F424337

General Info

Members Datasets Scaffolds Average Seq Length
367 220 336 634

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10134260|Ga0105239_101342602
Length 682
Sequence MLPELGQFALILALLLACVQCALPIYGAWRGNAILISLARPAVAGQAVFVVLAFGLLSYAFVTQDFSVAYVAQNSNLALPWYYRFSAVWGAHEGSLLLWVLILNIWSVAVATFSRRLPDALIARVLGVLGFISFGFLLFTILTSNPFLRRLPALADGSDLNPILQDPGLIMHPPMLYTGYVGFSVAFAXXXXALLGGAESRADSRARQALGDNRAPDFIQWVRWARPWTNVAWAFLTLGISLGSWWAYYVLGWGXXXFWDPVENASFMPWLVGTALIHSQAVTEKRGSFRAWTLLLSIFAFSLSLLGTFLVRSGVLTSVHAFASDPKRGLFILAFLGVVVGGSLLIHAIRAPKVAGGKPFRMLSRETLLLVNNLLFTCAAAMVLLGTLYPLIGDALGVGRISVGPPYFGFMFVLLMAPVVLLLPFGPFFRWQSGDLKATLRRLAPAALPIPFALLGAGLLVGEHVPATAKTYWGIAASLWVGGGIVLYALMRWRSAPRGRRYTPEMLGMIFAHFGVALFLAGVLITEASSVESDLRLAPNESKNVGGIDFRFKGVERAQGPNFVADQGTIEVSRNGELLTTLYPQKRQYAGGGQVQTKSDIDPGVFRDLYVALGEPLQDGATSPGQGAWAVRIYVKPFVRWIWLGALFMMFGGFVAASDRRFRALPDRIGATNAPPLSEGTA

