F422280

General Info

Members Datasets Scaffolds Average Seq Length
361 249 317 332

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0000612|Ga0373956_0000612_3002_4066
Length 354
Sequence VGRTGVAGPAGGIVTGPGPIRHAAVLGAGSWGTAFAKVLADAGCDVRLWTRGWKVAEAISNTRENPGYLPGVRLPAGLRACTDVVEALDGAELVALAVPSQVLRENLGKWREALPVNACLLSLAKGVELGTLKRMSEVVAEVAGAGAERIAVLSGPNLAKEIAAEQPAATVVACADHEVAVRLQQACATAYFRPYTITDVIGCELGGACKNVIALACGMAAGLGFGGNTLASLVTRGLAETARLGVRLGADPMTFSGLAGLGDLVATCWSPLSRNRTFGERLGMGDTLEQAQQAARGQVAEGVKSCSSVRELALRSGVDMPITDAVYRVCHESLEPRAMAAELLTRDHKPERQA

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2582580736 Prauserella sp. Am3 Isolate Unclassified
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2643221576 Nocardioides sp. Root614 Isolate Unclassified
6 2643221590 Nocardioides sp. Root682 Isolate Unclassified
7 2643221604 Nocardioides sp. Root190 Isolate Unclassified
8 2643221615 Nocardioides sp. Root224 Isolate Unclassified
9 2643221617 Nocardioides sp. Root79 Isolate Unclassified
10 2643221620 Nocardioides sp. Root240 Isolate Unclassified
11 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
12 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
13 2738541305 Nocardioides sp. CF167 Isolate Unclassified
14 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
15 2739367898 Nocardioides sp. CF479 Isolate Unclassified
16 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
17 2773857933 Frankia sp. BMG5.30 Isolate Nodule
18 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
19 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
20 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
21 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
22 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
23 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
24 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
25 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
26 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
27 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
28 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
29 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
30 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
31 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
32 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
33 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
34 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
35 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
36 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
37 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
38 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
39 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
40 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
41 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
42 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
43 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
145 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
146 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
167 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
170 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
248 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
249 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.53
Metatranscriptomes 0.28
Isolates 12.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 1.39
Nodule 0.55
Rhizoplane 5.26
Rhizosphere 79.22
Stem 0
Stem Tuber 0.28
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10026783 3300002067 Bacteria 1731
2 JGI25406J46586_10000620 3300003203 Bacteria 16621
3 rootL2_10193277 3300003322 Bacteria 2024
4 Ga0070658_10049405 3300005327 Bacteria 3407
5 Ga0070658_10072124 3300005327 Bacteria 2829
6 Ga0070658_10250984 3300005327 Bacteria 1501
7 Ga0070683_100145492 3300005329 Bacteria 2245
8 Ga0070683_100209809 3300005329 Bacteria 1850
9 Ga0068869_100101622 3300005334 Bacteria 2175
10 Ga0068868_100140586 3300005338 Bacteria 1981
11 Ga0070660_100001896 3300005339 Bacteria 14400
12 Ga0070689_100177262 3300005340 Bacteria 1730
13 Ga0070687_100077387 3300005343 Bacteria 1804
14 Ga0070668_100001456 3300005347 Bacteria 17104
15 Ga0070669_100079047 3300005353 Bacteria 2445
16 Ga0070688_100065099 3300005365 Bacteria 2316
17 Ga0070659_100008607 3300005366 Bacteria 7463
18 Ga0070659_100014707 3300005366 Bacteria 5852
19 Ga0070659_100150307 3300005366 Bacteria 1900
20 Ga0070667_100161802 3300005367 Bacteria 1972
21 Ga0070714_100100708 3300005435 Bacteria 2545
22 Ga0070713_100010695 3300005436 Bacteria 6641
23 Ga0070710_10000170 3300005437 Bacteria 30007
24 Ga0070711_100015568 3300005439 Bacteria 4814
25 Ga0070700_100000088 3300005441 Bacteria 61864
26 Ga0070663_100017834 3300005455 Bacteria 4641
27 Ga0070663_100345005 3300005455 Bacteria 1204
28 Ga0070678_100133936 3300005456 Bacteria 1973
29 Ga0070678_100288988 3300005456 Bacteria 1389
30 Ga0070662_100135213 3300005457 Bacteria 1905
31 Ga0070662_100442955 3300005457 Bacteria 1077
32 Ga0070685_10004093 3300005466 Bacteria 7366
33 Ga0070706_100157838 3300005467 Bacteria 2117
34 Ga0070707_100022170 3300005468 Bacteria 6004
35 Ga0070707_100194317 3300005468 Bacteria 1978
36 Ga0070699_100089759 3300005518 Bacteria 2686
37 Ga0070699_100176197 3300005518 Bacteria 1896
38 Ga0068853_100004749 3300005539 Bacteria 10561
39 Ga0070696_100149358 3300005546 Bacteria 1714
40 Ga0068855_100160947 3300005563 Bacteria 2548
41 Ga0068855_100270231 3300005563 Bacteria 1891
42 Ga0070664_100079740 3300005564 Bacteria 2819
43 Ga0070664_100114851 3300005564 Bacteria 2352
44 Ga0068854_100038832 3300005578 Bacteria 3350
45 Ga0068856_100037301 3300005614 Bacteria 4769
46 Ga0068852_100014744 3300005616 Bacteria 6032
47 Ga0068859_100491450 3300005617 Bacteria 1322
