F420085

General Info

Members Datasets Scaffolds Average Seq Length
355 275 710 136

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100488302|Ga0075434_1004883023
Length 150
Sequence LTSVLVDSNVILDVVSENPQWGEWSSSMLARCAESGMLIINPIIYAEVSVGFERIEELDEVLPADSFRRDILPWEAAFLAGKCFLAYRRKGGSRRSPLPDFYIGAHAAVAGLPLLTRDARRYRTYFPHLILLAPEDDETEPALPGPTENA

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
156 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
244 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
245 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
246 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
247 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
253 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
254 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
258 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
259 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
262 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
266 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
267 2643221607 Rhizobium sp. Root73 Isolate Unclassified
268 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
269 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
270 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
271 2791355199
272 2851182111 Bosea sp. Tri-44 Isolate Nodule
273 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
274 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
275 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 0
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.14
Nodule 1.41
Rhizoplane 0.85
Rhizosphere 82.82
Stem 0
Stem Tuber 0
Unclassified 6.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100488302 3300006871 Bacteria 1252
2 JGI24745J21846_1047325 3300002073 Unclassified 541
3 JGI25153J46596_10047201 3300003215 Bacteria 1269
4 rootH2_10001155 3300003320 Bacteria 10658
5 rootH1_10308769 3300003323 Bacteria 1539
6 JGI25404J52841_10006104 3300003659 Bacteria 2508
7 JGI25404J52841_10010572 3300003659 Bacteria 1983
8 Ga0055526_1031944 3300003771 Bacteria 1496
9 Ga0065707_11001916 3300005295 Unclassified 539
10 Ga0070658_10341658 3300005327 Bacteria 1280
11 Ga0070676_10244578 3300005328 Bacteria 1195
12 Ga0070680_100130948 3300005336 Bacteria 2099
13 Ga0070682_100049803 3300005337 Bacteria 2613
14 Ga0070682_100092790 3300005337 Bacteria 1978
15 Ga0070660_100556164 3300005339 Bacteria 957
16 Ga0070668_100274250 3300005347 Bacteria 1407
17 Ga0070659_100470334 3300005366 Unclassified 1068
18 Ga0070709_10000444 3300005434 Bacteria 25000
19 Ga0070709_10016630 3300005434 Bacteria 4203
20 Ga0070714_101158790 3300005435 Bacteria 754
21 Ga0070713_100573611 3300005436 Bacteria 1070
22 Ga0070713_102235094 3300005436 Unclassified 530
23 Ga0070710_10099907 3300005437 Unclassified 1726
24 Ga0070711_100009008 3300005439 Bacteria 6127
25 Ga0070711_100875584 3300005439 Unclassified 765
26 Ga0070700_100359045 3300005441 Bacteria 1083
27 Ga0070708_100817050 3300005445 Bacteria 876
28 Ga0070663_100735506 3300005455 Bacteria 841
29 Ga0070662_100344663 3300005457 Bacteria 1219
30 Ga0070662_100354786 3300005457 Unclassified 1202
31 Ga0070681_10008020 3300005458 Bacteria 10339
32 Ga0070681_10807998 3300005458 Unclassified 855
33 Ga0070699_100420265 3300005518 Bacteria 1210
34 Ga0070679_100020797 3300005530 Bacteria 6401
35 Ga0070679_101142821 3300005530 Bacteria 724
36 Ga0068853_100053740 3300005539 Bacteria 3469
37 Ga0068853_100173546 3300005539 Bacteria 1952