Samples

Sample ID Description Type Environment
1 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
2 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
3 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
4 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
5 2734482264 Dyella sp. AD052 Isolate Unclassified
6 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
7 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
8 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
9 2818991457 Xanthomonas translucens 569 Isolate Unclassified
10 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
11 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
12 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
13 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
14 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
15 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
16 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
17 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
18 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
19 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
20 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
21 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
22 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
23 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
24 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
25 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
26 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
151 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
216 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
217 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
218 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
219 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
220 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.55
Metatranscriptomes 0
Isolates 8.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 0.27
Rhizoplane 2.45
Rhizosphere 72.48
Stem 0
Stem Tuber 0
Unclassified 18.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001236 3300001979 Bacteria 11564
2 JGI24739J22299_10000042 3300001989 Bacteria 34840
3 JGI24739J22299_10000993 3300001989 Bacteria 10563
4 JGI25152J39213_1000035 3300002773 Bacteria 93806
5 JGI25150J39212_1000111 3300002774 Bacteria 47663
6 JGI25151J46595_10000057 3300003187 Bacteria 151052
7 JGI25153J46596_10000041 3300003215 Bacteria 162103
8 Ga0055536_1001874 3300003781 Bacteria 12248
9 Ga0055531_10017540 3300003794 Bacteria 3016
10 Ga0058692_1000006 3300003856 Bacteria 398109
11 Ga0058692_1000012 3300003856 Bacteria 318930
12 Ga0058692_1000029 3300003856 Bacteria 189475
13 Ga0065165_1003057 3300005262 Bacteria 12525
14 Ga0065714_10071120 3300005288 Bacteria 3662
15 Ga0065704_10082459 3300005289 Bacteria 3597
16 Ga0070658_10004472 3300005327 Bacteria 11385
17 Ga0070670_100000886 3300005331 Bacteria 23588
18 Ga0070670_100073389 3300005331 Bacteria 2939
19 Ga0070666_10000005 3300005335 Bacteria 343092
20 Ga0070666_10000139 3300005335 Bacteria 50346
21 Ga0070666_10014700 3300005335 Bacteria 4986
22 Ga0070666_10022430 3300005335 Bacteria 4098
23 Ga0070682_100029929 3300005337 Bacteria 3282
24 Ga0068868_100103233 3300005338 Bacteria 2309
25 Ga0070660_100027133 3300005339 Bacteria 4271
26 Ga0070661_100000185 3300005344 Bacteria 51364
27 Ga0070668_100061225 3300005347 Bacteria 2916
28 Ga0070667_100039096 3300005367 Bacteria 3976
29 Ga0070709_10004902 3300005434 Bacteria 7231
30 Ga0070663_100000500 3300005455 Bacteria 20724
31 Ga0070663_100076314 3300005455 Bacteria 2451
32 Ga0070685_10001279 3300005466 Bacteria 13293
33 Ga0068853_100000633 3300005539 Bacteria 24186
34 Ga0068853_100008035 3300005539 Bacteria 8462
35 Ga0068853_100011793 3300005539 Bacteria 7105
36 Ga0068853_100021361 3300005539 Bacteria 5396
37 Ga0070693_100012978 3300005547 Bacteria 4232
38 Ga0070665_100001911 3300005548 Bacteria 23550
39 Ga0068855_100003554 3300005563 Bacteria 19058
40 Ga0068855_100016828 3300005563 Bacteria 8794
41 Ga0068855_100030567 3300005563 Bacteria 6440
42 Ga0068855_100107326 3300005563 Bacteria 3208
43 Ga0068855_100116963 3300005563 Bacteria 3055
44 Ga0068857_100085047 3300005577 Bacteria 2827
45 Ga0068856_100013146 3300005614 Bacteria 8020
46 Ga0068856_100029897 3300005614 Bacteria 5324
47 Ga0068859_100008850 3300005617 Bacteria 10163
48 Ga0068863_100110194 3300005841 Bacteria 2621
49 Ga0068858_100007803 3300005842 Bacteria 10332
50 Ga0068862_100000354 3300005844 Bacteria 49717
51 Ga0081540_1002130 3300005983 Bacteria 16480
52 Ga0070712_100005016 3300006175 Bacteria 8196
53 Ga0075431_100034987 3300006847 Bacteria 5174
54 Ga0075429_100046913 3300006880 Bacteria 3759
55 Ga0068865_100050980 3300006881 Bacteria 2862
56 Ga0097620_100008850 3300006931 Bacteria 10163
57 Ga0105251_10000139 3300009011 Bacteria 74032
58 Ga0105251_10000261 3300009011 Bacteria 52880
59 Ga0105240_10003816 3300009093 Bacteria 23288
60 Ga0105240_10013498 3300009093 Bacteria 11219
61 Ga0105240_10022459 3300009093 Bacteria 8362
62 Ga0105240_10032191 3300009093 Bacteria 6791
63 Ga0105243_10005221 3300009148 Bacteria 10161
64 Ga0105241_10038144 3300009174 Bacteria 3622
65 Ga0105242_10014282 3300009176 Bacteria 6151
66 Ga0105248_10019325 3300009177 Bacteria 7537
67 Ga0105248_10041293 3300009177 Bacteria 5171
68 Ga0105237_10000023 3300009545 Bacteria 226144
69 Ga0105237_10012540 3300009545 Bacteria 8928
70 Ga0105237_10020972 3300009545 Bacteria 6726
71 Ga0105237_10058233 3300009545 Bacteria 3867
72 Ga0105237_10071689 3300009545 Bacteria 3459
73 Ga0105238_10000060 3300009551 Bacteria 129934
74 Ga0105238_10009819 3300009551 Bacteria 9584
75 Ga0105238_10010019 3300009551 Bacteria 9505
76 Ga0105238_10022955 3300009551 Bacteria 6359
77 Ga0105238_10026794 3300009551 Bacteria 5876
78 Ga0105249_10000498 3300009553 Bacteria 36320
79 Ga0105249_10051282 3300009553 Bacteria 3763
80 Ga0105239_10006662 3300010375 Bacteria 13354
81 Ga0105239_10034703 3300010375 Bacteria 5541
82 Ga0105239_10042865 3300010375 Bacteria 4959
83 Ga0105239_10085694 3300010375 Bacteria 3472
84 Ga0105239_10134260 3300010375 Bacteria 2754
85 Ga0157314_1000333 3300012500 Bacteria 4914
86 Ga0157371_10007822 3300013102 Bacteria 8583
87 Ga0157371_10007889 3300013102 Bacteria 8545
88 Ga0157370_10007478 3300013104 Bacteria 11865
89 Ga0157370_10081598 3300013104 Bacteria 3042
90 Ga0157369_10000097 3300013105 Bacteria 121042
91 Ga0157369_10015187 3300013105 Bacteria 8692
92 Ga0157369_10088911 3300013105 Bacteria 3298
93 Ga0157369_10092952 3300013105 Bacteria 3220
94 Ga0157374_10011509 3300013296 Bacteria 7667
95 Ga0157378_10000006 3300013297 Bacteria 192683
96 Ga0157378_10075429 3300013297 Bacteria 3036
97 Ga0163162_10000016 3300013306 Bacteria 250836