48 Ga0068861_100084863 3300005719 Bacteria 2486
49 Ga0068858_100311735 3300005842 Bacteria 1503
50 Ga0068862_100089267 3300005844 Bacteria 2683
51 Ga0081455_10000011 3300005937 Bacteria 203132
52 Ga0081455_10000856 3300005937 Bacteria 39231
53 Ga0081455_10001927 3300005937 Bacteria 24929
54 Ga0081455_10004893 3300005937 Bacteria 14843
55 Ga0081538_10056270 3300005981 Bacteria 2305
56 Ga0081539_10001153 3300005985 Bacteria 47882
57 Ga0070717_10183480 3300006028 Bacteria 1825
58 Ga0075364_10064504 3300006051 Bacteria 2404
59 Ga0070712_100045201 3300006175 Bacteria 3040
60 Ga0075428_100010252 3300006844 Bacteria 10404
61 Ga0075430_100001901 3300006846 Bacteria 17116
62 Ga0075431_100000515 3300006847 Bacteria 32391
63 Ga0075431_100004346 3300006847 Bacteria 13894
64 Ga0075431_100004364 3300006847 Bacteria 13882
65 Ga0075434_100236451 3300006871 Bacteria 1847
66 Ga0075429_100001113 3300006880 Bacteria 21672
67 Ga0075429_100004768 3300006880 Bacteria 11676
68 Ga0068865_100294996 3300006881 Bacteria 1295
69 Ga0097620_100491456 3300006931 Bacteria 1322
70 Ga0111539_10073712 3300009094 Bacteria 4024
71 Ga0111539_10370988 3300009094 Bacteria 1666
72 Ga0105245_10201533 3300009098 Bacteria 1911
73 Ga0105245_10541075 3300009098 Bacteria 1186
74 Ga0105247_10101903 3300009101 Bacteria 1836
75 Ga0114129_10001475 3300009147 Bacteria 31859
76 Ga0114129_10030468 3300009147 Bacteria 7634
77 Ga0105243_10034182 3300009148 Bacteria 3934
78 Ga0105243_10199170 3300009148 Bacteria 1755
79 Ga0105238_10081134 3300009551 Bacteria 3233
80 Ga0105238_10158322 3300009551 Bacteria 2240
81 Ga0105249_10306661 3300009553 Bacteria 1594
82 Ga0105239_10181986 3300010375 Bacteria 2351
83 Ga0163162_10028541 3300013306 Bacteria 5522
84 Ga0157372_10100350 3300013307 Bacteria 3303
85 Ga0157372_10198930 3300013307 Bacteria 2321
86 Ga0157372_10289022 3300013307 Bacteria 1907
87 Ga0157375_10145182 3300013308 Bacteria 2503
88 Ga0157380_10066382 3300014326 Bacteria 2901
89 Ga0182008_10059683 3300014497 Bacteria 1882
90 Ga0157379_10175690 3300014968 Bacteria 1934
91 Ga0157376_10058494 3300014969 Bacteria 3229
92 Ga0206353_10765213 3300020082 Bacteria 6079
93 Ga0213875_10001713 3300021388 Bacteria 13768
94 Ga0213875_10107669 3300021388 Bacteria 1301
95 Ga0207697_10039866 3300025315 Bacteria 1927
96 Ga0207692_10000293 3300025898 Bacteria 17337
97 Ga0207692_10198752 3300025898 Bacteria 1177
98 Ga0207710_10052843 3300025900 Bacteria 1827
99 Ga0207688_10021330 3300025901 Bacteria 3538
100 Ga0207647_10022502 3300025904 Bacteria 4184
101 Ga0207645_10072569 3300025907 Bacteria 2203
102 Ga0207705_10203088 3300025909 Bacteria 1502
103 Ga0207693_10019802 3300025915 Bacteria 5350
104 Ga0207663_10238847 3300025916 Bacteria 1332
105 Ga0207662_10186658 3300025918 Bacteria 1336
106 Ga0207657_10007437 3300025919 Bacteria 11235
107 Ga0207681_10077139 3300025923 Bacteria 2342
108 Ga0207694_10110760 3300025924 Bacteria 2184
109 Ga0207659_10321127 3300025926 Bacteria 1277
110 Ga0207700_10002007 3300025928 Bacteria 11610
111 Ga0207664_10036239 3300025929 Bacteria 3812
112 Ga0207664_10043105 3300025929 Bacteria 3527
113 Ga0207690_10034998 3300025932 Bacteria 3239
114 Ga0207690_10214072 3300025932 Bacteria 1471
115 Ga0207690_10217670 3300025932 Bacteria 1459
116 Ga0207690_10414403 3300025932 Bacteria 1077
117 Ga0207706_10038747 3300025933 Bacteria 4228
118 Ga0207706_10288761 3300025933 Bacteria 1430
119 Ga0207689_10046572 3300025942 Bacteria 3584
120 Ga0207679_10048130 3300025945 Bacteria 3102
121 Ga0207679_10175549 3300025945 Bacteria 1768
122 Ga0207668_10002772 3300025972 Bacteria 10249
123 Ga0207668_10370765 3300025972 Bacteria 1202
124 Ga0207658_10056428 3300025986 Bacteria 2915
125 Ga0207639_10119185 3300026041 Bacteria 2165
126 Ga0207678_10013082 3300026067 Bacteria 7281
127 Ga0207678_10019141 3300026067 Bacteria 6011
128 Ga0207678_10094117 3300026067 Bacteria 2560
129 Ga0207678_10388370 3300026067 Bacteria 1207
130 Ga0207708_10000110 3300026075 Bacteria 62957
131 Ga0207708_10240708 3300026075 Bacteria 1455
132 Ga0207708_10254703 3300026075 Bacteria 1415
133 Ga0207702_10042603 3300026078 Bacteria 3808
134 Ga0207702_10063678 3300026078 Bacteria 3154
135 Ga0207674_10032850 3300026116 Bacteria 5440
136 Ga0207675_100129089 3300026118 Bacteria 2396
137 Ga0207675_100351079 3300026118 Bacteria 1445
138 Ga0207698_10067955 3300026142 Bacteria 2812
139 Ga0207428_10035054 3300027907 Bacteria 4105
140 Ga0268264_10107943 3300028381 Bacteria 2432
141 Ga0268264_10581040 3300028381 Bacteria 1102
142 Ga0307515_10142433 3300028794 Bacteria 2562
143 Ga0307515_10165771 3300028794 Bacteria 2228
144 Ga0307511_10001109 3300030521 Bacteria 28721
145 Ga0307511_10086168 3300030521 Bacteria 2166
146 Ga0307512_10025285 3300030522 Bacteria 5265
147 Ga0316177_1074566 3300030731 Bacteria 6133
148 Ga0316176_1175502 3300030732 Bacteria 3782
149 Ga0316182_1279110 3300030745 Bacteria 4810
150 Ga0307513_10067115 3300031456 Bacteria 3766
151 Ga0307513_10298833 3300031456 Bacteria 1378
152 Ga0307405_10101187 3300031731 Bacteria 1933
153 Ga0307413_10000562 3300031824 Bacteria 12452
154 Ga0307413_10010784 3300031824 Bacteria 4455
155 Ga0307413_10359620 3300031824 Bacteria 1126
156 Ga0307413_10393857 3300031824 Bacteria 1083
157 Ga0307518_10002521 3300031838 Bacteria 13370
158 Ga0307406_10025796 3300031901 Bacteria 3522
159 Ga0307406_10050704 3300031901 Bacteria 2632
160 Ga0307407_10157376 3300031903 Bacteria 1483
161 Ga0307412_10202691 3300031911 Bacteria 1508
162 Ga0307409_100023956 3300031995 Bacteria 4244
163 Ga0307409_100096706 3300031995 Bacteria 2437
164 Ga0307416_100010101 3300032002 Bacteria 6219
165 Ga0307416_100284001 3300032002 Bacteria 1634
166 Ga0307414_10194431 3300032004 Bacteria 1644
167 Ga0307411_10033572 3300032005 Bacteria 3184
