F419140

General Info

Members Datasets Scaffolds Average Seq Length
352 238 328 166

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0127017|Ga0495640_0127017_320_922
Length 200
Sequence MTRAAWGAIVPLLDAVAAPLSNTQRALSRIRGIPMSHVTLKGSPVNVEGSFPAVGGQAPDFTLVGKDLADAALSGFTGKRKVLNIFPSVDTPTCAMSVRHFNASASQFDNTVVICISADLPFAQARFCGAEGLDNVVMLSTMRGRAFLDDYGVAIADGPLAGVAARAVVVLDESNRVLHAELVGEIAHEPDYKAALAALA

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
4 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
5 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
6 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
7 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
8 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
9 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
10 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
11 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
12 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
13 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
14 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
15 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
16 2932406140 Serratia sp. 2723 Isolate Rhizosphere
17 2939577877 Serratia sp. 509 Isolate Rhizosphere
18 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
19 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
20 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
21 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
22 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
25 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
30 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
34 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
35 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
36 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
37 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
156 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
157 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
158 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
161 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
162 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
173 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
187 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
188 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
236 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
237 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
238 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 1.14
Isolates 6.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.25
Nodule 0.28
Rhizoplane 1.7
Rhizosphere 80.4
Stem 0
Stem Tuber 0.28
Unclassified 11.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002699 3300001979 Bacteria 7967
2 JGI24739J22299_10000803 3300001989 Bacteria 11484
3 JGI24737J22298_10001352 3300001990 Bacteria 8687
4 JGI24735J21928_10020202 3300002067 Bacteria 2042
5 JGI24735J21928_10036332 3300002067 Bacteria 1445
6 JGI25156J39149_1000637 3300002705 Bacteria 19232
7 JGI25162J39368_1001075 3300002737 Bacteria 16659
8 JGI25154J39366_1003890 3300002738 Bacteria 2901
9 JGI25157J39369_1000425 3300002741 Bacteria 27809
10 JGI25157J39369_1000501 3300002741 Bacteria 24125
11 JGI25164J39214_1000024 3300002772 Bacteria 165608
12 JGI25165J46597_1000394 3300003214 Bacteria 46232
13 JGI25165J46597_1000446 3300003214 Bacteria 41610
14 JGI25153J46596_10008670 3300003215 Bacteria 4831
