000086478 140
89 3300005338 Ga0068868_100762408 Ga0068868_1007624081 140
90 3300005339 Ga0070660_100041043 Ga0070660_1000410435 140
91 3300005339 Ga0070660_100192218 Ga0070660_1001922182 140
92 3300005341 Ga0070691_10513880 Ga0070691_105138801 140
93 3300005355 Ga0070671_100011391 Ga0070671_1000113916 140
94 3300005364 Ga0070673_100513065 Ga0070673_1005130651 140
95 3300005366 Ga0070659_100003971 Ga0070659_1000039719 140
96 3300005367 Ga0070667_100456601 Ga0070667_1004566011 140
97 3300005458 Ga0070681_10016865 Ga0070681_100168657 140
98 3300005530 Ga0070679_100013479 Ga0070679_1000134793 140
99 3300005535 Ga0070684_100032625 Ga0070684_1000326251 140
100 3300005539 Ga0068853_100101882 Ga0068853_1001018824 140
101 3300005539 Ga0068853_101466581 Ga0068853_1014665811 140
102 3300005543 Ga0070672_100745771 Ga0070672_1007457711 140
103 3300005563 Ga0068855_100008910 Ga0068855_1000089105 140
104 3300005577 Ga0068857_100024689 Ga0068857_1000246896 140
105 3300005578 Ga0068854_100116959 Ga0068854_1001169592 140
106 3300005617 Ga0068859_100002456 Ga0068859_1000024563 140
107 3300005617 Ga0068859_100243551 Ga0068859_1002435513 140
108 3300005618 Ga0068864_100214101 Ga0068864_1002141012 140
109 3300005618 Ga0068864_100544436 Ga0068864_1005444362 140
110 3300005718 Ga0068866_10091185 Ga0068866_100911852 140
111 3300005834 Ga0068851_10011157 Ga0068851_100111571 140
112 3300005841 Ga0068863_100389462 Ga0068863_1003894623 140
113 3300005841 Ga0068863_100829012 Ga0068863_1008290122 140
114 3300005842 Ga0068858_100038722 Ga0068858_1000387222 140
115 3300005842 Ga0068858_100303725 Ga0068858_1003037251 140
116 3300005843 Ga0068860_100003506 Ga0068860_10000350614 140
117 3300005844 Ga0068862_100128842 Ga0068862_1001288422 140
118 3300005844 Ga0068862_100142642 Ga0068862_1001426423 140
119 3300006173 Ga0070716_100779059 Ga0070716_1007790592 140
120 3300006195 Ga0075366_10098176 Ga0075366_100981762 140
121 3300006237 Ga0097621_100112518 Ga0097621_1001125184 140
122 3300006931 Ga0097620_100002456 Ga0097620_1000024563 140
123 3300006931 Ga0097620_100243552 Ga0097620_1002435523 140
124 3300009093 Ga0105240_10000126 Ga0105240_1000012628 140
125 3300009174 Ga0105241_10464726 Ga0105241_104647261 140
126 3300009174 Ga0105241_10542224 Ga0105241_105422242 140
127 3300009174 Ga0105241_10674995 Ga0105241_106749951 140
128 3300009176 Ga0105242_10296721 Ga0105242_102967212 140
129 3300009545 Ga0105237_10001804 Ga0105237_100018045 140
130 3300009545 Ga0105237_10205888 Ga0105237_102058882 140
131 3300009551 Ga0105238_10306330 Ga0105238_103063302 140
132 3300009553 Ga0105249_10438655 Ga0105249_104386552 140
133 3300009553 Ga0105249_11386183 Ga0105249_113861831 140
134 3300010375 Ga0105239_10000026 Ga0105239_10000026121 140
135 3300010375 Ga0105239_10002186 Ga0105239_1000218618 140
136 3300010375 Ga0105239_10049636 Ga0105239_100496367 140
137 3300010375 Ga0105239_10243011 Ga0105239_102430112 140
138 3300010375 Ga0105239_12176635 Ga0105239_121766351 140
139 3300011119 Ga0105246_10467336 Ga0105246_104673361 140