168 Ga0307415_100124463 3300032126 Bacteria 1940
169 Ga0307507_10023687 3300033179 Bacteria 6725
170 Ga0373956_0000612 3300035119 Bacteria 14647
171 Ga0373925_0191681 3300037068 Bacteria 1622
172 Ga0395899_0009287 3300037312 Bacteria 7551
173 Ga0395900_0020407 3300037418 Bacteria 6765
174 Ga0395900_0365755 3300037418 Bacteria 1413
175 Ga0436364_0473109 3300037853 Bacteria 35842
176 Ga0436364_0674710 3300037853 Bacteria 5672
177 Ga0436364_0813769 3300037853 Bacteria 2496
178 Ga0436364_1485205 3300037853 Bacteria 11763
179 Ga0395901_0093104 3300038443 Bacteria 3155
180 Ga0439465_0042533 3300041413 Bacteria 1472
181 Ga0451837_0052201 3300041494 Bacteria 1290
182 Ga0439445_0020552 3300042004 Bacteria 1653
183 Ga0439449_0007924 3300042007 Bacteria 4034
184 Ga0466969_0008629 3300044656 Bacteria 5406
185 Ga0466969_0044020 3300044656 Bacteria 2223
186 Ga0466972_0002149 3300044658 Bacteria 9683
187 Ga0466972_0008011 3300044658 Bacteria 5295
188 Ga0466972_0022374 3300044658 Bacteria 3149
189 Ga0466965_0000195 3300044683 Bacteria 18846
190 Ga0466965_0003086 3300044683 Bacteria 7258
191 Ga0466965_0073928 3300044683 Bacteria 1717
192 Ga0466965_0096120 3300044683 Bacteria 1511
193 Ga0466966_0013861 3300044684 Bacteria 5335
194 Ga0466966_0014395 3300044684 Bacteria 5237
195 Ga0466966_0141169 3300044684 Bacteria 1472
196 Ga0466961_0047401 3300044693 Bacteria 2748
197 Ga0466961_0086551 3300044693 Bacteria 1980
198 Ga0466961_0173454 3300044693 Bacteria 1341
199 Ga0466963_0001665 3300044694 Bacteria 12105
200 Ga0466963_0134965 3300044694 Bacteria 1707
201 Ga0466963_0149617 3300044694 Bacteria 1621
202 Ga0466963_0268412 3300044694 Bacteria 1199
203 Ga0453684_0246671 3300044712 Bacteria 2053
204 Ga0466971_0076382 3300044719 Bacteria 1524
205 Ga0466971_0088615 3300044719 Bacteria 1416
206 Ga0466968_0002161 3300044735 Bacteria 7175
207 Ga0466968_0008849 3300044735 Bacteria 3863
208 Ga0466970_0004725 3300044765 Bacteria 6728
209 Ga0466970_0025412 3300044765 Bacteria 3100
210 Ga0466970_0046457 3300044765 Bacteria 2312
211 Ga0466970_0080802 3300044765 Bacteria 1757
212 Ga0466957_0070316 3300044842 Bacteria 2163
213 Ga0466960_0004045 3300044901 Bacteria 5696
214 Ga0466960_0011878 3300044901 Bacteria 3661
215 Ga0466960_0051380 3300044901 Bacteria 1991
216 Ga0466960_0124714 3300044901 Bacteria 1352
217 Ga0466960_0132670 3300044901 Bacteria 1316
218 Ga0466959_0002480 3300045049 Bacteria 11812
219 Ga0466959_0020369 3300045049 Bacteria 4887
220 Ga0466959_0166297 3300045049 Bacteria 1549
221 Ga0466958_0018859 3300045836 Bacteria 4009
222 Ga0466967_0003549 3300045976 Bacteria 10216
223 Ga0466967_0054528 3300045976 Bacteria 3519
224 Ga0466967_0089825 3300045976 Bacteria 2790
225 Ga0466967_0093188 3300045976 Bacteria 2740
226 Ga0466967_0146760 3300045976 Bacteria 2201
227 Ga0466967_0524726 3300045976 Bacteria 1164
228 Ga0495627_036419 3300046453 Bacteria 1529
229 Ga0495603_0061275 3300046455 Bacteria 2222
230 Ga0495641_0081996 3300046461 Bacteria 1444
231 Ga0495582_0094968 3300046473 Bacteria 1665
232 Ga0495594_0065951 3300046499 Bacteria 2008
233 Ga0495645_0085901 3300046543 Unclassified 2252
234 Ga0495669_0011515 3300046684 Bacteria 3756
235 Ga0495674_0009769 3300047319 Bacteria 9112
236 Ga0496100_0419882 3300048903 Bacteria 1021
237 Ga0496101_0092960 3300048904 Bacteria 2246
238 Ga0496101_0149581 3300048904 Bacteria 1785
239 Ga0496102_0026632 3300048905 Bacteria 5160
240 Ga0496103_0061386 3300048906 Bacteria 2337
241 Ga0496103_0112864 3300048906 Bacteria 1727
242 Ga0496103_0193554 3300048906 Bacteria 1307
243 Ga0496104_0110130 3300048907 Bacteria 2640
244 Ga0496104_0519103 3300048907 Bacteria 1102
245 Ga0496105_0178513 3300048908 Bacteria 1739
246 Ga0496106_0016388 3300048909 Bacteria 5483
247 Ga0496107_0120429 3300048910 Bacteria 1933
248 Ga0496108_0267161 3300048911 Bacteria 1489
249 Ga0496110_0346039 3300048913 Bacteria 1354
250 Ga0496112_0231072 3300048915 Bacteria 1804
251 Ga0496113_0074440 3300048916 Bacteria 2589
252 Ga0496114_0002789 3300048917 Bacteria 13370
253 Ga0496114_0035800 3300048917 Bacteria 4100
254 Ga0496114_0050480 3300048917 Bacteria 3463
255 Ga0496119_0000061 3300048922 Bacteria 171442
256 Ga0496120_0004587 3300048923 Bacteria 11503
257 Ga0501031_0002402 3300049568 Bacteria 11907
258 Ga0501031_0006622 3300049568 Bacteria 7558
259 Ga0501031_0023342 3300049568 Bacteria 4034
260 Ga0501031_0173006 3300049568 Bacteria 1411
261 Ga0501032_0201762 3300049569 Bacteria 1298
262 Ga0501033_0140462 3300049570 Bacteria 1746
263 Ga0501036_0016526 3300049572 Bacteria 6163
264 Ga0501036_0256582 3300049572 Bacteria 1465
265 Ga0501038_0003732 3300049574 Bacteria 14192
266 Ga0501038_0007971 3300049574 Bacteria 9757
267 Ga0501038_0160420 3300049574 Bacteria 1828
268 Ga0501039_0011200 3300049575 Bacteria 6834
269 Ga0501039_0249267 3300049575 Bacteria 1396
270 Ga0501040_0010955 3300049576 Bacteria 5930
271 Ga0501042_0000189 3300049578 Bacteria 28855
272 Ga0501042_0021945 3300049578 Bacteria 4456
273 Ga0501043_0009717 3300049579 Bacteria 7540
274 Ga0501046_0007188 3300049580 Bacteria 9794
275 Ga0501047_0017387 3300049581 Bacteria 6886
276 Ga0501048_0000611 3300049582 Bacteria 25411
277 Ga0501048_0008025 3300049582 Bacteria 7993
278 Ga0501067_0010132 3300049583 Bacteria 5213
279 Ga0501069_0023302 3300049585 Bacteria 3375
280 Ga0501070_0150382 3300049586 Bacteria 1921
281 Ga0501071_0006771 3300049587 Bacteria 7460
282 Ga0501071_0188820 3300049587 Bacteria 1545
283 Ga0501072_0013272 3300049588 Bacteria 6308
284 Ga0501075_0020571 3300049591 Bacteria 4803
285 Ga0501076_0032441 3300049592 Bacteria 4076
286 Ga0501079_0024925 3300049741 Bacteria 4589
287 Ga0501080_0055471 3300049742 Bacteria 3691
288 Ga0501081_0041080 3300049743 Bacteria 3167
289 Ga0501035_0019082 3300049822 Bacteria 6312