98 Ga0163162_10020407 3300013306 Bacteria 6511
99 Ga0163162_10039613 3300013306 Bacteria 4710
100 Ga0157372_10000470 3300013307 Bacteria 44468
101 Ga0157375_10009950 3300013308 Bacteria 8363
102 Ga0157375_10055068 3300013308 Bacteria 3920
103 Ga0163163_10000970 3300014325 Bacteria 24383
104 Ga0157379_10018850 3300014968 Bacteria 6088
105 Ga0157376_10008311 3300014969 Bacteria 7482
106 Ga0157376_10012574 3300014969 Bacteria 6286
107 Ga0182005_1000004 3300015265 Bacteria 609645
108 Ga0182005_1000825 3300015265 Bacteria 13935
109 Ga0182005_1001305 3300015265 Bacteria 10217
110 Ga0182005_1001765 3300015265 Bacteria 8315
111 Ga0163161_10001879 3300017792 Bacteria 15327
112 Ga0207425_1000044 3300025245 Bacteria 195202
113 Ga0209129_1000044 3300025258 Bacteria 298971
114 Ga0209676_1000279 3300025292 Bacteria 106358
115 Ga0209025_1000012 3300025294 Bacteria 924362
116 Ga0209758_1000018 3300025297 Bacteria 753320
117 Ga0209758_1002406 3300025297 Bacteria 19172
118 Ga0209050_1013886 3300025298 Bacteria 3529
119 Ga0209257_1000122 3300025304 Bacteria 219678
120 Ga0209257_1000647 3300025304 Bacteria 55358
121 Ga0207656_10001499 3300025321 Bacteria 7733
122 Ga0207656_10007874 3300025321 Bacteria 3902
123 Ga0207713_1000630 3300025735 Bacteria 34309
124 Ga0207713_1001939 3300025735 Bacteria 15650
125 Ga0207692_10009940 3300025898 Bacteria 3989
126 Ga0207680_10000005 3300025903 Bacteria 660983
127 Ga0207680_10000215 3300025903 Bacteria 27897
128 Ga0207647_10000350 3300025904 Bacteria 37343
129 Ga0207647_10004964 3300025904 Bacteria 9808
130 Ga0207647_10013852 3300025904 Bacteria 5583
131 Ga0207643_10031743 3300025908 Bacteria 2946
132 Ga0207705_10005669 3300025909 Bacteria 9320
133 Ga0207707_10001182 3300025912 Bacteria 24582
134 Ga0207707_10005580 3300025912 Bacteria 11008
135 Ga0207695_10000007 3300025913 Bacteria 1092551
136 Ga0207695_10000182 3300025913 Bacteria 184125
137 Ga0207695_10001068 3300025913 Bacteria 47945
138 Ga0207695_10002599 3300025913 Bacteria 26471
139 Ga0207695_10010715 3300025913 Bacteria 11193
140 Ga0207695_10020373 3300025913 Bacteria 7598
141 Ga0207695_10022096 3300025913 Bacteria 7236
142 Ga0207671_10000020 3300025914 Bacteria 309636
143 Ga0207671_10000033 3300025914 Bacteria 245869
144 Ga0207671_10001379 3300025914 Bacteria 28266
145 Ga0207671_10004485 3300025914 Bacteria 13308
146 Ga0207671_10005611 3300025914 Bacteria 11513
147 Ga0207693_10000455 3300025915 Bacteria 37329
148 Ga0207657_10003945 3300025919 Bacteria 15757
149 Ga0207652_10030643 3300025921 Bacteria 4506
150 Ga0207694_10004524 3300025924 Bacteria 10847
151 Ga0207694_10006273 3300025924 Bacteria 9083
152 Ga0207694_10013830 3300025924 Bacteria 6083
153 Ga0207694_10023282 3300025924 Bacteria 4702
154 Ga0207694_10027999 3300025924 Bacteria 4296
155 Ga0207650_10005514 3300025925 Bacteria 8634
156 Ga0207650_10050716 3300025925 Bacteria 3070
157 Ga0207664_10002859 3300025929 Bacteria 11469
158 Ga0207709_10000898 3300025935 Bacteria 22480
159 Ga0207709_10008931 3300025935 Bacteria 5533
160 Ga0207691_10004047 3300025940 Bacteria 14216
161 Ga0207711_10001336 3300025941 Bacteria 23339
162 Ga0207711_10082855 3300025941 Bacteria 2804
163 Ga0207689_10036820 3300025942 Bacteria 4061
164 Ga0207667_10000130 3300025949 Bacteria 115321
165 Ga0207667_10001289 3300025949 Bacteria 31377
166 Ga0207667_10003176 3300025949 Bacteria 20327
167 Ga0207667_10005924 3300025949 Bacteria 14884
168 Ga0207712_10000339 3300025961 Bacteria 42473
169 Ga0207712_10000634 3300025961 Bacteria 27702
170 Ga0207712_10039697 3300025961 Bacteria 3226
171 Ga0207668_10026303 3300025972 Bacteria 3776
172 Ga0207640_10003468 3300025981 Bacteria 8492
173 Ga0207658_10000098 3300025986 Bacteria 96611
174 Ga0207658_10011828 3300025986 Bacteria 5945
175 Ga0207677_10084251 3300026023 Bacteria 2291
176 Ga0207639_10000454 3300026041 Bacteria 28220
177 Ga0207639_10000507 3300026041 Bacteria 26971
178 Ga0207639_10001111 3300026041 Bacteria 18285
179 Ga0207639_10003408 3300026041 Bacteria 10693
180 Ga0207639_10017380 3300026041 Bacteria 5098
181 Ga0207678_10000281 3300026067 Bacteria 46171
182 Ga0207702_10011012 3300026078 Bacteria 7545
183 Ga0207641_10069454 3300026088 Bacteria 3024
184 Ga0207674_10000218 3300026116 Bacteria 71563
185 Ga0207674_10014348 3300026116 Bacteria 8753
186 Ga0207683_10020782 3300026121 Bacteria 5617
187 Ga0207698_10055801 3300026142 Bacteria 3047
188 Ga0209371_1000007 3300027312 Bacteria 1050654
189 Ga0209371_1000016 3300027312 Bacteria 646301
190 Ga0209371_1000072 3300027312 Bacteria 199942
191 Ga0268266_10000004 3300028379 Bacteria 1495817
192 Ga0268266_10000006 3300028379 Bacteria 1410021
193 Ga0268265_10000775 3300028380 Bacteria 30819
194 Ga0268256_1000008 3300030500 Bacteria 1050654
195 Ga0268256_1000015 3300030500 Bacteria 646300
196 Ga0268256_1000065 3300030500 Bacteria 199943
197 Ga0265328_10006393 3300031239 Bacteria 4996
198 Ga0265328_10007489 3300031239 Bacteria 4547
199 Ga0265331_10000055 3300031250 Bacteria 177693
200 Ga0265327_10000045 3300031251 Bacteria 282880
201 Ga0265327_10000512 3300031251 Bacteria 67274
202 Ga0265327_10000556 3300031251 Bacteria 63939
203 Ga0265327_10003260 3300031251 Bacteria 15736
204 Ga0265316_10002801 3300031344 Bacteria 17850
205 Ga0307513_10175759 3300031456 Bacteria 2012
206 Ga0307508_10018162 3300031616 Bacteria 6391
207 Ga0307412_10000684 3300031911 Bacteria 19615
208 Ga0307414_10056869 3300032004 Bacteria 2746
209 Ga0307510_10020810 3300033180 Bacteria 7659
210 Ga0395905_0000914 3300037471 Bacteria 38163
211 Ga0395905_0003363 3300037471 Bacteria 17143
212 Ga0237819_00687 3300038705 Bacteria 10977
213 Ga0436361_0898793 3300039447 Bacteria 17943
214 Ga0436363_1526758 3300039450 Bacteria 6995
215 Ga0439465_0000369 3300041413 Bacteria 12906
216 Ga0439465_0005256 3300041413 Bacteria 4144
217 Ga0451793_0387481 3300041452 Bacteria 2321
218 Ga0451800_0044748 3300041459 Bacteria 4236
219 Ga0451806_169204 3300041462 Bacteria 2768
220 Ga0451807_2430884 3300041486 Bacteria 2566
221 Ga0439449_0000207 3300042007 Bacteria 20712
222 Ga0439449_0001465 3300042007 Bacteria 9251
223 Ga0466972_0004551 3300044658 Bacteria 6946
224 Ga0466972_0005062 3300044658 Bacteria 6606
225 Ga0466982_0000020 3300044672 Bacteria 99164
226 Ga0453684_0000437 3300044712 Bacteria 169900
227 Ga0466970_0017167 3300044765 Bacteria 3737
228 Ga0466959_0001336 3300045049 Bacteria 15010
229 Ga0451576_0000081 3300045051 Bacteria 239875
230 Ga0495650_0000590 3300046471 Bacteria 50202
231 Ga0495584_0000050 3300046491 Bacteria 87308
232 Ga0495606_0000356 3300046507 Bacteria 78185
233 Ga0495632_0000003 3300046519 Bacteria 396071
234 Ga0495643_0002439 3300046522 Bacteria 14756
235 Ga0495622_0000036 3300046557 Bacteria 122551