140 3300013100 Ga0157373_10000692 Ga0157373_100006928 140
141 3300013100 Ga0157373_10001120 Ga0157373_1000112010 140
142 3300013100 Ga0157373_10001134 Ga0157373_100011343 140
143 3300013100 Ga0157373_10100717 Ga0157373_101007172 140
144 3300013100 Ga0157373_10109895 Ga0157373_101098951 140
145 3300013100 Ga0157373_10131710 Ga0157373_101317103 140
146 3300013100 Ga0157373_10188482 Ga0157373_101884822 140
147 3300013102 Ga0157371_10000041 Ga0157371_10000041125 140
148 3300013102 Ga0157371_10004623 Ga0157371_1000462310 140
149 3300013102 Ga0157371_10008340 Ga0157371_100083402 140
150 3300013102 Ga0157371_10042807 Ga0157371_100428072 140
151 3300013102 Ga0157371_10224480 Ga0157371_102244802 140
152 3300013102 Ga0157371_10344859 Ga0157371_103448592 140
153 3300013102 Ga0157371_10706705 Ga0157371_107067051 140
154 3300013104 Ga0157370_10002503 Ga0157370_100025035 140
155 3300013104 Ga0157370_10002602 Ga0157370_1000260220 140
156 3300013104 Ga0157370_10005781 Ga0157370_100057819 140
157 3300013104 Ga0157370_10011513 Ga0157370_100115133 140
158 3300013104 Ga0157370_10013598 Ga0157370_100135982 140
159 3300013104 Ga0157370_10024650 Ga0157370_100246503 140
160 3300013104 Ga0157370_10084384 Ga0157370_100843844 140
161 3300013104 Ga0157370_10089977 Ga0157370_100899773 140
162 3300013104 Ga0157370_10309180 Ga0157370_103091802 140
163 3300013104 Ga0157370_11404951 Ga0157370_114049511 140
164 3300013105 Ga0157369_10000016 Ga0157369_1000001699 140
165 3300013105 Ga0157369_10013161 Ga0157369_100131618 140
166 3300013105 Ga0157369_10092049 Ga0157369_100920493 140
167 3300013105 Ga0157369_10593917 Ga0157369_105939172 140
168 3300013296 Ga0157374_10195897 Ga0157374_101958972 140
169 3300013296 Ga0157374_10486488 Ga0157374_104864882 140
170 3300013297 Ga0157378_10007241 Ga0157378_100072416 140
171 3300013297 Ga0157378_10060441 Ga0157378_100604413 140
172 3300013297 Ga0157378_10080039 Ga0157378_100800393 140
173 3300013306 Ga0163162_10000165 Ga0163162_1000016541 140
174 3300013306 Ga0163162_10015953 Ga0163162_100159532 140
175 3300013306 Ga0163162_10069643 Ga0163162_100696434 140
176 3300013306 Ga0163162_11727584 Ga0163162_117275841 140
177 3300013307 Ga0157372_10000118 Ga0157372_1000011843 140
178 3300013307 Ga0157372_10001626 Ga0157372_1000162617 140
179 3300013307 Ga0157372_10049518 Ga0157372_100495182 140
180 3300013307 Ga0157372_10093091 Ga0157372_100930914 140
181 3300013307 Ga0157372_10146118 Ga0157372_101461184 140
182 3300013307 Ga0157372_10158965 Ga0157372_101589652 140
183 3300013307 Ga0157372_10643406 Ga0157372_106434062 140
184 3300013308 Ga0157375_10305482 Ga0157375_103054821 140
185 3300013308 Ga0157375_10745438 Ga0157375_107454382 140
186 3300013308 Ga0157375_11969407 Ga0157375_119694071 140
187 3300014497 Ga0182008_10004146 Ga0182008_100041465 140
188 3300014745 Ga0157377_10380199 Ga0157377_103801991 140
189 3300015261 Ga0182006_1000295 Ga0182006_10002955 140
190 3300015261 Ga0182006_1000453 Ga0182006_10004538 140
191 3300015262 Ga0182007_10000002 Ga0182007_10000002298 140
192 3300015682 Ga0183373_1004 Ga0183373_1004175 140