290 Ga0501035_0130195 3300049822 Bacteria 2194
291 Ga0501035_0189511 3300049822 Bacteria 1768
292 Ga0501045_0003098 3300049824 Bacteria 11367
293 Ga0501045_0115196 3300049824 Bacteria 1994
294 nmdc:mga07m45_23255_c1 3300050496 Bacteria 1474
295 nmdc:mga05p37_1192_c1 3300050507 Bacteria 30031
296 nmdc:mga05p37_238_c1 3300050507 Bacteria 56124
297 nmdc:mga05p37_266966_c1 3300050507 Bacteria 2046
298 nmdc:mga09592_222438_c1 3300050508 Bacteria 1635
299 nmdc:mga09592_555_c1 3300050508 Bacteria 28350
300 nmdc:mga09592_9836_c1 3300050508 Bacteria 7775
301 nmdc:mga0qj67_2354_c1 3300050509 Bacteria 13454
302 nmdc:mga0qj67_4038_c1 3300050509 Bacteria 10629
303 nmdc:mga06r32_1106_c1 3300050510 Bacteria 24182
304 nmdc:mga06r32_4598_c1 3300050510 Bacteria 12372
305 nmdc:mga06r32_8462_c1 3300050510 Bacteria 9271
306 nmdc:mga08y16_220873_c1 3300050511 Bacteria 1962
307 nmdc:mga08y16_9945_c1 3300050511 Bacteria 9984
308 nmdc:mga0n895_77322_c1 3300050512 Bacteria 3310
309 Ga0495655_0041950 3300053083 Bacteria 1172
310 Ga0500556_0001233 3300053104 Bacteria 11888
311 Ga0500593_000080 3300053117 Bacteria 35767
312 Ga0500577_0004532 3300053142 Bacteria 3680
313 Ga0501084_0029004 3300054114 Bacteria 4627
314 Ga0501084_0171759 3300054114 Bacteria 1830
315 Ga0590075_032616 3300059424 Bacteria 1322
316 Ga0501082_0035265 3300060353 Bacteria 4312
317 Ga0530510_0382527 3300061734 Bacteria 1059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10056270 Ga0081538_100562703 293
2 iso_pu_bacteria 2775506925 2776374244 295
3 3300050496 nmdc:mga07m45_23255_c1 nmdc:mga07m45_23255_c1_314_1228 304
4 3300013307 Ga0157372_10289022 Ga0157372_102890222 305
5 3300045049 Ga0466959_0020369 Ga0466959_0020369_981_1997 309
6 3300033179 Ga0307507_10023687 Ga0307507_100236873 310
7 3300048903 Ga0496100_0419882 Ga0496100_0419882_33_980 313
8 3300005467 Ga0070706_100157838 Ga0070706_1001578382 314
9 3300005518 Ga0070699_100089759 Ga0070699_1000897591 314
10 3300041494 Ga0451837_0052201 Ga0451837_0052201_189_1133 314
11 3300049824 Ga0501045_0115196 Ga0501045_0115196_465_1466 314
12 3300044765 Ga0466970_0080802 Ga0466970_0080802_681_1691 315
13 3300050508 nmdc:mga09592_222438_c1 nmdc:mga09592_222438_c1_81_1064 317
14 3300050510 nmdc:mga06r32_1106_c1 nmdc:mga06r32_1106_c1_14322_15305 317
15 3300005468 Ga0070707_100022170 Ga0070707_1000221702 318
16 3300005518 Ga0070699_100176197 Ga0070699_1001761972 318
17 3300025986 Ga0207658_10056428 Ga0207658_100564283 318
18 3300030745 Ga0316182_1279110 Ga0316182_12791106 318
19 3300041413 Ga0439465_0042533 Ga0439465_0042533_183_1184 318
20 3300042004 Ga0439445_0020552 Ga0439445_0020552_596_1597 318
21 3300049578 Ga0501042_0021945 Ga0501042_0021945_1005_2009 318
22 3300005468 Ga0070707_100194317 Ga0070707_1001943172 319
23 3300006051 Ga0075364_10064504 Ga0075364_100645041 319
24 3300045976 Ga0466967_0089825 Ga0466967_0089825_1678_2679 319
25 3300009148 Ga0105243_10034182 Ga0105243_100341823 320
26 3300031731 Ga0307405_10101187 Ga0307405_101011872 320
27 3300037418 Ga0395900_0365755 Ga0395900_0365755_317_1318 320
28 3300049568 Ga0501031_0023342 Ga0501031_0023342_2797_3798 320
29 3300049574 Ga0501038_0160420 Ga0501038_0160420_69_1070 320
30 3300049575 Ga0501039_0249267 Ga0501039_0249267_73_1074 320
31 3300049587 Ga0501071_0188820 Ga0501071_0188820_151_1152 320
32 3300054114 Ga0501084_0171759 Ga0501084_0171759_43_1044 320
33 3300050511 nmdc:mga08y16_220873_c1 nmdc:mga08y16_220873_c1_41_1033 321
34 3300005937 Ga0081455_10000856 Ga0081455_1000085629 322
35 3300005937 Ga0081455_10001927 Ga0081455_1000192718 322
36 3300006844 Ga0075428_100010252 Ga0075428_1000102525 322
37 3300006847 Ga0075431_100000515 Ga0075431_1000005158 322
38 3300006847 Ga0075431_100004364 Ga0075431_10000436411 322
39 3300006871 Ga0075434_100236451 Ga0075434_1002364512 322
40 3300006880 Ga0075429_100004768 Ga0075429_10000476811 322
41 3300009094 Ga0111539_10073712 Ga0111539_100737122 322
42 3300009147 Ga0114129_10030468 Ga0114129_100304688 322
43 3300027907 Ga0207428_10035054 Ga0207428_100350542 322
44 3300049568 Ga0501031_0002402 Ga0501031_0002402_4466_5464 322
45 3300049569 Ga0501032_0201762 Ga0501032_0201762_35_1033 322
46 3300049572 Ga0501036_0016526 Ga0501036_0016526_2464_3462 322
47 3300049574 Ga0501038_0007971 Ga0501038_0007971_2461_3459 322
48 3300049575 Ga0501039_0011200 Ga0501039_0011200_1654_2652 322
49 3300049576 Ga0501040_0010955 Ga0501040_0010955_3892_4890 322
50 3300049578 Ga0501042_0000189 Ga0501042_0000189_14729_15727 322
51 3300049580 Ga0501046_0007188 Ga0501046_0007188_77_1075 322
52 3300049582 Ga0501048_0008025 Ga0501048_0008025_2840_3838 322
53 3300049585 Ga0501069_0023302 Ga0501069_0023302_2337_3335 322
54 3300049586 Ga0501070_0150382 Ga0501070_0150382_29_1027 322
55 3300049587 Ga0501071_0006771 Ga0501071_0006771_4395_5393 322
56 3300049588 Ga0501072_0013272 Ga0501072_0013272_861_1859 322
57 3300049591 Ga0501075_0020571 Ga0501075_0020571_2444_3442 322
58 3300049592 Ga0501076_0032441 Ga0501076_0032441_155_1153 322
59 3300049741 Ga0501079_0024925 Ga0501079_0024925_2115_3113 322
60 3300049742 Ga0501080_0055471 Ga0501080_0055471_1745_2743 322
61 3300049824 Ga0501045_0003098 Ga0501045_0003098_3079_4077 322
62 3300050507 nmdc:mga05p37_1192_c1 nmdc:mga05p37_1192_c1_17436_18455 322
63 3300050508 nmdc:mga09592_555_c1 nmdc:mga09592_555_c1_26799_27818 322
64 3300050509 nmdc:mga0qj67_4038_c1 nmdc:mga0qj67_4038_c1_8325_9344 322
65 3300050510 nmdc:mga06r32_8462_c1 nmdc:mga06r32_8462_c1_2902_3921 322
66 3300050511 nmdc:mga08y16_9945_c1 nmdc:mga08y16_9945_c1_2422_3441 322
67 3300050512 nmdc:mga0n895_77322_c1 nmdc:mga0n895_77322_c1_218_1237 322
68 3300054114 Ga0501084_0029004 Ga0501084_0029004_1212_2210 322
69 3300060353 Ga0501082_0035265 Ga0501082_0035265_1953_2951 322