38 Ga0068853_100208321 3300005539 Bacteria 1781
39 Ga0070686_101120035 3300005544 Bacteria 651
40 Ga0070693_100872275 3300005547 Unclassified 672
41 Ga0068855_100156934 3300005563 Bacteria 2585
42 Ga0068855_100308048 3300005563 Bacteria 1753
43 Ga0068855_100673132 3300005563 Bacteria 1109
44 Ga0070664_100256528 3300005564 Bacteria 1573
45 Ga0068854_100134161 3300005578 Bacteria 1894
46 Ga0068854_100338455 3300005578 Bacteria 1228
47 Ga0068854_101981317 3300005578 Unclassified 536
48 Ga0068856_101126683 3300005614 Bacteria 802
49 Ga0068852_100160712 3300005616 Bacteria 2097
50 Ga0068866_10225163 3300005718 Bacteria 1134
51 Ga0068861_100278020 3300005719 Bacteria 1440
52 Ga0081455_10014193 3300005937 Bacteria 7822
53 Ga0081455_10052103 3300005937 Bacteria 3506
54 Ga0081540_1003859 3300005983 Bacteria 11699
55 Ga0081540_1007036 3300005983 Bacteria 8089
56 Ga0070717_10028468 3300006028 Bacteria 4474
57 Ga0070717_10708584 3300006028 Bacteria 915
58 Ga0075365_10056634 3300006038 Bacteria 2606
59 Ga0070716_100406043 3300006173 Bacteria 981
60 Ga0070712_100058137 3300006175 Bacteria 2720
61 Ga0070712_100426719 3300006175 Bacteria 1100
62 Ga0075362_10129480 3300006177 Bacteria 1199
63 Ga0075367_10431368 3300006178 Bacteria 835
64 Ga0075367_10656297 3300006178 Bacteria 667
65 Ga0075369_10218644 3300006186 Bacteria 881
66 Ga0097621_100191111 3300006237 Bacteria 1773
67 Ga0097621_100409187 3300006237 Bacteria 1216
68 Ga0068871_100677973 3300006358 Bacteria 943
69 Ga0068871_101357493 3300006358 Unclassified 669
70 Ga0075428_100050174 3300006844 Bacteria 4577
71 Ga0075430_100877106 3300006846 Bacteria 739
72 Ga0075431_101534872 3300006847 Unclassified 624
73 Ga0075434_100210227 3300006871 Bacteria 1966
74 Ga0105240_10075643 3300009093 Bacteria 4153
75 Ga0105240_10164407 3300009093 Bacteria 2633
76 Ga0105241_10015022 3300009174 Bacteria 5671
77 Ga0105242_10385471 3300009176 Bacteria 1304
78 Ga0105237_10311918 3300009545 Bacteria 1576
79 Ga0105237_10911999 3300009545 Bacteria 886
80 Ga0105238_10094842 3300009551 Bacteria 2971
81 Ga0105238_10375842 3300009551 Bacteria 1412
82 Ga0105249_10214033 3300009553 Bacteria 1893
83 Ga0105249_10262789 3300009553 Bacteria 1716
84 Ga0105249_10690297 3300009553 Bacteria 1080
85 Ga0105239_10671544 3300010375 Bacteria 1184
86 Ga0157373_10190184 3300013100 Bacteria 1446
87 Ga0157373_10327294 3300013100 Bacteria 1091
88 Ga0157371_10207187 3300013102 Bacteria 1407
89 Ga0157370_10014040 3300013104 Bacteria 8221
90 Ga0157370_10058043 3300013104 Bacteria 3678
91 Ga0157370_11291199 3300013104 Unclassified 658
92 Ga0157369_10071048 3300013105 Bacteria 3738
93 Ga0157369_10599534 3300013105 Bacteria 1137
94 Ga0163162_10097431 3300013306 Bacteria 3029
95 Ga0163162_10171578 3300013306 Bacteria 2294
96 Ga0157372_10117505 3300013307 Bacteria 3050
97 Ga0157372_10360123 3300013307 Bacteria 1695
98 Ga0157372_10800482 3300013307 Unclassified 1095
99 Ga0157372_10977112 3300013307 Bacteria 981
100 Ga0157375_10519572 3300013308 Bacteria 1354
101 Ga0157380_10167677 3300014326 Bacteria 1915
102 Ga0209025_1000509 3300025294 Bacteria 74336
103 Ga0209758_1004752 3300025297 Bacteria 11023
104 Ga0207655_1032125 3300025728 Bacteria 2404
105 Ga0207692_10009991 3300025898 Bacteria 3981
106 Ga0207642_10246447 3300025899 Bacteria 1012
107 Ga0207688_10121179 3300025901 Bacteria 1526
108 Ga0207699_10000303 3300025906 Bacteria 26473
109 Ga0207699_10353116 3300025906 Unclassified 1038
110 Ga0207645_10460677 3300025907 Bacteria 859
111 Ga0207684_10382316 3300025910 Bacteria 1211