193 3300017792 Ga0163161_10000212 Ga0163161_1000021212 140
194 3300017792 Ga0163161_10002968 Ga0163161_1000296810 140
195 3300017792 Ga0163161_10102543 Ga0163161_101025431 140
196 3300021361 Ga0213872_10033173 Ga0213872_100331732 140
197 3300025242 Ga0209258_122884 Ga0209258_1228841 140
198 3300025246 Ga0209646_1000003 Ga0209646_1000003598 140
199 3300025250 Ga0209026_1000166 Ga0209026_100016610 140
200 3300025250 Ga0209026_1001152 Ga0209026_10011523 140
201 3300025250 Ga0209026_1059992 Ga0209026_10599921 140
202 3300025258 Ga0209129_1021156 Ga0209129_10211561 140
203 3300025273 Ga0209673_1000147 Ga0209673_10001474 140
204 3300025273 Ga0209673_1112134 Ga0209673_11121341 140
205 3300025295 Ga0209564_1000636 Ga0209564_100063636 140
206 3300025295 Ga0209564_1016407 Ga0209564_10164072 140
207 3300025295 Ga0209564_1029513 Ga0209564_10295132 140
208 3300025297 Ga0209758_1003212 Ga0209758_10032122 140
209 3300025297 Ga0209758_1004087 Ga0209758_10040875 140
210 3300025297 Ga0209758_1007470 Ga0209758_10074707 140
211 3300025298 Ga0209050_1000669 Ga0209050_100066933 140
212 3300025302 Ga0207426_1000720 Ga0207426_100072015 140
213 3300025302 Ga0207426_1001483 Ga0207426_10014834 140
214 3300025302 Ga0207426_1005913 Ga0207426_10059134 140
215 3300025303 Ga0209051_1057062 Ga0209051_10570622 140
216 3300025304 Ga0209257_1006187 Ga0209257_10061872 140
217 3300025321 Ga0207656_10112642 Ga0207656_101126421 140
218 3300025899 Ga0207642_10026816 Ga0207642_100268162 140
219 3300025909 Ga0207705_10156241 Ga0207705_101562411 140
220 3300025909 Ga0207705_10335013 Ga0207705_103350132 140
221 3300025911 Ga0207654_10019178 Ga0207654_100191784 140
222 3300025912 Ga0207707_10012073 Ga0207707_100120738 140
223 3300025912 Ga0207707_10325033 Ga0207707_103250331 140
224 3300025913 Ga0207695_10000013 Ga0207695_10000013350 140
225 3300025913 Ga0207695_10529986 Ga0207695_105299862 140
226 3300025914 Ga0207671_10001978 Ga0207671_1000197818 140
227 3300025914 Ga0207671_10356586 Ga0207671_103565862 140
228 3300025917 Ga0207660_10016475 Ga0207660_100164752 140
229 3300025917 Ga0207660_10186577 Ga0207660_101865772 140
230 3300025919 Ga0207657_10007780 Ga0207657_100077804 140
231 3300025919 Ga0207657_10040183 Ga0207657_100401834 140
232 3300025919 Ga0207657_10263156 Ga0207657_102631562 140
233 3300025921 Ga0207652_10087028 Ga0207652_100870282 140
234 3300025923 Ga0207681_11220908 Ga0207681_112209081 140
235 3300025924 Ga0207694_10070487 Ga0207694_100704872 140
236 3300025925 Ga0207650_10016845 Ga0207650_100168456 140
237 3300025931 Ga0207644_10031218 Ga0207644_100312182 140
238 3300025932 Ga0207690_10010574 Ga0207690_100105749 140
239 3300025939 Ga0207665_10267362 Ga0207665_102673622 140
240 3300025940 Ga0207691_11529603 Ga0207691_115296031 140
241 3300025942 Ga0207689_10065645 Ga0207689_100656453 140
242 3300025944 Ga0207661_10042045 Ga0207661_100420453 140
243 3300025949 Ga0207667_10008558 Ga0207667_100085585 140
244 3300025960 Ga0207651_10614523 Ga0207651_106145231 140
245 3300025961 Ga0207712_10501155 Ga0207712_105011552 140