70 3300061734 Ga0530510_0382527 Ga0530510_0382527_14_1012 322
71 3300005327 Ga0070658_10250984 Ga0070658_102509842 323
72 3300005366 Ga0070659_100008607 Ga0070659_1000086076 323
73 3300025909 Ga0207705_10203088 Ga0207705_102030882 323
74 3300025932 Ga0207690_10034998 Ga0207690_100349982 323
75 3300003322 rootL2_10193277 rootL2_101932772 324
76 3300005327 Ga0070658_10049405 Ga0070658_100494054 324
77 3300005339 Ga0070660_100001896 Ga0070660_10000189610 324
78 3300005366 Ga0070659_100014707 Ga0070659_1000147073 324
79 3300005457 Ga0070662_100135213 Ga0070662_1001352132 324
80 3300005564 Ga0070664_100079740 Ga0070664_1000797403 324
81 3300025315 Ga0207697_10039866 Ga0207697_100398662 324
82 3300025904 Ga0207647_10022502 Ga0207647_100225022 324
83 3300025919 Ga0207657_10007437 Ga0207657_1000743710 324
84 3300025932 Ga0207690_10217670 Ga0207690_102176701 324
85 3300025932 Ga0207690_10414403 Ga0207690_104144031 324
86 3300025933 Ga0207706_10038747 Ga0207706_100387473 324
87 3300025945 Ga0207679_10048130 Ga0207679_100481302 324
88 3300026067 Ga0207678_10019141 Ga0207678_100191414 324
89 3300049743 Ga0501081_0041080 Ga0501081_0041080_1469_2482 324
90 3300005329 Ga0070683_100209809 Ga0070683_1002098092 325
91 3300037853 Ga0436364_1485205 Ga0436364_1485205_8595_9605 325
92 3300048917 Ga0496114_0035800 Ga0496114_0035800_1189_2337 325
93 3300031824 Ga0307413_10359620 Ga0307413_103596201 326
94 3300031901 Ga0307406_10050704 Ga0307406_100507042 326
95 3300032004 Ga0307414_10194431 Ga0307414_101944312 326
96 iso_pu_bacteria 2506783011 2506868263 327
97 iso_pu_bacteria 2643221697 2644537034 327
98 iso_pu_bacteria 2739367898 2740166767 327
99 iso_pu_bacteria 2773857933 2774902679 327
100 iso_pu_bacteria 2816332119 2816427466 327
101 3300028794 Ga0307515_10165771 Ga0307515_101657712 328
102 3300044683 Ga0466965_0096120 Ga0466965_0096120_498_1490 328
103 3300044694 Ga0466963_0268412 Ga0466963_0268412_52_1041 328
104 3300046543 Ga0495645_0085901 Ga0495645_0085901_316_1305 328
105 3300047319 Ga0495674_0009769 Ga0495674_0009769_76_1065 328
106 iso_pu_bacteria 2643221615 2644089862 328
107 iso_pu_bacteria 2643221617 2644102530 328
108 iso_pu_bacteria 2643221620 2644118193 328
109 iso_pu_bacteria 2643221657 2644319707 328
110 iso_pu_bacteria 2738541305 2738871306 328
111 iso_pu_bacteria 2738543005 2739203228 328
112 iso_pu_bacteria 2751185734 2753070679 328
113 iso_pu_bacteria 2791354901 2791910610 328
114 iso_pu_bacteria 2811994874 2812333837 328
115 iso_pu_bacteria 2866612099 2866616714 328
116 iso_pu_bacteria 2904765812 2904770145 328
117 iso_pu_bacteria 2904770941 2904771006 328
118 iso_pu_bacteria 2908811453 2908815049 328
119 iso_pu_bacteria 2919420072 2919424467 328
120 iso_pu_bacteria 2919432681 2919436860 328
121 iso_pu_bacteria 2928142448 2928142548 328
122 iso_pu_bacteria 2974315732 2974317191 328
123 iso_pu_bacteria 2984523437 2984525397 328
124 iso_pu_bacteria 2795385472 2795794502 329
125 iso_pu_bacteria 2855386786 2855387584 329
126 iso_pu_bacteria 2891326441 2891327422 329
127 3300005366 Ga0070659_100150307 Ga0070659_1001503072 330
128 3300005367 Ga0070667_100161802 Ga0070667_1001618022 330
129 3300005436 Ga0070713_100010695 Ga0070713_1000106954 330
130 3300005439 Ga0070711_100015568 Ga0070711_1000155683 330
131 3300005456 Ga0070678_100288988 Ga0070678_1002889882 330
132 3300006175 Ga0070712_100045201 Ga0070712_1000452013 330
133 3300006846 Ga0075430_100001901 Ga0075430_10000190110 330
134 3300006847 Ga0075431_100004346 Ga0075431_1000043469 330
135 3300006880 Ga0075429_100001113 Ga0075429_10000111317 330
136 3300009098 Ga0105245_10201533 Ga0105245_102015332 330
137 3300009098 Ga0105245_10541075 Ga0105245_105410752 330
138 3300009147 Ga0114129_10001475 Ga0114129_1000147523 330
139 3300010375 Ga0105239_10181986 Ga0105239_101819862 330
140 3300013307 Ga0157372_10100350 Ga0157372_101003502 330
141 3300013307 Ga0157372_10198930 Ga0157372_101989303 330
142 3300014497 Ga0182008_10059683 Ga0182008_100596832 330
143 3300025915 Ga0207693_10019802 Ga0207693_100198022 330
144 3300025928 Ga0207700_10002007 Ga0207700_100020077 330
145 3300025929 Ga0207664_10036239 Ga0207664_100362393 330
146 3300025932 Ga0207690_10214072 Ga0207690_102140722 330
147 3300025972 Ga0207668_10370765 Ga0207668_103707651 330
148 3300026067 Ga0207678_10094117 Ga0207678_100941173 330
149 3300026075 Ga0207708_10254703 Ga0207708_102547032 330
150 3300026078 Ga0207702_10063678 Ga0207702_100636783 330
151 3300026118 Ga0207675_100351079 Ga0207675_1003510791 330
152 3300031824 Ga0307413_10010784 Ga0307413_100107843 330
153 3300031824 Ga0307413_10393857 Ga0307413_103938571 330
154 3300031901 Ga0307406_10025796 Ga0307406_100257962 330
155 3300031903 Ga0307407_10157376 Ga0307407_101573762 330
156 3300031911 Ga0307412_10202691 Ga0307412_102026911 330
157 3300031995 Ga0307409_100023956 Ga0307409_1000239562 330
158 3300031995 Ga0307409_100096706 Ga0307409_1000967062 330
159 3300032002 Ga0307416_100010101 Ga0307416_1000101017 330
160 3300032002 Ga0307416_100284001 Ga0307416_1002840012 330
161 3300032126 Ga0307415_100124463 Ga0307415_1001244632 330
162 3300037068 Ga0373925_0191681 Ga0373925_0191681_470_1477 330
163 3300037312 Ga0395899_0009287 Ga0395899_0009287_11_1018 330
164 3300037418 Ga0395900_0020407 Ga0395900_0020407_3723_4727 330
165 3300037853 Ga0436364_0813769 Ga0436364_0813769_103_1101 330
166 3300038443 Ga0395901_0093104 Ga0395901_0093104_1568_2572 330
167 3300044683 Ga0466965_0073928 Ga0466965_0073928_625_1629 330
168 3300044684 Ga0466966_0141169 Ga0466966_0141169_321_1325 330
169 3300044693 Ga0466961_0047401 Ga0466961_0047401_570_1574 330
170 3300044693 Ga0466961_0173454 Ga0466961_0173454_181_1197 330
171 3300044712 Ga0453684_0246671 Ga0453684_0246671_1032_2030 330