112 Ga0207654_10026805 3300025911 Bacteria 3125
113 Ga0207707_10004831 3300025912 Bacteria 11819
114 Ga0207695_10181885 3300025913 Bacteria 2023
115 Ga0207695_10221113 3300025913 Bacteria 1801
116 Ga0207671_10244408 3300025914 Bacteria 1410
117 Ga0207693_10045299 3300025915 Bacteria 3456
118 Ga0207693_10333449 3300025915 Bacteria 1188
119 Ga0207663_10045417 3300025916 Bacteria 2702
120 Ga0207660_10186751 3300025917 Bacteria 1612
121 Ga0207657_10968979 3300025919 Bacteria 653
122 Ga0207652_10003656 3300025921 Bacteria 12658
123 Ga0207652_11316288 3300025921 Unclassified 625
124 Ga0207694_10046238 3300025924 Bacteria 3364
125 Ga0207694_11000934 3300025924 Unclassified 707
126 Ga0207690_10553885 3300025932 Bacteria 935
127 Ga0207706_10445166 3300025933 Bacteria 1121
128 Ga0207686_10763997 3300025934 Bacteria 772
129 Ga0207669_10204788 3300025937 Bacteria 1435
130 Ga0207667_10103201 3300025949 Bacteria 2941
131 Ga0207667_10107120 3300025949 Bacteria 2883
132 Ga0207668_10114823 3300025972 Bacteria 2027
133 Ga0207640_10042938 3300025981 Bacteria 2886
134 Ga0207640_10310469 3300025981 Bacteria 1251
135 Ga0207639_10184819 3300026041 Bacteria 1776
136 Ga0207678_10348737 3300026067 Bacteria 1276
137 Ga0207678_10601673 3300026067 Bacteria 964
138 Ga0207708_11392056 3300026075 Unclassified 615
139 Ga0207648_10045279 3300026089 Bacteria 3859
140 Ga0207674_10086356 3300026116 Bacteria 3132
141 Ga0207675_100025618 3300026118 Bacteria 5489
142 Ga0209996_1024449 3300027395 Unclassified 861
143 Ga0209984_1020586 3300027424 Unclassified 902
144 Ga0209179_1040077 3300027512 Bacteria 984
145 Ga0209968_1020656 3300027526 Unclassified 1065
146 Ga0209971_1033671 3300027682 Bacteria 1231
147 Ga0209974_10004832 3300027876 Bacteria 4775
148 Ga0268266_10095697 3300028379 Bacteria 2608
149 Ga0268266_10834660 3300028379 Bacteria 890
150 Ga0265337_1106295 3300028556 Bacteria 763
151 Ga0265326_10025352 3300028558 Bacteria 1691
152 Ga0265319_1007801 3300028563 Bacteria 4763
153 Ga0265334_10001591 3300028573 Bacteria 10913
154 Ga0265318_10000788 3300028577 Bacteria 21011
155 Ga0265322_10013456 3300028654 Bacteria 2369
156 Ga0265336_10015791 3300028666 Bacteria 2477
157 Ga0307517_10000942 3300028786 Bacteria 49547
158 Ga0307515_10281254 3300028794 Bacteria 1371
159 Ga0265338_10010025 3300028800 Bacteria 11196
160 Ga0265324_10047361 3300029957 Bacteria 1479
161 Ga0265330_10002447 3300031235 Bacteria 10111
162 Ga0265330_10018194 3300031235 Bacteria 3230
163 Ga0265332_10002277 3300031238 Bacteria 9822
164 Ga0265332_10036445 3300031238 Bacteria 2135
165 Ga0265328_10004250 3300031239 Bacteria 6232
166 Ga0265328_10195242 3300031239 Bacteria 768
167 Ga0265320_10002634 3300031240 Bacteria 12458
168 Ga0265325_10007773 3300031241 Bacteria 6388
169 Ga0265325_10023248 3300031241 Bacteria 3387
170 Ga0265325_10093147 3300031241 Bacteria 1483
171 Ga0265329_10003625 3300031242 Bacteria 6668
172 Ga0265340_10013618 3300031247 Bacteria 4269
173 Ga0265339_10006094 3300031249 Bacteria 7957
174 Ga0265331_10007782 3300031250 Bacteria 6152
175 Ga0265316_10028261 3300031344 Bacteria 4628
176 Ga0265316_10117102 3300031344 Bacteria 2014
177 Ga0265313_10012624 3300031595 Bacteria 5139
178 Ga0307508_10037804 3300031616 Bacteria 4340
179 Ga0265314_10006327 3300031711 Bacteria 10502
180 Ga0265342_10009588 3300031712 Bacteria 6800
181 Ga0307516_10074083 3300031730 Bacteria 3261
182 Ga0307406_10318779 3300031901 Bacteria 1202
183 Ga0307412_10021663 3300031911 Bacteria 3929