246 3300025986 Ga0207658_10925239 Ga0207658_109252391 140
247 3300025986 Ga0207658_11661800 Ga0207658_116618001 140
248 3300026035 Ga0207703_10099570 Ga0207703_100995702 140
249 3300026041 Ga0207639_10150832 Ga0207639_101508322 140
250 3300026041 Ga0207639_10448559 Ga0207639_104485592 140
251 3300026041 Ga0207639_12120637 Ga0207639_121206371 140
252 3300026088 Ga0207641_10052449 Ga0207641_100524493 140
253 3300026095 Ga0207676_10466385 Ga0207676_104663852 140
254 3300026116 Ga0207674_10037085 Ga0207674_100370853 140
255 3300026142 Ga0207698_12032480 Ga0207698_120324802 140
256 3300028380 Ga0268265_10186733 Ga0268265_101867332 140
257 3300028381 Ga0268264_10004732 Ga0268264_100047321 140
258 3300028794 Ga0307515_10262340 Ga0307515_102623402 140
259 3300030521 Ga0307511_10003744 Ga0307511_100037442 140
260 3300030732 Ga0316176_1126433 Ga0316176_11264335 140
261 3300030744 Ga0316181_1138860 Ga0316181_113886021 140
262 3300030745 Ga0316182_1132702 Ga0316182_11327022 140
263 3300031456 Ga0307513_10038752 Ga0307513_100387525 140
264 3300031507 Ga0307509_10113049 Ga0307509_101130491 140
265 3300031507 Ga0307509_10127720 Ga0307509_101277203 140
266 3300031730 Ga0307516_10000322 Ga0307516_1000032214 140
267 3300031730 Ga0307516_10039033 Ga0307516_100390335 140
268 3300031731 Ga0307405_10000006 Ga0307405_10000006202 140
269 3300031901 Ga0307406_10849417 Ga0307406_108494172 140
270 3300031903 Ga0307407_10000003 Ga0307407_1000000332 140
271 3300031911 Ga0307412_10000045 Ga0307412_1000004525 140
272 3300031911 Ga0307412_10692029 Ga0307412_106920292 140
273 3300031995 Ga0307409_100010563 Ga0307409_1000105631 140
274 3300032002 Ga0307416_100000002 Ga0307416_100000002280 140
275 3300032002 Ga0307416_100409767 Ga0307416_1004097672 140
276 3300032004 Ga0307414_10000623 Ga0307414_100006239 140
277 3300032004 Ga0307414_10008909 Ga0307414_100089096 140
278 3300032004 Ga0307414_10087013 Ga0307414_100870132 140
279 3300032004 Ga0307414_10233617 Ga0307414_102336172 140
280 3300032004 Ga0307414_10332995 Ga0307414_103329952 140
281 3300032133 Ga0316583_10194032 Ga0316583_101940322 140
282 3300037312 Ga0395899_0002054 Ga0395899_0002054_4703_5125 140
283 3300037312 Ga0395899_0055672 Ga0395899_0055672_1092_1514 140
284 3300037312 Ga0395899_0359813 Ga0395899_0359813_132_554 140
285 3300037418 Ga0395900_0001991 Ga0395900_0001991_22478_22900 140
286 3300037418 Ga0395900_0021965 Ga0395900_0021965_3682_4104 140
287 3300037418 Ga0395900_0090106 Ga0395900_0090106_301_723 140
288 3300037418 Ga0395900_0267964 Ga0395900_0267964_303_725 140
289 3300037418 Ga0395900_0861709 Ga0395900_0861709_61_483 140
290 3300037466 Ga0395898_0130418 Ga0395898_0130418_1880_2302 140
291 3300037466 Ga0395898_0299083 Ga0395898_0299083_984_1406 140
292 3300037466 Ga0395898_0695629 Ga0395898_0695629_387_809 140
293 3300037471 Ga0395905_0001254 Ga0395905_0001254_11476_11898 140
294 3300037471 Ga0395905_0005293 Ga0395905_0005293_9460_9882 140
295 3300037471 Ga0395905_0335970 Ga0395905_0335970_622_1044 140
296 3300037471 Ga0395905_1216270 Ga0395905_1216270_167_589 140