15 rootL2_10007329 3300003322 Bacteria 15912
16 Ga0006562J51391_1058394 3300003578 Bacteria 3210
17 Ga0006562J51391_1058395 3300003578 Bacteria 8080
18 Ga0055527_1002581 3300003760 Bacteria 2992
19 Ga0055535_1000576 3300003761 Bacteria 30846
20 Ga0055542_1000598 3300003762 Bacteria 30854
21 Ga0055529_1000387 3300003763 Bacteria 47628
22 Ga0058692_1059688 3300003856 Bacteria 605
23 Ga0070682_100344439 3300005337 Bacteria 1109
24 Ga0070661_100041135 3300005344 Bacteria 3372
25 Ga0070692_10250588 3300005345 Bacteria 1060
26 Ga0070659_100071132 3300005366 Bacteria 2765
27 Ga0070714_100007413 3300005435 Bacteria 8536
28 Ga0070714_100029432 3300005435 Bacteria 4566
29 Ga0070713_100020822 3300005436 Bacteria 5035
30 Ga0070681_10011625 3300005458 Bacteria 8716
31 Ga0070681_10044794 3300005458 Bacteria 4429
32 Ga0070679_100045299 3300005530 Bacteria 4383
33 Ga0070679_100055400 3300005530 Bacteria 3948
34 Ga0070684_100929622 3300005535 Bacteria 815
35 Ga0068853_100127325 3300005539 Bacteria 2276
36 Ga0070696_100005938 3300005546 Bacteria 8154
37 Ga0070696_100007255 3300005546 Bacteria 7400
38 Ga0070696_101287086 3300005546 Bacteria 620
39 Ga0070693_100035269 3300005547 Bacteria 2773
40 Ga0070693_100043499 3300005547 Bacteria 2536
41 Ga0070693_100428810 3300005547 Bacteria 923
42 Ga0068855_100199160 3300005563 Bacteria 2255
43 Ga0068855_101298042 3300005563 Bacteria 753
44 Ga0068857_100004160 3300005577 Bacteria 12190
45 Ga0068857_100050147 3300005577 Bacteria 3703
46 Ga0068857_100411228 3300005577 Bacteria 1260
47 Ga0068854_100000218 3300005578 Bacteria 38701
48 Ga0068854_100010073 3300005578 Bacteria 6121
49 Ga0068856_100147017 3300005614 Bacteria 2364
50 Ga0068856_100821852 3300005614 Bacteria 949
51 Ga0068852_100004500 3300005616 Bacteria 9858
52 Ga0068859_102109833 3300005617 Bacteria 622
53 Ga0068851_10001830 3300005834 Bacteria 9315
54 Ga0068858_100106637 3300005842 Bacteria 2615
55 Ga0070712_100460210 3300006175 Bacteria 1061
56 Ga0097620_102110632 3300006931 Bacteria 622
57 Ga0105240_10007845 3300009093 Bacteria 15407
58 Ga0105240_10012345 3300009093 Bacteria 11795
59 Ga0105241_10136697 3300009174 Bacteria 1991
60 Ga0105237_10000436 3300009545 Bacteria 59400
61 Ga0105237_10818030 3300009545 Bacteria 938
62 Ga0105237_11483014 3300009545 Bacteria 685
63 Ga0105237_11573283 3300009545 Bacteria 664
64 Ga0105249_10567417 3300009553 Bacteria 1187
65 Ga0105239_10006753 3300010375 Bacteria 13252
66 Ga0157373_10034389 3300013100 Bacteria 3640
67 Ga0157373_10117691 3300013100 Bacteria 1868
68 Ga0157373_10372922 3300013100 Bacteria 1020
69 Ga0157373_10473325 3300013100 Bacteria 903
70 Ga0157373_10487423 3300013100 Bacteria 890
71 Ga0157373_10621841 3300013100 Bacteria 787
72 Ga0157371_10038324 3300013102 Bacteria 3430
73 Ga0157371_10096878 3300013102 Bacteria 2091
74 Ga0157371_11023991 3300013102 Bacteria 631
75 Ga0157370_10000514 3300013104 Bacteria 48336
76 Ga0157370_10630292 3300013104 Bacteria 981
77 Ga0157370_11236089 3300013104 Bacteria 674
78 Ga0157369_10067284 3300013105 Bacteria 3852
79 Ga0157369_10254767 3300013105 Bacteria 1831
80 Ga0157369_10604782 3300013105 Bacteria 1131
81 Ga0157372_10099609 3300013307 Bacteria 3315
82 Ga0182008_10046533 3300014497 Bacteria 2156
83 Ga0182008_10192548 3300014497 Bacteria 1035
84 Ga0182008_10332075 3300014497 Bacteria 802
85 Ga0157376_10107030 3300014969 Bacteria 2454
86 Ga0182006_1013080 3300015261 Bacteria 3613
87 Ga0182006_1063470 3300015261 Bacteria 1387