236 Ga0495633_0010993 3300046558 Bacteria 4913
237 Ga0495625_0050008 3300046660 Bacteria 3001
238 Ga0495671_0008987 3300046692 Bacteria 5607
239 Ga0495672_0000456 3300047320 Bacteria 48378
240 Ga0495687_001429 3300047443 Bacteria 21978
241 Ga0495686_0001504 3300047472 Bacteria 25161
242 Ga0495686_0025790 3300047472 Bacteria 3849
243 Ga0496104_0000011 3300048907 Bacteria 459358
244 Ga0496105_0000014 3300048908 Bacteria 220911
245 Ga0496106_0002969 3300048909 Bacteria 12622
246 Ga0496114_0009483 3300048917 Bacteria 7727
247 Ga0496115_0000293 3300048918 Bacteria 43225
248 Ga0496116_0002429 3300048919 Bacteria 19630
249 Ga0496117_0000330 3300048920 Bacteria 83673
250 Ga0496117_0004847 3300048920 Bacteria 14541
251 Ga0496118_0000166 3300048921 Bacteria 119204
252 Ga0496118_0001608 3300048921 Bacteria 33395
253 Ga0496118_0009467 3300048921 Bacteria 9835
254 Ga0496118_0019756 3300048921 Bacteria 6008
255 Ga0496118_0027049 3300048921 Bacteria 4864
256 Ga0496118_0029716 3300048921 Bacteria 4577
257 Ga0496118_0090352 3300048921 Bacteria 2110
258 Ga0496119_0000240 3300048922 Bacteria 77404
259 Ga0496119_0002357 3300048922 Bacteria 20805
260 Ga0496119_0002863 3300048922 Bacteria 18408
261 Ga0496120_0000011 3300048923 Bacteria 365549
262 Ga0496120_0000685 3300048923 Bacteria 49749
263 Ga0496120_0029685 3300048923 Bacteria 3334
264 Ga0496121_0004682 3300048924 Bacteria 18146
265 Ga0496121_0010608 3300048924 Bacteria 10353
266 Ga0496121_0091792 3300048924 Bacteria 2369
267 Ga0496122_0000189 3300048925 Bacteria 142792
268 Ga0496122_0000734 3300048925 Bacteria 64135
269 Ga0496122_0000965 3300048925 Bacteria 51557
270 Ga0496122_0002844 3300048925 Bacteria 23694
271 Ga0496122_0012524 3300048925 Bacteria 8431
272 Ga0496122_0012864 3300048925 Bacteria 8272
273 Ga0496122_0019208 3300048925 Bacteria 6255
274 Ga0496123_0000068 3300048926 Bacteria 208797
275 Ga0496123_0000436 3300048926 Bacteria 74963
276 Ga0496123_0000456 3300048926 Bacteria 71960
277 Ga0496123_0002732 3300048926 Bacteria 21150
278 Ga0496123_0003009 3300048926 Bacteria 19474
279 Ga0496123_0008751 3300048926 Bacteria 9241
280 Ga0496124_0000089 3300048927 Bacteria 192423
281 Ga0496124_0000411 3300048927 Bacteria 76929
282 Ga0496124_0000433 3300048927 Bacteria 74353
283 Ga0496124_0000443 3300048927 Bacteria 73242
284 Ga0496124_0000808 3300048927 Bacteria 50879
285 Ga0496124_0008226 3300048927 Bacteria 10940
286 Ga0496125_0004011 3300048928 Bacteria 17305
287 Ga0496125_0006971 3300048928 Bacteria 12103
288 Ga0496125_0009073 3300048928 Bacteria 10289
289 Ga0496125_0009826 3300048928 Bacteria 9750
290 Ga0496125_0018883 3300048928 Bacteria 6525
291 Ga0496126_0000057 3300048929 Bacteria 276781
292 Ga0496126_0019472 3300048929 Bacteria 6683
293 Ga0501032_0000994 3300049569 Bacteria 22837
294 Ga0501032_0039480 3300049569 Bacteria 3210
295 Ga0501033_0006764 3300049570 Bacteria 8956
296 Ga0501034_0000769 3300049571 Bacteria 48050
297 Ga0501034_0001262 3300049571 Bacteria 34347
298 Ga0501034_0002423 3300049571 Bacteria 22561
299 Ga0501037_0001763 3300049573 Bacteria 15712
300 Ga0501037_0010539 3300049573 Bacteria 6789
301 Ga0501038_0009035 3300049574 Bacteria 9146
302 Ga0501038_0033729 3300049574 Bacteria 4507
303 Ga0501039_0003438 3300049575 Bacteria 11824
304 Ga0501046_0008647 3300049580 Bacteria 8851
305 Ga0501046_0069336 3300049580 Bacteria 2743
306 Ga0501047_0000446 3300049581 Bacteria 45717
307 Ga0501047_0042055 3300049581 Bacteria 4416
308 Ga0501048_0003086 3300049582 Bacteria 12699
309 Ga0501067_0004497 3300049583 Bacteria 7693
310 Ga0501069_0002920 3300049585 Bacteria 8772
311 Ga0501070_0010811 3300049586 Bacteria 7710
312 Ga0501072_0001232 3300049588 Bacteria 19103
313 Ga0501073_0003183 3300049589 Bacteria 12318
314 Ga0501073_0003698 3300049589 Bacteria 11488
315 Ga0501073_0007264 3300049589 Bacteria 8247
316 Ga0501074_0004474 3300049590 Bacteria 10003
317 Ga0501225_0011626 3300049705 Bacteria 2476
318 Ga0501080_0006000 3300049742 Bacteria 10889
319 Ga0501080_0015657 3300049742 Bacteria 6992
320 Ga0501080_0026541 3300049742 Bacteria 5381
321 Ga0501080_0040510 3300049742 Bacteria 4344
322 Ga0501083_0000225 3300049744 Bacteria 36374
323 Ga0501035_0003994 3300049822 Bacteria 14069
324 Ga0501044_0001236 3300049823 Bacteria 30366
325 Ga0501044_0001646 3300049823 Bacteria 26227
326 Ga0501044_0012392 3300049823 Bacteria 9230
327 Ga0501044_0051122 3300049823 Bacteria 4262
328 nmdc:mga09592_67517_c1 3300050508 Bacteria 3033
329 nmdc:mga0qj67_10340_c1 3300050509 Bacteria 6971
330 nmdc:mga06r32_28633_c1 3300050510 Bacteria 5216
331 Ga0500610_0000098 3300053079 Bacteria 25847
332 Ga0500651_0001237 3300053093 Bacteria 12706
333 Ga0500651_0003341 3300053093 Bacteria 8760
334 Ga0500597_000155 3300053120 Bacteria 13729
335 Ga0500568_0000145 3300053139 Bacteria 62300
336 Ga0500634_0000195 3300053161 Bacteria 19694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031456 Ga0307513_10175759 Ga0307513_101757591 498
2 iso_pu_bacteria 8021626552 8021630172 518
3 3300049569 Ga0501032_0039480 Ga0501032_0039480_1340_3199 527
4 3300048924 Ga0496121_0091792 Ga0496121_0091792_38_1732 534
5 3300041462 Ga0451806_169204 Ga0451806_169204_922_2751 535
6 3300005983 Ga0081540_1002130 Ga0081540_10021304 554
7 3300015265 Ga0182005_1001765 Ga0182005_10017657 555
8 3300041452 Ga0451793_0387481 Ga0451793_0387481_275_2260 556
9 3300025912 Ga0207707_10001182 Ga0207707_1000118213 559
10 3300025949 Ga0207667_10005924 Ga0207667_100059246 559
11 3300013105 Ga0157369_10088911 Ga0157369_100889113 560
12 3300025921 Ga0207652_10030643 Ga0207652_100306432 560
13 3300025924 Ga0207694_10023282 Ga0207694_100232825 560
14 3300003856 Ga0058692_1000029 Ga0058692_1000029101 562
15 3300027312 Ga0209371_1000072 Ga0209371_100007265 562
16 3300030500 Ga0268256_1000065 Ga0268256_100006565 562
17 3300013105 Ga0157369_10092952 Ga0157369_100929522 564
18 3300025912 Ga0207707_10005580 Ga0207707_100055807 564
19 3300025913 Ga0207695_10022096 Ga0207695_100220964 564
20 3300005339 Ga0070660_100027133 Ga0070660_1000271331 566
21 3300005844 Ga0068862_100000354 Ga0068862_10000035420 566
22 3300025919 Ga0207657_10003945 Ga0207657_1000394511 566
23 3300028380 Ga0268265_10000775 Ga0268265_1000077514 566
24 3300005331 Ga0070670_100073389 Ga0070670_1000733894 568
25 3300025925 Ga0207650_10050716 Ga0207650_100507164 568
26 3300005617 Ga0068859_100008850 Ga0068859_1000088502 569
27 3300006931 Ga0097620_100008850 Ga0097620_10000885010 569
28 3300009011 Ga0105251_10000139 Ga0105251_1000013937 569
29 3300025735 Ga0207713_1000630 Ga0207713_100063021 569
30 3300025972 Ga0207668_10026303 Ga0207668_100263032 569
31 3300044658 Ga0466972_0004551 Ga0466972_0004551_3288_5321 569
32 3300046522 Ga0495643_0002439 Ga0495643_0002439_11770_13689 569