184 Ga0307409_100268083 3300031995 Bacteria 1571
185 Ga0373934_0009450 3300035086 Bacteria 3654
186 Ga0373936_0067921 3300035113 Bacteria 1465
187 Ga0373936_0251010 3300035113 Bacteria 790
188 Ga0373953_0029268 3300035117 Bacteria 2129
189 Ga0373943_0033680 3300035170 Bacteria 2442
190 Ga0373955_0020091 3300035172 Bacteria 3352
191 Ga0373924_0008298 3300035410 Bacteria 3769
192 Ga0373927_0058826 3300035695 Bacteria 2486
193 Ga0373927_0068215 3300035695 Bacteria 2301
194 Ga0373927_0116596 3300035695 Bacteria 1741
195 Ga0373933_0107506 3300035724 Bacteria 1737
196 Ga0373947_0032296 3300035725 Bacteria 3084
197 Ga0373937_0179266 3300036401 Bacteria 1989
198 Ga0373925_0548820 3300037068 Bacteria 950
199 Ga0395899_0130678 3300037312 Bacteria 1793
200 Ga0395900_0281122 3300037418 Bacteria 1656
201 Ga0395898_0484214 3300037466 Bacteria 1177
202 Ga0395901_0631813 3300038443 Bacteria 1076
203 Ga0237819_02875 3300038705 Bacteria 3260
204 Ga0436365_0953642 3300039437 Bacteria 2400
205 Ga0439436_0078363 3300041404 Bacteria 920
206 Ga0439438_069852 3300041405 Bacteria 870
207 Ga0451853_1380956 3300041512 Bacteria 905
208 Ga0439457_143368 3300042014 Bacteria 572
209 Ga0450920_042956 3300042122 Bacteria 903
210 Ga0451577_0606287 3300042876 Bacteria 993
211 Ga0466969_0038182 3300044656 Bacteria 2418
212 Ga0453684_0100475 3300044712 Bacteria 3540
213 Ga0453684_0189687 3300044712 Bacteria 2405
214 Ga0466970_0200197 3300044765 Bacteria 1111
215 Ga0466959_0006033 3300045049 Bacteria 8365
216 Ga0466959_0375124 3300045049 Bacteria 968
217 Ga0451576_0708363 3300045051 Bacteria 1058
218 Ga0466967_0353629 3300045976 Bacteria 1422
219 Ga0495592_0034188 3300046454 Bacteria 3833
220 Ga0495603_0250871 3300046455 Bacteria 1019
221 Ga0495629_0193409 3300046459 Bacteria 1408
222 Ga0495651_0104411 3300046462 Bacteria 2104
223 Ga0495650_0278159 3300046471 Unclassified 564
224 Ga0495580_0017556 3300046472 Bacteria 5348
225 Ga0495605_0332008 3300046474 Bacteria 640
226 Ga0495639_0008876 3300046475 Bacteria 4309
227 Ga0495662_0016503 3300046476 Bacteria 3576
228 Ga0495664_0012763 3300046477 Bacteria 4759
229 Ga0495585_0503405 3300046492 Bacteria 575
230 Ga0495618_0159214 3300046514 Bacteria 1440
231 Ga0495620_0140291 3300046515 Bacteria 945
232 Ga0495628_0264973 3300046516 Bacteria 1279
233 Ga0495630_0047873 3300046517 Bacteria 3199
234 Ga0495631_0227340 3300046518 Bacteria 796
235 Ga0495652_0055814 3300046529 Bacteria 3358
236 Ga0495665_0309037 3300046531 Bacteria 808
237 Ga0495645_0200573 3300046543 Bacteria 1354
238 Ga0495633_0024314 3300046558 Bacteria 2994
239 Ga0495633_0059630 3300046558 Bacteria 1789
240 Ga0495668_0128027 3300046616 Bacteria 1390
241 Ga0495634_0104673 3300046642 Bacteria 1825
242 Ga0495658_0018825 3300046683 Bacteria 3596
243 Ga0495670_0159106 3300046691 Bacteria 1186
244 Ga0495670_0163585 3300046691 Bacteria 1170
245 Ga0495671_0099104 3300046692 Bacteria 1425
246 Ga0495649_0388096 3300046694 Bacteria 702
247 Ga0495660_0342400 3300046810 Bacteria 666
248 Ga0495674_0038084 3300047319 Bacteria 4318
249 Ga0495672_0158211 3300047320 Bacteria 1168
250 Ga0495672_0215771 3300047320 Bacteria 950
251 Ga0495680_0116619 3300047322 Bacteria 1974
252 Ga0495677_0123934 3300047445 Bacteria 987
253 Ga0495681_0175335 3300047470 Bacteria 884
254 Ga0495684_0058732 3300047471 Bacteria 2929
255 Ga0495684_0114583 3300047471 Bacteria 2032
256 Ga0495593_0118037 3300047673 Bacteria 1351
257 Ga0496104_1867146 3300048907 Bacteria 503
258 Ga0496109_1101201 3300048912 Bacteria 731