297 3300038443 Ga0395901_0000861 Ga0395901_0000861_11460_11882 140
298 3300038443 Ga0395901_0011134 Ga0395901_0011134_3981_4403 140
299 3300038443 Ga0395901_0989650 Ga0395901_0989650_140_562 140
300 3300039447 Ga0436361_1134729 Ga0436361_1134729_1329_1751 140
301 3300041486 Ga0451807_2467709 Ga0451807_2467709_15_437 140
302 3300041503 Ga0451847_0381287 Ga0451847_0381287_64_495 140
303 3300042007 Ga0439449_0355032 Ga0439449_0355032_113_535 140
304 3300044658 Ga0466972_0000035 Ga0466972_0000035_57485_57907 140
305 3300044735 Ga0466968_0408013 Ga0466968_0408013_231_653 140
306 3300044765 Ga0466970_0000119 Ga0466970_0000119_12321_12743 140
307 3300046453 Ga0495627_014539 Ga0495627_014539_2280_2702 140
308 3300046453 Ga0495627_098367 Ga0495627_098367_89_511 140
309 3300046460 Ga0495638_0075971 Ga0495638_0075971_443_865 140
310 3300046460 Ga0495638_0291724 Ga0495638_0291724_440_862 140
311 3300046462 Ga0495651_0793362 Ga0495651_0793362_77_499 140
312 3300046471 Ga0495650_0000025 Ga0495650_0000025_420491_420913 140
313 3300046492 Ga0495585_0000164 Ga0495585_0000164_20744_21166 140
314 3300046506 Ga0495583_0117753 Ga0495583_0117753_610_1032 140
315 3300046507 Ga0495606_0000035 Ga0495606_0000035_92814_93236 140
316 3300046507 Ga0495606_0173450 Ga0495606_0173450_363_785 140
317 3300046507 Ga0495606_0368270 Ga0495606_0368270_205_627 140
318 3300046507 Ga0495606_0515399 Ga0495606_0515399_61_483 140
319 3300046512 Ga0495610_0000785 Ga0495610_0000785_17552_17974 140
320 3300046512 Ga0495610_0001761 Ga0495610_0001761_12173_12595 140
321 3300046512 Ga0495610_0003232 Ga0495610_0003232_2421_2843 140
322 3300046520 Ga0495637_0007789 Ga0495637_0007789_3409_3831 140
323 3300046524 Ga0495648_0277575 Ga0495648_0277575_167_589 140
324 3300046538 Ga0495609_0025981 Ga0495609_0025981_243_665 140
325 3300046538 Ga0495609_0053058 Ga0495609_0053058_288_710 140
326 3300046558 Ga0495633_0000101 Ga0495633_0000101_24072_24494 140
327 3300046558 Ga0495633_0003591 Ga0495633_0003591_588_1010 140
328 3300046616 Ga0495668_0002709 Ga0495668_0002709_7628_8050 140
329 3300046660 Ga0495625_0000063 Ga0495625_0000063_74718_75173 140
330 3300046665 Ga0495661_0003891 Ga0495661_0003891_8442_8864 140
331 3300046665 Ga0495661_0076115 Ga0495661_0076115_130_585 140
332 3300046692 Ga0495671_0044393 Ga0495671_0044393_1262_1684 140
333 3300046694 Ga0495649_0000006 Ga0495649_0000006_122270_122725 140
334 3300046794 Ga0495589_0225229 Ga0495589_0225229_103_525 140
335 3300046810 Ga0495660_0027688 Ga0495660_0027688_2758_3180 140
336 3300047323 Ga0495683_0129760 Ga0495683_0129760_725_1147 140
337 3300047443 Ga0495687_000304 Ga0495687_000304_38016_38438 140
338 3300047469 Ga0495673_0050774 Ga0495673_0050774_965_1420 140
339 3300047470 Ga0495681_0092261 Ga0495681_0092261_219_641 140
340 3300047472 Ga0495686_0000113 Ga0495686_0000113_99343_99765 140
341 3300048918 Ga0496115_0604042 Ga0496115_0604042_346_768 140
342 3300049459 Ga0495678_174072 Ga0495678_174072_136_558 140
343 3300049579 Ga0501043_0058327 Ga0501043_0058327_2543_2986 140