33 3300046660 Ga0495625_0050008 Ga0495625_0050008_139_2058 569
34 3300047320 Ga0495672_0000456 Ga0495672_0000456_11819_13738 569
35 3300048920 Ga0496117_0000330 Ga0496117_0000330_23158_25140 569
36 3300048921 Ga0496118_0029716 Ga0496118_0029716_439_2421 569
37 3300048922 Ga0496119_0000240 Ga0496119_0000240_51485_53467 569
38 3300048923 Ga0496120_0000011 Ga0496120_0000011_339542_341524 569
39 3300048925 Ga0496122_0000189 Ga0496122_0000189_23020_25002 569
40 3300048926 Ga0496123_0000068 Ga0496123_0000068_88999_90981 569
41 3300005841 Ga0068863_100110194 Ga0068863_1001101942 570
42 3300009177 Ga0105248_10041293 Ga0105248_100412931 570
43 3300013308 Ga0157375_10055068 Ga0157375_100550682 570
44 3300014969 Ga0157376_10012574 Ga0157376_100125746 570
45 3300025941 Ga0207711_10082855 Ga0207711_100828552 570
46 3300048927 Ga0496124_0000433 Ga0496124_0000433_51739_53721 571
47 3300003856 Ga0058692_1000006 Ga0058692_1000006216 572
48 3300026121 Ga0207683_10020782 Ga0207683_100207825 572
49 3300027312 Ga0209371_1000016 Ga0209371_1000016215 572
50 3300030500 Ga0268256_1000015 Ga0268256_1000015355 572
51 3300005539 Ga0068853_100008035 Ga0068853_1000080356 573
52 3300005563 Ga0068855_100016828 Ga0068855_1000168286 573
53 3300005577 Ga0068857_100085047 Ga0068857_1000850472 573
54 3300026041 Ga0207639_10017380 Ga0207639_100173802 573
55 3300049569 Ga0501032_0000994 Ga0501032_0000994_16758_18785 573
56 3300049571 Ga0501034_0001262 Ga0501034_0001262_4035_6062 573
57 3300049573 Ga0501037_0001763 Ga0501037_0001763_7340_9367 573
58 3300049574 Ga0501038_0009035 Ga0501038_0009035_2508_4535 573
59 3300049580 Ga0501046_0008647 Ga0501046_0008647_2716_4743 573
60 3300049581 Ga0501047_0042055 Ga0501047_0042055_1803_3830 573
61 3300049589 Ga0501073_0007264 Ga0501073_0007264_553_2580 573
62 3300049742 Ga0501080_0006000 Ga0501080_0006000_4983_7010 573
63 3300049822 Ga0501035_0003994 Ga0501035_0003994_3126_5153 573
64 3300049823 Ga0501044_0001236 Ga0501044_0001236_28261_30288 573
65 3300041459 Ga0451800_0044748 Ga0451800_0044748_655_2589 580
66 3300005434 Ga0070709_10004902 Ga0070709_100049025 581
67 3300006175 Ga0070712_100005016 Ga0070712_1000050165 581
68 3300025898 Ga0207692_10009940 Ga0207692_100099402 581
69 3300025915 Ga0207693_10000455 Ga0207693_1000045533 581
70 3300048917 Ga0496114_0009483 Ga0496114_0009483_1464_3404 582
71 3300048927 Ga0496124_0008226 Ga0496124_0008226_1506_3419 582
72 3300048928 Ga0496125_0006971 Ga0496125_0006971_8536_10449 582
73 3300048928 Ga0496125_0018883 Ga0496125_0018883_39_1952 582
74 3300005338 Ga0068868_100103233 Ga0068868_1001032332 583
75 3300014969 Ga0157376_10008311 Ga0157376_100083118 583
76 3300026023 Ga0207677_10084251 Ga0207677_100842512 583
77 3300031616 Ga0307508_10018162 Ga0307508_100181623 583
78 3300005335 Ga0070666_10022430 Ga0070666_100224303 584
79 3300025904 Ga0207647_10004964 Ga0207647_100049648 584
80 3300026116 Ga0207674_10014348 Ga0207674_100143485 584
81 3300003781 Ga0055536_1001874 Ga0055536_10018744 585
82 3300013306 Ga0163162_10000016 Ga0163162_10000016154 585
83 3300025292 Ga0209676_1000279 Ga0209676_100027975 585
84 3300025935 Ga0207709_10008931 Ga0207709_100089314 585
85 3300044712 Ga0453684_0000437 Ga0453684_0000437_158566_160509 585
86 3300045051 Ga0451576_0000081 Ga0451576_0000081_9392_11335 585
87 3300031239 Ga0265328_10006393 Ga0265328_100063934 586
88 3300048922 Ga0496119_0002357 Ga0496119_0002357_8505_10478 586
89 3300048923 Ga0496120_0029685 Ga0496120_0029685_169_2142 586
90 3300048924 Ga0496121_0004682 Ga0496121_0004682_7658_9631 586
91 3300048928 Ga0496125_0004011 Ga0496125_0004011_7630_9603 586
92 3300048929 Ga0496126_0019472 Ga0496126_0019472_1105_3078 586
93 3300046558 Ga0495633_0010993 Ga0495633_0010993_1227_3200 587
94 3300047443 Ga0495687_001429 Ga0495687_001429_5714_7687 587
95 3300053161 Ga0500634_0000195 Ga0500634_0000195_17191_19164 587
96 3300003856 Ga0058692_1000012 Ga0058692_1000012115 588
97 3300005539 Ga0068853_100000633 Ga0068853_1000006339 588
98 3300005563 Ga0068855_100003554 Ga0068855_10000355414 588
99 3300009545 Ga0105237_10058233 Ga0105237_100582332 588
100 3300010375 Ga0105239_10006662 Ga0105239_100066628 588
101 3300025949 Ga0207667_10003176 Ga0207667_100031763 588
102 3300026041 Ga0207639_10000507 Ga0207639_100005079 588
103 3300026088 Ga0207641_10069454 Ga0207641_100694542 588
104 3300027312 Ga0209371_1000007 Ga0209371_1000007274 588
105 3300030500 Ga0268256_1000008 Ga0268256_1000008676 588
106 3300037471 Ga0395905_0000914 Ga0395905_0000914_11646_13598 589
107 3300049823 Ga0501044_0051122 Ga0501044_0051122_786_2777 589
108 3300005288 Ga0065714_10071120 Ga0065714_100711204 590
109 3300014968 Ga0157379_10018850 Ga0157379_100188505 590
110 3300048921 Ga0496118_0001608 Ga0496118_0001608_28051_30063 590
111 3300049580 Ga0501046_0069336 Ga0501046_0069336_185_2173 590
112 3300053093 Ga0500651_0003341 Ga0500651_0003341_6055_8040 590
113 3300046491 Ga0495584_0000050 Ga0495584_0000050_28630_30642 591
114 3300005344 Ga0070661_100000185 Ga0070661_1000001852 592
115 3300005563 Ga0068855_100030567 Ga0068855_1000305676 592
116 3300005614 Ga0068856_100013146 Ga0068856_1000131465 592
117 3300009093 Ga0105240_10032191 Ga0105240_100321915 592
118 3300009545 Ga0105237_10012540 Ga0105237_100125405 592
119 3300009551 Ga0105238_10022955 Ga0105238_100229555 592
120 3300010375 Ga0105239_10085694 Ga0105239_100856942 592
121 3300013105 Ga0157369_10015187 Ga0157369_100151875 592
122 3300013296 Ga0157374_10011509 Ga0157374_100115092 592
123 3300013307 Ga0157372_10000470 Ga0157372_1000047037 592
124 3300015265 Ga0182005_1000825 Ga0182005_10008256 592
125 3300025913 Ga0207695_10000182 Ga0207695_1000018290 592
126 3300025914 Ga0207671_10005611 Ga0207671_1000561110 592
127 3300025924 Ga0207694_10027999 Ga0207694_100279994 592
128 3300025949 Ga0207667_10001289 Ga0207667_1000128922 592
129 3300026041 Ga0207639_10003408 Ga0207639_100034086 592
130 3300031251 Ga0265327_10000512 Ga0265327_1000051242 592
131 3300038705 Ga0237819_00687 Ga0237819_00687_1682_3622 592
132 3300048918 Ga0496115_0000293 Ga0496115_0000293_1948_3921 592
133 3300048927 Ga0496124_0000089 Ga0496124_0000089_495_2483 592
134 3300048929 Ga0496126_0000057 Ga0496126_0000057_151368_153341 592
135 3300045049 Ga0466959_0001336 Ga0466959_0001336_3388_5409 593
136 3300046557 Ga0495622_0000036 Ga0495622_0000036_41668_43683 593
137 3300049571 Ga0501034_0000769 Ga0501034_0000769_17011_18963 593
138 3300049574 Ga0501038_0033729 Ga0501038_0033729_2273_4264 593
139 3300049581 Ga0501047_0000446 Ga0501047_0000446_42265_44217 593
140 3300049583 Ga0501067_0004497 Ga0501067_0004497_1491_3443 593
141 3300049585 Ga0501069_0002920 Ga0501069_0002920_80_2032 593