259 Ga0496112_0000020 3300048915 Bacteria 169373
260 Ga0496117_0103818 3300048920 Bacteria 1790
261 Ga0496118_0101227 3300048921 Bacteria 1946
262 Ga0496125_0197969 3300048928 Bacteria 1319
263 Ga0501031_0001159 3300049568 Bacteria 16026
264 Ga0501032_0000303 3300049569 Bacteria 41504
265 Ga0501032_0096612 3300049569 Bacteria 1958
266 Ga0501033_0005996 3300049570 Bacteria 9535
267 Ga0501033_0133072 3300049570 Bacteria 1800
268 Ga0501034_0000250 3300049571 Bacteria 99407
269 Ga0501034_0001087 3300049571 Bacteria 38372
270 Ga0501034_1138425 3300049571 Unclassified 660
271 Ga0501036_0000098 3300049572 Bacteria 54252
272 Ga0501036_0186424 3300049572 Bacteria 1746
273 Ga0501037_0000092 3300049573 Bacteria 83924
274 Ga0501038_0000059 3300049574 Bacteria 92319
275 Ga0501038_0692384 3300049574 Bacteria 764
276 Ga0501039_0000085 3300049575 Bacteria 70306
277 Ga0501042_0257536 3300049578 Bacteria 1259
278 Ga0501043_0000460 3300049579 Bacteria 36273
279 Ga0501043_0288154 3300049579 Bacteria 1257
280 Ga0501046_0004986 3300049580 Bacteria 11918
281 Ga0501046_0302755 3300049580 Unclassified 1167
282 Ga0501047_0000022 3300049581 Bacteria 249062
283 Ga0501047_0289705 3300049581 Bacteria 1481
284 Ga0501048_0000292 3300049582 Bacteria 34134
285 Ga0501048_0234956 3300049582 Bacteria 1301
286 Ga0501048_0316273 3300049582 Bacteria 1112
287 Ga0501067_0004320 3300049583 Bacteria 7829
288 Ga0501068_0003934 3300049584 Bacteria 8081
289 Ga0501068_0563339 3300049584 Bacteria 741
290 Ga0501069_0016192 3300049585 Bacteria 4000
291 Ga0501070_0006879 3300049586 Bacteria 9675
292 Ga0501070_0310697 3300049586 Bacteria 1283
293 Ga0501071_0016365 3300049587 Bacteria 5098
294 Ga0501072_0061199 3300049588 Bacteria 2968
295 Ga0501072_0327244 3300049588 Bacteria 1218
296 Ga0501073_0000109 3300049589 Bacteria 53094
297 Ga0501074_0001489 3300049590 Bacteria 15769
298 Ga0501077_0148903 3300049593 Bacteria 1485
299 Ga0501079_0010309 3300049741 Bacteria 7099
300 Ga0501080_0010390 3300049742 Bacteria 8517
301 Ga0501083_0000618 3300049744 Bacteria 22913
302 Ga0501083_0011649 3300049744 Bacteria 6170
303 Ga0501035_0001471 3300049822 Bacteria 24145
304 Ga0501035_0090111 3300049822 Bacteria 2700
305 Ga0501044_0000072 3300049823 Bacteria 124143
306 Ga0501044_0606444 3300049823 Bacteria 987
307 Ga0501045_0257237 3300049824 Bacteria 1299
308 nmdc:mga0yw44_93450_c1 3300050492 Bacteria 1905
309 nmdc:mga06z11_92798_c1 3300050494 Bacteria 1642
310 nmdc:mga0qj67_793364_c1 3300050509 Bacteria 750
311 nmdc:mga0n895_13840_c1 3300050512 Bacteria 7301
312 nmdc:mga0n895_157445_c1 3300050512 Bacteria 2302
313 nmdc:mga0n895_69689_c1 3300050512 Bacteria 3485
314 nmdc:mga0rr50_444458_c1 3300050513 Bacteria 1099
315 nmdc:mga08x19_2117_c1 3300050514 Bacteria 12134
316 nmdc:mga0a205_425862_c1 3300050515 Bacteria 1189
317 nmdc:mga0sz30_106863_c1 3300050516 Bacteria 1225
318 nmdc:mga0sz30_22887_c1 3300050516 Bacteria 2538
319 Ga0495601_0021346 3300053077 Bacteria 3965
320 Ga0500578_0067855 3300053086 Bacteria 2274
321 Ga0500651_0012088 3300053093 Bacteria 5221
322 Ga0500566_0000524 3300053094 Bacteria 21491
323 Ga0500640_009923 3300053095 Bacteria 3828
324 Ga0500572_005723 3300053111 Bacteria 2826
325 Ga0500591_113889 3300053115 Bacteria 1127
326 Ga0500595_008385 3300053119 Bacteria 4223
327 Ga0500608_251894 3300053122 Bacteria 688
328 Ga0500614_160139 3300053123 Bacteria 681
329 Ga0500642_0024958 3300053130 Bacteria 2422
330 Ga0500559_0196601 3300053136 Bacteria 950