344 3300049581 Ga0501047_0208524 Ga0501047_0208524_1339_1761 140
345 3300049582 Ga0501048_1170423 Ga0501048_1170423_118_540 140
346 3300049587 Ga0501071_0334191 Ga0501071_0334191_495_938 140
347 3300049663 Ga0501223_002488 Ga0501223_002488_1626_2048 140
348 3300049673 Ga0501240_051107 Ga0501240_051107_44_466 140
349 3300049703 Ga0501219_000390 Ga0501219_000390_1577_1999 140
350 3300049758 Ga0501241_076652 Ga0501241_076652_104_526 140
351 3300049822 Ga0501035_0171420 Ga0501035_0171420_142_564 140
352 3300049823 Ga0501044_0401397 Ga0501044_0401397_812_1255 140
353 3300049823 Ga0501044_0677850 Ga0501044_0677850_403_825 140
354 3300049824 Ga0501045_0579623 Ga0501045_0579623_15_458 140
355 3300050005 Ga0501284_00049 Ga0501284_00049_7766_8188 140
356 3300050493 nmdc:mga0k408_131720_c1 nmdc:mga0k408_131720_c1_844_1266 140
357 3300053088 Ga0500644_0420040 Ga0500644_0420040_95_517 140
358 3300053091 Ga0500647_0186022 Ga0500647_0186022_386_808 140
359 3300053092 Ga0500583_0135047 Ga0500583_0135047_677_1099 140
360 3300053093 Ga0500651_0000476 Ga0500651_0000476_9308_9739 140
361 3300053125 Ga0500618_000238 Ga0500618_000238_17249_17671 140
362 3300053130 Ga0500642_0109247 Ga0500642_0109247_588_1010 140
363 3300053131 Ga0500652_116443 Ga0500652_116443_664_1086 140
364 3300053136 Ga0500559_0059695 Ga0500559_0059695_55_573 140
365 3300053139 Ga0500568_0142449 Ga0500568_0142449_203_625 140
366 3300053151 Ga0500604_0016100 Ga0500604_0016100_1162_1584 140
367 3300053161 Ga0500634_0310195 Ga0500634_0310195_102_524 140
368 3300053730 Ga0500645_029918 Ga0500645_029918_711_1133 140
369 3300060353 Ga0501082_0584733 Ga0501082_0584733_197_640 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

19

136

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.9114 5 140
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.9002 1 140
1vph-assembly2.cif.gz_E crystal structure of a ybjq-like protein of unknown function (sso2532) from sulfolobus solfataricus p2 at 1.76 a resolution 0.9 2 140
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.8939 1 140
2cu5-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1486 from thermus thermophilus hb8 0.8924 7 135
ID Description Score Start End Superfamily
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9824 1 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9754 1 139 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9601 2 140 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9534 2 140 2.60.120.460
2cu5A00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9086 5 134 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A1G8CKQ5-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9951 2 140
AF-A0A6N8JGD5-F1-model_v4 YjbQ family protein 0.9926 1 140
AF-A0A7Z2AXP6-F1-model_v4 deleted 0.9925 2 139
AF-A0A512RKX1-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9914 2 140
AF-A0A1G8BX26-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9912 1 140

Feature Viewer

pLDDT pTM Quality
94.31 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map