142 3300049588 Ga0501072_0001232 Ga0501072_0001232_2164_4116 593
143 3300049589 Ga0501073_0003698 Ga0501073_0003698_2429_4381 593
144 3300049742 Ga0501080_0026541 Ga0501080_0026541_927_2879 593
145 3300049744 Ga0501083_0000225 Ga0501083_0000225_3857_5809 593
146 3300049823 Ga0501044_0001646 Ga0501044_0001646_10958_12910 593
147 3300005455 Ga0070663_100076314 Ga0070663_1000763141 594
148 3300026142 Ga0207698_10055801 Ga0207698_100558012 594
149 3300048925 Ga0496122_0000965 Ga0496122_0000965_33979_35913 594
150 3300048926 Ga0496123_0000456 Ga0496123_0000456_15793_17727 594
151 3300005547 Ga0070693_100012978 Ga0070693_1000129782 595
152 3300005539 Ga0068853_100021361 Ga0068853_1000213615 596
153 3300044658 Ga0466972_0005062 Ga0466972_0005062_1165_3201 596
154 3300048925 Ga0496122_0012864 Ga0496122_0012864_4283_6241 596
155 3300048926 Ga0496123_0008751 Ga0496123_0008751_1791_3749 596
156 3300053079 Ga0500610_0000098 Ga0500610_0000098_20400_22391 596
157 3300006881 Ga0068865_100050980 Ga0068865_1000509802 597
158 3300009176 Ga0105242_10014282 Ga0105242_100142822 597
159 3300013104 Ga0157370_10007478 Ga0157370_1000747813 597
160 3300013306 Ga0163162_10039613 Ga0163162_100396135 597
161 3300013308 Ga0157375_10009950 Ga0157375_100099502 597
162 3300031239 Ga0265328_10007489 Ga0265328_100074895 597
163 3300031250 Ga0265331_10000055 Ga0265331_10000055108 597
164 3300031251 Ga0265327_10000045 Ga0265327_10000045210 597
165 3300032004 Ga0307414_10056869 Ga0307414_100568692 597
166 3300048907 Ga0496104_0000011 Ga0496104_0000011_211388_213403 597
167 3300048908 Ga0496105_0000014 Ga0496105_0000014_211415_213430 597
168 3300005614 Ga0068856_100029897 Ga0068856_1000298972 598
169 3300025298 Ga0209050_1013886 Ga0209050_10138864 598
170 3300025961 Ga0207712_10039697 Ga0207712_100396972 598
171 3300026078 Ga0207702_10011012 Ga0207702_100110124 598
172 3300041413 Ga0439465_0005256 Ga0439465_0005256_1044_2978 598
173 3300042007 Ga0439449_0000207 Ga0439449_0000207_2528_4462 598
174 3300049582 Ga0501048_0003086 Ga0501048_0003086_647_2758 598
175 3300048928 Ga0496125_0009826 Ga0496125_0009826_4682_6616 599
176 iso_pu_bacteria 2547132130 2547499613 599
177 iso_pu_bacteria 2765235840 2765579732 599
178 iso_pu_bacteria 2816332141 2816517812 599
179 iso_pu_bacteria 2842391507 2842391995 599
180 iso_pu_bacteria 2842757796 2842760064 599
181 iso_pu_bacteria 2874220319 2874222427 599
182 iso_pu_bacteria 2919089067 2919090365 599
183 iso_pu_bacteria 2919134579 2919138484 599
184 iso_pu_bacteria 2928496128 2928497752 599
185 iso_pu_bacteria 2931380184 2931384117 599
186 iso_pu_bacteria 2937610967 2937614720 599
187 iso_pu_bacteria 2939626828 2939630594 599
188 iso_pu_bacteria 2961047084 2961049192 599
189 iso_pu_bacteria 2961064222 2961066110 599
190 3300005455 Ga0070663_100000500 Ga0070663_10000050021 600
191 3300005539 Ga0068853_100011793 Ga0068853_1000117933 600
192 3300006847 Ga0075431_100034987 Ga0075431_1000349874 600
193 3300006880 Ga0075429_100046913 Ga0075429_1000469132 600
194 3300009177 Ga0105248_10019325 Ga0105248_100193256 600
195 3300009545 Ga0105237_10071689 Ga0105237_100716892 600
196 3300009553 Ga0105249_10000498 Ga0105249_100004983 600
197 3300015265 Ga0182005_1001305 Ga0182005_10013052 600
198 3300025914 Ga0207671_10001379 Ga0207671_100013794 600
199 3300025941 Ga0207711_10001336 Ga0207711_100013363 600
200 3300025961 Ga0207712_10000634 Ga0207712_100006343 600
201 3300026041 Ga0207639_10001111 Ga0207639_100011113 600
202 3300026067 Ga0207678_10000281 Ga0207678_100002813 600
203 3300047472 Ga0495686_0001504 Ga0495686_0001504_1607_3637 600
204 3300048925 Ga0496122_0000734 Ga0496122_0000734_2826_4856 600
205 3300048926 Ga0496123_0002732 Ga0496123_0002732_18956_20986 600
206 3300050508 nmdc:mga09592_67517_c1 nmdc:mga09592_67517_c1_324_2315 600
207 3300050509 nmdc:mga0qj67_10340_c1 nmdc:mga0qj67_10340_c1_1173_3164 600
208 3300050510 nmdc:mga06r32_28633_c1 nmdc:mga06r32_28633_c1_2260_4251 600
209 3300025908 Ga0207643_10031743 Ga0207643_100317432 601
210 3300025940 Ga0207691_10004047 Ga0207691_100040473 601
211 3300025942 Ga0207689_10036820 Ga0207689_100368203 601
212 3300053120 Ga0500597_000155 Ga0500597_000155_3304_5334 601
213 iso_pu_bacteria 8054357960 8054359975 601
214 3300037471 Ga0395905_0003363 Ga0395905_0003363_874_2832 602
215 3300053139 Ga0500568_0000145 Ga0500568_0000145_56036_58027 602
216 3300002773 JGI25152J39213_1000035 JGI25152J39213_100003533 603
217 3300002774 JGI25150J39212_1000111 JGI25150J39212_100011123 603
218 3300003187 JGI25151J46595_10000057 JGI25151J46595_10000057111 603
219 3300003215 JGI25153J46596_10000041 JGI25153J46596_10000041118 603
220 3300005335 Ga0070666_10014700 Ga0070666_100147006 603
221 3300005347 Ga0070668_100061225 Ga0070668_1000612252 603
222 3300005367 Ga0070667_100039096 Ga0070667_1000390964 603
223 3300009148 Ga0105243_10005221 Ga0105243_100052218 603
224 3300009553 Ga0105249_10051282 Ga0105249_100512824 603
225 3300013102 Ga0157371_10007822 Ga0157371_100078229 603
226 3300013102 Ga0157371_10007889 Ga0157371_100078898 603
227 3300013104 Ga0157370_10081598 Ga0157370_100815982 603
228 3300017792 Ga0163161_10001879 Ga0163161_100018796 603
229 3300025245 Ga0207425_1000044 Ga0207425_100004469 603
230 3300025258 Ga0209129_1000044 Ga0209129_1000044208 603
231 3300025294 Ga0209025_1000012 Ga0209025_1000012293 603
232 3300025297 Ga0209758_1000018 Ga0209758_1000018365 603
233 3300025321 Ga0207656_10007874 Ga0207656_100078744 603
234 3300025935 Ga0207709_10000898 Ga0207709_100008987 603
235 3300025961 Ga0207712_10000339 Ga0207712_1000033936 603
236 3300025986 Ga0207658_10011828 Ga0207658_100118284 603
237 3300031911 Ga0307412_10000684 Ga0307412_100006848 603
238 3300047472 Ga0495686_0025790 Ga0495686_0025790_1035_2975 603
239 3300048919 Ga0496116_0002429 Ga0496116_0002429_10330_12249 603
240 3300048921 Ga0496118_0027049 Ga0496118_0027049_1875_3794 603
241 3300048924 Ga0496121_0010608 Ga0496121_0010608_7388_9307 603
242 3300048928 Ga0496125_0009073 Ga0496125_0009073_7344_9263 603
243 iso_pu_bacteria 2747842428 2747949154 603
244 iso_pu_bacteria 2987605356 2987606246 603
245 3300025904 Ga0207647_10000350 Ga0207647_1000035020 604
246 3300025924 Ga0207694_10013830 Ga0207694_100138306 604
247 3300048921 Ga0496118_0009467 Ga0496118_0009467_3595_5568 604
248 3300049742 Ga0501080_0040510 Ga0501080_0040510_862_2826 604
249 iso_pu_bacteria 2690315857 2691331763 604
250 iso_pu_bacteria 2818991457 2819659907 604
251 iso_pu_bacteria 2852684882 2852685265 604
252 iso_pu_bacteria 2919130084 2919131386 604
253 iso_pu_bacteria 2919534386 2919537026 604
254 iso_pu_bacteria 2929195423 2929198192 604
255 iso_pu_bacteria 8021622325 8021624798 604
256 iso_pu_bacteria 8021648035 8021650142 604