331 Ga0500577_0065697 3300053142 Bacteria 1409
332 Ga0500590_053128 3300053148 Bacteria 2055
333 Ga0500603_154220 3300053150 Bacteria 713
334 Ga0500604_0031903 3300053151 Bacteria 1550
335 Ga0500622_0019731 3300053156 Bacteria 3579
336 Ga0500622_0048202 3300053156 Bacteria 2199
337 Ga0500630_021370 3300053159 Bacteria 3198
338 Ga0500638_089889 3300053162 Bacteria 1447
339 Ga0500639_026363 3300053163 Bacteria 3071
340 Ga0500645_058062 3300053730 Bacteria 1121
341 Ga0500596_000683 3300053735 Bacteria 6598
342 Ga0500601_013466 3300053737 Bacteria 926
343 Ga0501084_0060690 3300054114 Bacteria 3165
344 Ga0501082_0002455 3300060353 Bacteria 16279
345 Ga0530510_0017506 3300061734 Bacteria 5079
346 2513695127 2513237101 Bacteria 7952346
347 2644051222 2643221607 Bacteria 6314006
348 2644200893 2643221636 Bacteria 6583769
349 2644484126 2643221686 Bacteria 6310811
350 2644497923 2643221689 Bacteria 6042950
351 2793081060
352 2851182783 2851182111 Bacteria 6047226
353 2874608049 2874604998 Bacteria 7834745
354 2922363985 2922361189 Bacteria 7436256
355 2922392581 2922386360 Bacteria 7017218
356 Ga0075434_100488302
357 JGI24745J21846_1047325
358 JGI25153J46596_10047201
359 rootH2_10001155
360 rootH1_10308769
361 JGI25404J52841_10006104
362 JGI25404J52841_10010572
363 Ga0055526_1031944
364 Ga0065707_11001916
365 Ga0070658_10341658
366 Ga0070676_10244578
367 Ga0070680_100130948
368 Ga0070682_100049803
369 Ga0070682_100092790
370 Ga0070660_100556164
371 Ga0070668_100274250
372 Ga0070659_100470334
373 Ga0070709_10000444
374 Ga0070709_10016630
375 Ga0070714_101158790
376 Ga0070713_100573611
377 Ga0070713_102235094
378 Ga0070710_10099907
379 Ga0070711_100009008
380 Ga0070711_100875584
381 Ga0070700_100359045
382 Ga0070708_100817050
383 Ga0070663_100735506
384 Ga0070662_100344663
385 Ga0070662_100354786
386 Ga0070681_10008020
387 Ga0070681_10807998
388 Ga0070699_100420265
389 Ga0070679_100020797
390 Ga0070679_101142821
391 Ga0068853_100053740
392 Ga0068853_100173546
393 Ga0068853_100208321
394 Ga0070686_101120035
395 Ga0070693_100872275
396 Ga0068855_100156934
397 Ga0068855_100308048
398 Ga0068855_100673132
399 Ga0070664_100256528
400 Ga0068854_100134161
401 Ga0068854_100338455
402 Ga0068854_101981317
403 Ga0068856_101126683
404 Ga0068852_100160712
405 Ga0068866_10225163
406 Ga0068861_100278020
407 Ga0081455_10014193
408 Ga0081455_10052103
409 Ga0081540_1003859
410 Ga0081540_1007036
411 Ga0070717_10028468
412 Ga0070717_10708584
413 Ga0075365_10056634
414 Ga0070716_100406043
415 Ga0070712_100058137
416 Ga0070712_100426719
417 Ga0075362_10129480
418 Ga0075367_10431368
419 Ga0075367_10656297
420 Ga0075369_10218644
421 Ga0097621_100191111
422 Ga0097621_100409187
423 Ga0068871_100677973
424 Ga0068871_101357493
425 Ga0075428_100050174
426 Ga0075430_100877106
427 Ga0075431_101534872
428 Ga0075434_100210227
429 Ga0105240_10075643
430 Ga0105240_10164407
431 Ga0105241_10015022
432 Ga0105242_10385471
433 Ga0105237_10311918
434 Ga0105237_10911999
435 Ga0105238_10094842
436 Ga0105238_10375842
437 Ga0105249_10214033
438 Ga0105249_10262789
439 Ga0105249_10690297
440 Ga0105239_10671544
441 Ga0157373_10190184
442 Ga0157373_10327294
443 Ga0157371_10207187
444 Ga0157370_10014040
445 Ga0157370_10058043
446 Ga0157370_11291199
447 Ga0157369_10071048
448 Ga0157369_10599534
449 Ga0163162_10097431
450 Ga0163162_10171578
451 Ga0157372_10117505
452 Ga0157372_10360123
453 Ga0157372_10800482
454 Ga0157372_10977112
455 Ga0157375_10519572
456 Ga0157380_10167677
457 Ga0209025_1000509