172 3300044719 Ga0466971_0076382 Ga0466971_0076382_90_1106 330
173 3300044765 Ga0466970_0004725 Ga0466970_0004725_3838_4842 330
174 3300044765 Ga0466970_0046457 Ga0466970_0046457_784_1788 330
175 3300044901 Ga0466960_0011878 Ga0466960_0011878_1203_2204 330
176 3300044901 Ga0466960_0124714 Ga0466960_0124714_226_1227 330
177 3300045049 Ga0466959_0166297 Ga0466959_0166297_509_1513 330
178 3300045976 Ga0466967_0524726 Ga0466967_0524726_129_1133 330
179 3300046453 Ga0495627_036419 Ga0495627_036419_54_1058 330
180 3300046461 Ga0495641_0081996 Ga0495641_0081996_353_1354 330
181 3300046473 Ga0495582_0094968 Ga0495582_0094968_434_1435 330
182 3300046499 Ga0495594_0065951 Ga0495594_0065951_317_1348 330
183 3300046684 Ga0495669_0011515 Ga0495669_0011515_1540_2535 330
184 3300048904 Ga0496101_0092960 Ga0496101_0092960_319_1320 330
185 3300048904 Ga0496101_0149581 Ga0496101_0149581_418_1419 330
186 3300048906 Ga0496103_0061386 Ga0496103_0061386_52_1053 330
187 3300048907 Ga0496104_0110130 Ga0496104_0110130_1161_2165 330
188 3300048907 Ga0496104_0519103 Ga0496104_0519103_21_1022 330
189 3300048908 Ga0496105_0178513 Ga0496105_0178513_662_1663 330
190 3300048909 Ga0496106_0016388 Ga0496106_0016388_3457_4458 330
191 3300048910 Ga0496107_0120429 Ga0496107_0120429_152_1153 330
192 3300048911 Ga0496108_0267161 Ga0496108_0267161_216_1223 330
193 3300048913 Ga0496110_0346039 Ga0496110_0346039_332_1339 330
194 3300048917 Ga0496114_0002789 Ga0496114_0002789_994_1995 330
195 3300049568 Ga0501031_0173006 Ga0501031_0173006_213_1214 330
196 3300049572 Ga0501036_0256582 Ga0501036_0256582_242_1243 330
197 3300049583 Ga0501067_0010132 Ga0501067_0010132_1665_2666 330
198 3300050507 nmdc:mga05p37_238_c1 nmdc:mga05p37_238_c1_48498_49502 330
199 3300050507 nmdc:mga05p37_266966_c1 nmdc:mga05p37_266966_c1_669_1685 330
200 3300050508 nmdc:mga09592_9836_c1 nmdc:mga09592_9836_c1_538_1542 330
201 3300050509 nmdc:mga0qj67_2354_c1 nmdc:mga0qj67_2354_c1_6540_7544 330
202 3300050510 nmdc:mga06r32_4598_c1 nmdc:mga06r32_4598_c1_5457_6461 330
203 3300053083 Ga0495655_0041950 Ga0495655_0041950_117_1121 330
204 3300053104 Ga0500556_0001233 Ga0500556_0001233_4263_5264 330
205 3300053117 Ga0500593_000080 Ga0500593_000080_30448_31449 330
206 3300059424 Ga0590075_032616 Ga0590075_032616_56_1057 330
207 iso_pu_bacteria 2558860280 2559429543 330
208 iso_pu_bacteria 2643221576 2643893175 330
209 iso_pu_bacteria 2643221590 2643961766 330
210 iso_pu_bacteria 2643221604 2644034096 330
211 iso_pu_bacteria 2870721527 2870726762 330
212 iso_pu_bacteria 2899359706 2899365413 330
213 iso_pu_bacteria 8047710418 8047715556 330
214 3300003203 JGI25406J46586_10000620 JGI25406J46586_100006202 331
215 3300005327 Ga0070658_10072124 Ga0070658_100721243 331
216 3300005329 Ga0070683_100145492 Ga0070683_1001454922 331
217 3300005334 Ga0068869_100101622 Ga0068869_1001016223 331
218 3300005338 Ga0068868_100140586 Ga0068868_1001405861 331
219 3300005340 Ga0070689_100177262 Ga0070689_1001772622 331
220 3300005343 Ga0070687_100077387 Ga0070687_1000773871 331
221 3300005347 Ga0070668_100001456 Ga0070668_10000145614 331
222 3300005353 Ga0070669_100079047 Ga0070669_1000790473 331
223 3300005365 Ga0070688_100065099 Ga0070688_1000650993 331
224 3300005435 Ga0070714_100100708 Ga0070714_1001007081 331
225 3300005437 Ga0070710_10000170 Ga0070710_1000017013 331
226 3300005441 Ga0070700_100000088 Ga0070700_10000008854 331
227 3300005455 Ga0070663_100017834 Ga0070663_1000178342 331
228 3300005456 Ga0070678_100133936 Ga0070678_1001339362 331
229 3300005457 Ga0070662_100442955 Ga0070662_1004429551 331
230 3300005466 Ga0070685_10004093 Ga0070685_100040935 331
231 3300005539 Ga0068853_100004749 Ga0068853_1000047492 331
232 3300005546 Ga0070696_100149358 Ga0070696_1001493582 331
233 3300005563 Ga0068855_100270231 Ga0068855_1002702312 331
234 3300005564 Ga0070664_100114851 Ga0070664_1001148512 331
235 3300005578 Ga0068854_100038832 Ga0068854_1000388324 331
236 3300005614 Ga0068856_100037301 Ga0068856_1000373014 331
237 3300005616 Ga0068852_100014744 Ga0068852_1000147442 331
238 3300005617 Ga0068859_100491450 Ga0068859_1004914501 331
239 3300005719 Ga0068861_100084863 Ga0068861_1000848633 331
240 3300005842 Ga0068858_100311735 Ga0068858_1003117352 331
241 3300005844 Ga0068862_100089267 Ga0068862_1000892672 331
242 3300005937 Ga0081455_10000011 Ga0081455_10000011211 331
243 3300005985 Ga0081539_10001153 Ga0081539_1000115331 331
244 3300006028 Ga0070717_10183480 Ga0070717_101834802 331
245 3300006881 Ga0068865_100294996 Ga0068865_1002949962 331
246 3300006931 Ga0097620_100491456 Ga0097620_1004914561 331
247 3300009094 Ga0111539_10370988 Ga0111539_103709882 331
248 3300009101 Ga0105247_10101903 Ga0105247_101019032 331
249 3300009148 Ga0105243_10199170 Ga0105243_101991702 331
250 3300009551 Ga0105238_10081134 Ga0105238_100811342 331
251 3300009551 Ga0105238_10158322 Ga0105238_101583222 331
252 3300009553 Ga0105249_10306661 Ga0105249_103066612 331
253 3300013306 Ga0163162_10028541 Ga0163162_100285414 331
254 3300013308 Ga0157375_10145182 Ga0157375_101451822 331
255 3300014326 Ga0157380_10066382 Ga0157380_100663822 331
256 3300014968 Ga0157379_10175690 Ga0157379_101756902 331
257 3300014969 Ga0157376_10058494 Ga0157376_100584942 331
258 3300021388 Ga0213875_10001713 Ga0213875_1000171314 331
259 3300021388 Ga0213875_10107669 Ga0213875_101076691 331
260 3300025898 Ga0207692_10000293 Ga0207692_100002932 331
261 3300025898 Ga0207692_10198752 Ga0207692_101987521 331
262 3300025900 Ga0207710_10052843 Ga0207710_100528431 331
263 3300025901 Ga0207688_10021330 Ga0207688_100213303 331
264 3300025907 Ga0207645_10072569 Ga0207645_100725692 331
265 3300025916 Ga0207663_10238847 Ga0207663_102388472 331
266 3300025918 Ga0207662_10186658 Ga0207662_101866582 331