257 3300039447 Ga0436361_0898793 Ga0436361_0898793_3873_5849 605
258 3300042007 Ga0439449_0001465 Ga0439449_0001465_2568_4484 606
259 3300048925 Ga0496122_0012524 Ga0496122_0012524_4216_6135 606
260 3300048926 Ga0496123_0003009 Ga0496123_0003009_13163_15082 606
261 3300003794 Ga0055531_10017540 Ga0055531_100175404 607
262 3300025304 Ga0209257_1000122 Ga0209257_1000122137 607
263 3300025304 Ga0209257_1000647 Ga0209257_100064732 607
264 3300041413 Ga0439465_0000369 Ga0439465_0000369_282_2201 607
265 3300046692 Ga0495671_0008987 Ga0495671_0008987_344_2263 607
266 3300048925 Ga0496122_0019208 Ga0496122_0019208_3435_5354 607
267 3300048927 Ga0496124_0000411 Ga0496124_0000411_38548_40506 607
268 3300049705 Ga0501225_0011626 Ga0501225_0011626_225_2162 607
269 3300005289 Ga0065704_10082459 Ga0065704_100824593 608
270 3300005331 Ga0070670_100000886 Ga0070670_10000088618 608
271 3300005548 Ga0070665_100001911 Ga0070665_10000191119 608
272 3300005842 Ga0068858_100007803 Ga0068858_10000780311 608
273 3300009011 Ga0105251_10000261 Ga0105251_100002614 608
274 3300013297 Ga0157378_10000006 Ga0157378_1000000629 608
275 3300025735 Ga0207713_1001939 Ga0207713_100193914 608
276 3300025913 Ga0207695_10020373 Ga0207695_100203734 608
277 3300025925 Ga0207650_10005514 Ga0207650_100055146 608
278 3300026041 Ga0207639_10000454 Ga0207639_1000045411 608
279 3300028379 Ga0268266_10000006 Ga0268266_100000061035 608
280 3300031251 Ga0265327_10000556 Ga0265327_1000055610 608
281 3300031251 Ga0265327_10003260 Ga0265327_1000326012 608
282 3300031344 Ga0265316_10002801 Ga0265316_100028018 608
283 3300048920 Ga0496117_0004847 Ga0496117_0004847_12371_14305 608
284 3300048921 Ga0496118_0090352 Ga0496118_0090352_109_2043 608
285 3300048922 Ga0496119_0002863 Ga0496119_0002863_8421_10355 608
286 3300048923 Ga0496120_0000685 Ga0496120_0000685_34579_36513 608
287 3300048925 Ga0496122_0002844 Ga0496122_0002844_13325_15259 608
288 3300048926 Ga0496123_0000436 Ga0496123_0000436_34689_36623 608
289 3300048927 Ga0496124_0000443 Ga0496124_0000443_61867_63801 608
290 3300048927 Ga0496124_0000808 Ga0496124_0000808_12083_14044 608
291 3300049742 Ga0501080_0015657 Ga0501080_0015657_3659_5623 608
292 3300041486 Ga0451807_2430884 Ga0451807_2430884_551_2476 609
293 3300049570 Ga0501033_0006764 Ga0501033_0006764_2553_4658 610
294 3300049571 Ga0501034_0002423 Ga0501034_0002423_8991_11096 610
295 3300049573 Ga0501037_0010539 Ga0501037_0010539_386_2491 610
296 3300049575 Ga0501039_0003438 Ga0501039_0003438_3073_5178 610
297 3300049586 Ga0501070_0010811 Ga0501070_0010811_120_2225 610
298 3300049589 Ga0501073_0003183 Ga0501073_0003183_3141_5246 610
299 3300049590 Ga0501074_0004474 Ga0501074_0004474_23_2128 610
300 3300049823 Ga0501044_0012392 Ga0501044_0012392_2021_4126 610
301 iso_pu_bacteria 8057160832 8057160917 610
302 3300010375 Ga0105239_10042865 Ga0105239_100428654 611
303 3300005337 Ga0070682_100029929 Ga0070682_1000299293 612
304 3300005335 Ga0070666_10000139 Ga0070666_1000013929 614
305 3300013297 Ga0157378_10075429 Ga0157378_100754293 614
306 3300025903 Ga0207680_10000215 Ga0207680_100002152 614
307 3300025929 Ga0207664_10002859 Ga0207664_100028599 614
308 3300039450 Ga0436363_1526758 Ga0436363_1526758_1285_3240 614
309 3300014325 Ga0163163_10000970 Ga0163163_100009705 615
310 3300046507 Ga0495606_0000356 Ga0495606_0000356_16154_18133 615
311 3300010375 Ga0105239_10034703 Ga0105239_100347034 616
312 3300015265 Ga0182005_1000004 Ga0182005_10000046 616
313 3300009093 Ga0105240_10022459 Ga0105240_100224595 617
314 3300025913 Ga0207695_10010715 Ga0207695_100107155 617
315 3300053093 Ga0500651_0001237 Ga0500651_0001237_6324_8312 617
316 iso_pu_bacteria 2687453129 2687578048 617
317 iso_pu_bacteria 2904615490 2904616212 617
318 3300005327 Ga0070658_10004472 Ga0070658_1000447212 618
319 3300005335 Ga0070666_10000005 Ga0070666_10000005233 618
320 3300009551 Ga0105238_10000060 Ga0105238_10000060107 618
321 3300013306 Ga0163162_10020407 Ga0163162_100204073 618
322 3300025903 Ga0207680_10000005 Ga0207680_10000005591 618
323 3300025909 Ga0207705_10005669 Ga0207705_100056694 618
324 3300025924 Ga0207694_10004524 Ga0207694_1000452413 618
325 3300028379 Ga0268266_10000004 Ga0268266_10000004940 618
326 3300033180 Ga0307510_10020810 Ga0307510_100208108 618
327 3300046471 Ga0495650_0000590 Ga0495650_0000590_12194_14158 618
328 3300010375 Ga0105239_10134260 Ga0105239_101342602 619
329 3300044765 Ga0466970_0017167 Ga0466970_0017167_388_2409 619
330 3300005466 Ga0070685_10001279 Ga0070685_100012796 620
331 3300009093 Ga0105240_10003816 Ga0105240_100038169 620
332 3300009545 Ga0105237_10020972 Ga0105237_100209725 620
333 3300009551 Ga0105238_10009819 Ga0105238_1000981911 620
334 3300025913 Ga0207695_10000007 Ga0207695_10000007952 620
335 3300025924 Ga0207694_10006273 Ga0207694_100062737 620
336 3300048921 Ga0496118_0019756 Ga0496118_0019756_2778_4769 620
337 3300009174 Ga0105241_10038144 Ga0105241_100381442 621
338 3300009551 Ga0105238_10010019 Ga0105238_100100192 621
339 3300013105 Ga0157369_10000097 Ga0157369_1000009715 621
340 3300025914 Ga0207671_10004485 Ga0207671_100044856 621
341 3300025986 Ga0207658_10000098 Ga0207658_1000009888 622
342 3300046519 Ga0495632_0000003 Ga0495632_0000003_255772_257742 622
343 3300048921 Ga0496118_0000166 Ga0496118_0000166_28466_30493 623
344 3300009551 Ga0105238_10026794 Ga0105238_100267943 624
345 iso_pu_bacteria 2718218334 2721027704 625
346 iso_pu_bacteria 2734482264 2735836736 625
347 3300025297 Ga0209758_1002406 Ga0209758_10024066 627
348 3300048909 Ga0496106_0002969 Ga0496106_0002969_2311_4293 629
349 3300001979 JGI24740J21852_10001236 JGI24740J21852_100012364 630
350 3300001989 JGI24739J22299_10000042 JGI24739J22299_1000004235 630
351 3300001989 JGI24739J22299_10000993 JGI24739J22299_100009938 630
352 3300005262 Ga0065165_1003057 Ga0065165_100305711 630
353 3300005563 Ga0068855_100107326 Ga0068855_1001073262 630
354 3300005563 Ga0068855_100116963 Ga0068855_1001169634 630
355 3300009093 Ga0105240_10013498 Ga0105240_100134985 630
356 3300009545 Ga0105237_10000023 Ga0105237_1000002312 630
357 3300012500 Ga0157314_1000333 Ga0157314_10003334 630
358 3300025321 Ga0207656_10001499 Ga0207656_100014995 630
359 3300025904 Ga0207647_10013852 Ga0207647_100138524 630
360 3300025913 Ga0207695_10001068 Ga0207695_1000106818 630
361 3300025913 Ga0207695_10002599 Ga0207695_1000259913 630
362 3300025914 Ga0207671_10000020 Ga0207671_10000020223 630
363 3300025914 Ga0207671_10000033 Ga0207671_1000003332 630
364 3300025949 Ga0207667_10000130 Ga0207667_10000130111 630
365 3300025981 Ga0207640_10003468 Ga0207640_1000346811 630
366 3300026116 Ga0207674_10000218 Ga0207674_1000021876 630
367 3300044672 Ga0466982_0000020 Ga0466982_0000020_63943_65916 630