458 Ga0209758_1004752
459 Ga0207655_1032125
460 Ga0207692_10009991
461 Ga0207642_10246447
462 Ga0207688_10121179
463 Ga0207699_10000303
464 Ga0207699_10353116
465 Ga0207645_10460677
466 Ga0207684_10382316
467 Ga0207654_10026805
468 Ga0207707_10004831
469 Ga0207695_10181885
470 Ga0207695_10221113
471 Ga0207671_10244408
472 Ga0207693_10045299
473 Ga0207693_10333449
474 Ga0207663_10045417
475 Ga0207660_10186751
476 Ga0207657_10968979
477 Ga0207652_10003656
478 Ga0207652_11316288
479 Ga0207694_10046238
480 Ga0207694_11000934
481 Ga0207690_10553885
482 Ga0207706_10445166
483 Ga0207686_10763997
484 Ga0207669_10204788
485 Ga0207667_10103201
486 Ga0207667_10107120
487 Ga0207668_10114823
488 Ga0207640_10042938
489 Ga0207640_10310469
490 Ga0207639_10184819
491 Ga0207678_10348737
492 Ga0207678_10601673
493 Ga0207708_11392056
494 Ga0207648_10045279
495 Ga0207674_10086356
496 Ga0207675_100025618
497 Ga0209996_1024449
498 Ga0209984_1020586
499 Ga0209179_1040077
500 Ga0209968_1020656
501 Ga0209971_1033671
502 Ga0209974_10004832
503 Ga0268266_10095697
504 Ga0268266_10834660
505 Ga0265337_1106295
506 Ga0265326_10025352
507 Ga0265319_1007801
508 Ga0265334_10001591
509 Ga0265318_10000788
510 Ga0265322_10013456
511 Ga0265336_10015791
512 Ga0307517_10000942
513 Ga0307515_10281254
514 Ga0265338_10010025
515 Ga0265324_10047361
516 Ga0265330_10002447
517 Ga0265330_10018194
518 Ga0265332_10002277
519 Ga0265332_10036445
520 Ga0265328_10004250
521 Ga0265328_10195242
522 Ga0265320_10002634
523 Ga0265325_10007773
524 Ga0265325_10023248
525 Ga0265325_10093147
526 Ga0265329_10003625
527 Ga0265340_10013618
528 Ga0265339_10006094
529 Ga0265331_10007782
530 Ga0265316_10028261
531 Ga0265316_10117102
532 Ga0265313_10012624
533 Ga0307508_10037804
534 Ga0265314_10006327
535 Ga0265342_10009588
536 Ga0307516_10074083
537 Ga0307406_10318779
538 Ga0307412_10021663
539 Ga0307409_100268083
540 Ga0373934_0009450
541 Ga0373936_0067921
542 Ga0373936_0251010
543 Ga0373953_0029268
544 Ga0373943_0033680
545 Ga0373955_0020091
546 Ga0373924_0008298
547 Ga0373927_0058826
548 Ga0373927_0068215
549 Ga0373927_0116596
550 Ga0373933_0107506
551 Ga0373947_0032296
552 Ga0373937_0179266
553 Ga0373925_0548820
554 Ga0395899_0130678
555 Ga0395900_0281122
556 Ga0395898_0484214
557 Ga0395901_0631813
558 Ga0237819_02875
559 Ga0436365_0953642
560 Ga0439436_0078363
561 Ga0439438_069852
562 Ga0451853_1380956
563 Ga0439457_143368
564 Ga0450920_042956
565 Ga0451577_0606287
566 Ga0466969_0038182
567 Ga0453684_0100475
568 Ga0453684_0189687
569 Ga0466970_0200197
570 Ga0466959_0006033
571 Ga0466959_0375124
572 Ga0451576_0708363
573 Ga0466967_0353629
574 Ga0495592_0034188
575 Ga0495603_0250871
576 Ga0495629_0193409
577 Ga0495651_0104411
578 Ga0495650_0278159
579 Ga0495580_0017556
580 Ga0495605_0332008
581 Ga0495639_0008876
582 Ga0495662_0016503
583 Ga0495664_0012763
584 Ga0495585_0503405
585 Ga0495618_0159214
586 Ga0495620_0140291
587 Ga0495628_0264973
588 Ga0495630_0047873
589 Ga0495631_0227340
590 Ga0495652_0055814
591 Ga0495665_0309037
592 Ga0495645_0200573
593 Ga0495633_0024314
594 Ga0495633_0059630
595 Ga0495668_0128027
596 Ga0495634_0104673
597 Ga0495658_0018825
598 Ga0495670_0159106
599 Ga0495670_0163585
600 Ga0495671_0099104
601 Ga0495649_0388096
602 Ga0495660_0342400
603 Ga0495674_0038084
604 Ga0495672_0158211
605 Ga0495672_0215771
606 Ga0495680_0116619
607 Ga0495677_0123934
608 Ga0495681_0175335
609 Ga0495684_0058732
610 Ga0495684_0114583
611 Ga0495593_0118037
612 Ga0496104_1867146
613 Ga0496109_1101201