267 3300025923 Ga0207681_10077139 Ga0207681_100771393 331
268 3300025924 Ga0207694_10110760 Ga0207694_101107602 331
269 3300025926 Ga0207659_10321127 Ga0207659_103211271 331
270 3300025929 Ga0207664_10043105 Ga0207664_100431051 331
271 3300025933 Ga0207706_10288761 Ga0207706_102887612 331
272 3300025942 Ga0207689_10046572 Ga0207689_100465723 331
273 3300025945 Ga0207679_10175549 Ga0207679_101755492 331
274 3300025972 Ga0207668_10002772 Ga0207668_100027728 331
275 3300026041 Ga0207639_10119185 Ga0207639_101191852 331
276 3300026067 Ga0207678_10013082 Ga0207678_100130825 331
277 3300026075 Ga0207708_10000110 Ga0207708_1000011024 331
278 3300026075 Ga0207708_10240708 Ga0207708_102407082 331
279 3300026116 Ga0207674_10032850 Ga0207674_100328502 331
280 3300026118 Ga0207675_100129089 Ga0207675_1001290892 331
281 3300026142 Ga0207698_10067955 Ga0207698_100679552 331
282 3300028381 Ga0268264_10107943 Ga0268264_101079432 331
283 3300028381 Ga0268264_10581040 Ga0268264_105810401 331
284 3300028794 Ga0307515_10142433 Ga0307515_101424332 331
285 3300030521 Ga0307511_10001109 Ga0307511_1000110923 331
286 3300030521 Ga0307511_10086168 Ga0307511_100861683 331
287 3300030522 Ga0307512_10025285 Ga0307512_100252853 331
288 3300030731 Ga0316177_1074566 Ga0316177_10745664 331
289 3300030732 Ga0316176_1175502 Ga0316176_11755023 331
290 3300031456 Ga0307513_10067115 Ga0307513_100671154 331
291 3300031456 Ga0307513_10298833 Ga0307513_102988331 331
292 3300031824 Ga0307413_10000562 Ga0307413_100005624 331
293 3300031838 Ga0307518_10002521 Ga0307518_1000252110 331
294 3300032005 Ga0307411_10033572 Ga0307411_100335725 331
295 3300035119 Ga0373956_0000612 Ga0373956_0000612_3002_4066 331
296 3300037853 Ga0436364_0473109 Ga0436364_0473109_11805_12815 331
297 3300037853 Ga0436364_0674710 Ga0436364_0674710_277_1275 331
298 3300042007 Ga0439449_0007924 Ga0439449_0007924_939_1943 331
299 3300044656 Ga0466969_0008629 Ga0466969_0008629_3191_4201 331
300 3300044656 Ga0466969_0044020 Ga0466969_0044020_662_1672 331
301 3300044658 Ga0466972_0002149 Ga0466972_0002149_2405_3415 331
302 3300044658 Ga0466972_0008011 Ga0466972_0008011_1380_2396 331
303 3300044683 Ga0466965_0000195 Ga0466965_0000195_9866_10876 331
304 3300044683 Ga0466965_0003086 Ga0466965_0003086_6064_7074 331
305 3300044684 Ga0466966_0013861 Ga0466966_0013861_2436_3446 331
306 3300044694 Ga0466963_0001665 Ga0466963_0001665_94_1095 331
307 3300044735 Ga0466968_0002161 Ga0466968_0002161_4611_5621 331
308 3300044735 Ga0466968_0008849 Ga0466968_0008849_2839_3849 331
309 3300044765 Ga0466970_0025412 Ga0466970_0025412_744_1754 331
310 3300044901 Ga0466960_0004045 Ga0466960_0004045_1662_2672 331
311 3300044901 Ga0466960_0051380 Ga0466960_0051380_291_1295 331
312 3300044901 Ga0466960_0132670 Ga0466960_0132670_251_1267 331
313 3300045049 Ga0466959_0002480 Ga0466959_0002480_8109_9119 331
314 3300045976 Ga0466967_0003549 Ga0466967_0003549_7964_8998 331
315 3300045976 Ga0466967_0093188 Ga0466967_0093188_1701_2714 331
316 3300046455 Ga0495603_0061275 Ga0495603_0061275_675_1673 331
317 3300048905 Ga0496102_0026632 Ga0496102_0026632_844_1839 331
318 3300048906 Ga0496103_0112864 Ga0496103_0112864_177_1172 331
319 3300048915 Ga0496112_0231072 Ga0496112_0231072_507_1535 331
320 3300048916 Ga0496113_0074440 Ga0496113_0074440_1343_2398 331
321 3300053142 Ga0500577_0004532 Ga0500577_0004532_1267_2274 331
322 iso_pu_bacteria 2582580736 2583150356 331
323 iso_pu_bacteria 2585427649 2586059084 331
324 iso_pu_bacteria 2808606522 2809592157 331
325 iso_pu_bacteria 2863067949 2863070974 331
326 iso_pu_bacteria 2866552031 2866552732 331
327 iso_pu_bacteria 2899370129 2899375254 331
328 iso_pu_bacteria 2915768154 2915773172 331
329 iso_pu_bacteria 2917736166 2917743392 331
330 iso_pu_bacteria 8003314358 8003316286 331
331 iso_pu_bacteria 8056207758 8056211929 331
332 3300002067 JGI24735J21928_10026783 JGI24735J21928_100267832 332
333 3300005455 Ga0070663_100345005 Ga0070663_1003450051 332
334 3300005563 Ga0068855_100160947 Ga0068855_1001609472 332
335 3300005937 Ga0081455_10004893 Ga0081455_100048934 332
336 3300020082 Ga0206353_10765213 Ga0206353_107652135 332
337 3300026067 Ga0207678_10388370 Ga0207678_103883702 332
338 3300026078 Ga0207702_10042603 Ga0207702_100426032 332
339 3300044658 Ga0466972_0022374 Ga0466972_0022374_1170_2171 332
340 3300044684 Ga0466966_0014395 Ga0466966_0014395_2463_3464 332
341 3300044693 Ga0466961_0086551 Ga0466961_0086551_766_1767 332
342 3300044694 Ga0466963_0134965 Ga0466963_0134965_373_1374 332
343 3300044694 Ga0466963_0149617 Ga0466963_0149617_392_1393 332
344 3300044719 Ga0466971_0088615 Ga0466971_0088615_59_1060 332
345 3300044842 Ga0466957_0070316 Ga0466957_0070316_1113_2114 332
346 3300045836 Ga0466958_0018859 Ga0466958_0018859_2920_3921 332
347 3300045976 Ga0466967_0054528 Ga0466967_0054528_1300_2313 332
348 3300045976 Ga0466967_0146760 Ga0466967_0146760_140_1141 332
349 3300048906 Ga0496103_0193554 Ga0496103_0193554_56_1057 332
350 3300048917 Ga0496114_0050480 Ga0496114_0050480_66_1067 332
351 3300048922 Ga0496119_0000061 Ga0496119_0000061_75235_76266 332
352 3300048923 Ga0496120_0004587 Ga0496120_0004587_2951_3982 332
353 3300049568 Ga0501031_0006622 Ga0501031_0006622_5087_6085 332
354 3300049570 Ga0501033_0140462 Ga0501033_0140462_649_1647 332
355 3300049574 Ga0501038_0003732 Ga0501038_0003732_8975_9973 332
356 3300049579 Ga0501043_0009717 Ga0501043_0009717_5821_6819 332
357 3300049581 Ga0501047_0017387 Ga0501047_0017387_2505_3503 332
358 3300049582 Ga0501048_0000611 Ga0501048_0000611_23246_24244 332
359 3300049822 Ga0501035_0019082 Ga0501035_0019082_508_1506 332
360 3300049822 Ga0501035_0130195 Ga0501035_0130195_447_1445 332
361 3300049822 Ga0501035_0189511 Ga0501035_0189511_33_1031 332