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

89

316

0.96

PF16327

CcmF_C

Cytochrome c-type biogenesis protein CcmF C-terminal

333

660

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.8698 1 603
6zmq-assembly1.cif.gz_A cytochrome c heme lyase ccmf 0.8346 1 603
7brs-assembly4.cif.gz_D e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.5817 509 573
7brs-assembly2.cif.gz_B e.coli beta-galactosidase (e537q) in complex with fluorescent probe ksa02 0.5795 509 573
3vd7-assembly1.cif.gz_B e. coli (lacz) beta-galactosidase (n460s) in complex with galactotetrazole 0.4819 507 594
ID Description Score Start End Superfamily
af_O01913_702_992_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5583 498 546 3.90.190.10
af_Q95XJ2_996_1266_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5579 500 550 3.90.190.10
af_Q9U1Q9_1006_1244_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.5547 500 550 3.90.190.10
af_K7TUB1_192_388_3.30.760.10 Alpha Beta;2-Layer Sandwich;RNA Cap, Translation Initiation Factor Eif4e;RNA Cap, Translation Initiation Factor Eif4e 0.52 160 317 3.30.760.10
af_I1JJR6_181_383_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5048 160 312 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A7X5N413-F1-model_v4 C-type cytochrome biogenesis protein CcmF 0.9798 506 595
AF-A0A7X5N413-F1-model_v4 C-type cytochrome biogenesis protein CcmF 0.9692 506 595
AF-A0A455U1B5-F1-model_v4 Cytochrome c assembly protein domain-containing protein 0.962 2 129 GO:0015232
GO:0016020
GO:0017004
AF-A0A753L125-F1-model_v4 Cytochrome c-type biogenesis protein CcmF C-terminal domain-containing protein 0.9564 434 603 GO:0016020
GO:0017004
AF-A0A636LNF1-F1-model_v4 Cytochrome c-type biogenesis protein CcmF C-terminal domain-containing protein 0.9548 431 603 GO:0016020
GO:0017004

Feature Viewer

pLDDT pTM Quality
80.14 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map