614 Ga0496112_0000020
615 Ga0496117_0103818
616 Ga0496118_0101227
617 Ga0496125_0197969
618 Ga0501031_0001159
619 Ga0501032_0000303
620 Ga0501032_0096612
621 Ga0501033_0005996
622 Ga0501033_0133072
623 Ga0501034_0000250
624 Ga0501034_0001087
625 Ga0501034_1138425
626 Ga0501036_0000098
627 Ga0501036_0186424
628 Ga0501037_0000092
629 Ga0501038_0000059
630 Ga0501038_0692384
631 Ga0501039_0000085
632 Ga0501042_0257536
633 Ga0501043_0000460
634 Ga0501043_0288154
635 Ga0501046_0004986
636 Ga0501046_0302755
637 Ga0501047_0000022
638 Ga0501047_0289705
639 Ga0501048_0000292
640 Ga0501048_0234956
641 Ga0501048_0316273
642 Ga0501067_0004320
643 Ga0501068_0003934
644 Ga0501068_0563339
645 Ga0501069_0016192
646 Ga0501070_0006879
647 Ga0501070_0310697
648 Ga0501071_0016365
649 Ga0501072_0061199
650 Ga0501072_0327244
651 Ga0501073_0000109
652 Ga0501074_0001489
653 Ga0501077_0148903
654 Ga0501079_0010309
655 Ga0501080_0010390
656 Ga0501083_0000618
657 Ga0501083_0011649
658 Ga0501035_0001471
659 Ga0501035_0090111
660 Ga0501044_0000072
661 Ga0501044_0606444
662 Ga0501045_0257237
663 nmdc:mga0yw44_93450_c1
664 nmdc:mga06z11_92798_c1
665 nmdc:mga0qj67_793364_c1
666 nmdc:mga0n895_13840_c1
667 nmdc:mga0n895_157445_c1
668 nmdc:mga0n895_69689_c1
669 nmdc:mga0rr50_444458_c1
670 nmdc:mga08x19_2117_c1
671 nmdc:mga0a205_425862_c1
672 nmdc:mga0sz30_106863_c1
673 nmdc:mga0sz30_22887_c1
674 Ga0495601_0021346
675 Ga0500578_0067855
676 Ga0500651_0012088
677 Ga0500566_0000524
678 Ga0500640_009923
679 Ga0500572_005723
680 Ga0500591_113889
681 Ga0500595_008385
682 Ga0500608_251894
683 Ga0500614_160139
684 Ga0500642_0024958
685 Ga0500559_0196601
686 Ga0500577_0065697
687 Ga0500590_053128
688 Ga0500603_154220
689 Ga0500604_0031903
690 Ga0500622_0019731
691 Ga0500622_0048202
692 Ga0500630_021370
693 Ga0500638_089889
694 Ga0500639_026363
695 Ga0500645_058062
696 Ga0500596_000683
697 Ga0500601_013466
698 Ga0501084_0060690
699 Ga0501082_0002455
700 Ga0530510_0017506
701 2513695127
702 2644051222
703 2644200893
704 2644484126
705 2644497923
706 2793081060
707 2851182783
708 2874608049
709 2922363985
710 2922392581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

127

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7572 2 131
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.7571 1 131
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.7501 2 118
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7476 2 133
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.7473 2 131
ID Description Score Start End Superfamily
af_P9WF65_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7959 2 117 3.40.50.1010
af_P9WF57_1_130_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7949 2 116 3.40.50.1010
af_Q58521_1_93_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7716 2 103 3.40.50.1010
af_Q58324_5_136_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7714 2 130 3.40.50.1010
af_P9WF69_2_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.768 3 122 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1Q3YZ66-F1-model_v4 DNA-binding protein 0.988 1 132 GO:0003677
GO:0004518
GO:0046872
AF-A0A4D8QWP9-F1-model_v4 PIN domain-containing protein 0.9865 2 132 GO:0004518
GO:0046872
AF-A0A1G4S2G1-F1-model_v4 PIN domain-containing protein 0.986 2 133 GO:0004518
GO:0046872
AF-A0A420CLA6-F1-model_v4 PIN domain-containing protein 0.9823 1 114 GO:0004518
GO:0046872
AF-A0A1Q3YZ66-F1-model_v4 DNA-binding protein 0.9806 1 132 GO:0003677
GO:0004518
GO:0046872

Map