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01210

NAD_Gly3P_dh_N

NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

22

180

0.98

PF07479

NAD_Gly3P_dh_C

NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus

199

341

0.98

PF20618

GPD_NAD_C_bact

Bacterial GPD, NAD-dependent C-terminal

259

326

0.88

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

23

173

0.76

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

22

126

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 1.007 2 29
7fgp-assembly1.cif.gz_A crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9955 1 28
7fgp-assembly1.cif.gz_B crystal structure of aureimonas altamirenisis flavin-containing opine dehydrogenase (fad-bound form) 0.9948 1 28
3if9-assembly2.cif.gz_D-3 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9942 3 29
3if9-assembly1.cif.gz_B-2 crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate 0.9871 3 29
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 1.007 2 29 3.50.50.60
af_P9WN77_2_187_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9981 2 180 3.40.50.720
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9893 3 31 3.50.50.60
af_P9WN77_188_331_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.982 184 328 1.10.1040.10
af_P9WNY9_4_366_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9752 3 28 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2S9FGE7-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9974 7 258 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-X8FB33-F1-model_v4 deleted 0.9971 8 187
AF-A0A1A0PI43-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9966 9 302 GO:0005829
GO:0005975
GO:0006650
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-M3FUW4-F1-model_v4 Glycerol-3-phosphate dehydrogenase (EC 1.1.1.94) 0.9958 77 260 GO:0005829
GO:0005975
GO:0008654
GO:0046168
GO:0047952
GO:0051287
AF-A0A6G3X0G2-F1-model_v4 NAD(P)-binding domain-containing protein 0.995 25 196 GO:0005829
GO:0046168
GO:0047952
GO:0051287

Feature Viewer

pLDDT pTM Quality
93.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map