88 Ga0182007_10016232 3300015262 Bacteria 2753
89 Ga0182007_10044997 3300015262 Bacteria 1463
90 Ga0182007_10053509 3300015262 Bacteria 1329
91 Ga0183369_1003 3300015685 Bacteria 726443
92 Ga0206353_11948309 3300020082 Bacteria 1035
93 Ga0213872_10002452 3300021361 Bacteria 10890
94 Ga0213872_10002573 3300021361 Bacteria 10573
95 Ga0209674_103721 3300025226 Bacteria 2708
96 Ga0209672_100332 3300025228 Bacteria 30604
97 Ga0207427_100058 3300025231 Bacteria 192979
98 Ga0209437_100142 3300025233 Bacteria 165628
99 Ga0209258_100307 3300025242 Bacteria 77305
100 Ga0209258_112676 3300025242 Bacteria 1026
101 Ga0209646_1002888 3300025246 Bacteria 3584
102 Ga0209026_1000114 3300025250 Bacteria 136985
103 Ga0209026_1000346 3300025250 Bacteria 44154
104 Ga0209148_1000062 3300025254 Bacteria 347704
105 Ga0209759_1000602 3300025256 Bacteria 34775
106 Ga0209759_1012829 3300025256 Bacteria 2300
107 Ga0209129_1000721 3300025258 Bacteria 21330
108 Ga0209233_1000141 3300025261 Bacteria 192978
109 Ga0209455_1000040 3300025272 Bacteria 430197
110 Ga0209758_1002501 3300025297 Bacteria 18665
111 Ga0209758_1044140 3300025297 Bacteria 1634
112 Ga0207656_10003096 3300025321 Bacteria 5693
113 Ga0207647_10036983 3300025904 Bacteria 3099
114 Ga0207647_10054793 3300025904 Bacteria 2453
115 Ga0207699_10756666 3300025906 Bacteria 713
116 Ga0207705_10067718 3300025909 Bacteria 2584
117 Ga0207654_10076702 3300025911 Bacteria 2001
118 Ga0207707_10005525 3300025912 Bacteria 11053
119 Ga0207707_10367382 3300025912 Bacteria 1238
120 Ga0207695_10002464 3300025913 Bacteria 27322
121 Ga0207695_10014229 3300025913 Bacteria 9437
122 Ga0207671_10000422 3300025914 Bacteria 58677
123 Ga0207671_11226466 3300025914 Bacteria 586
124 Ga0207693_10384877 3300025915 Bacteria 1097
125 Ga0207660_10109411 3300025917 Bacteria 2077
126 Ga0207652_10229185 3300025921 Bacteria 1674
127 Ga0207694_10213052 3300025924 Bacteria 1574
128 Ga0207700_10006738 3300025928 Bacteria 6976
129 Ga0207664_10000792 3300025929 Bacteria 21377
130 Ga0207664_10008842 3300025929 Bacteria 7045
131 Ga0207690_10009433 3300025932 Bacteria 5796
132 Ga0207679_10717350 3300025945 Bacteria 908
133 Ga0207667_10000752 3300025949 Bacteria 42064
134 Ga0207667_10002209 3300025949 Bacteria 24429
135 Ga0207667_10125098 3300025949 Bacteria 2648
136 Ga0207667_10207014 3300025949 Bacteria 2011
137 Ga0207712_10695216 3300025961 Bacteria 887
138 Ga0207640_10000275 3300025981 Bacteria 34681
139 Ga0207640_10000512 3300025981 Bacteria 23383
140 Ga0207703_10095983 3300026035 Bacteria 2502
141 Ga0207702_10533051 3300026078 Bacteria 1147
142 Ga0207702_10594602 3300026078 Bacteria 1085
143 Ga0207674_10001200 3300026116 Bacteria 33740
144 Ga0207674_10038923 3300026116 Bacteria 4932
145 Ga0207674_10529099 3300026116 Bacteria 1139
146 Ga0207698_10577798 3300026142 Bacteria 1105
147 Ga0207698_10841246 3300026142 Bacteria 922
148 Ga0209973_1018570 3300027252 Bacteria 903
149 Ga0209371_1001897 3300027312 Bacteria 12805
150 Ga0209995_1004935 3300027471 Bacteria 2139
151 Ga0209982_1011684 3300027552 Bacteria 1313
152 Ga0209970_1044328 3300027614 Bacteria 796
153 Ga0209983_1032916 3300027665 Bacteria 1108
154 Ga0209282_1000076 3300027666 Bacteria 77289
155 Ga0209971_1000265 3300027682 Bacteria 14800
156 Ga0209974_10016862 3300027876 Bacteria 2424
157 Ga0265324_10040743 3300029957 Bacteria 1608
158 Ga0268256_1001912 3300030500 Bacteria 11466
159 Ga0265328_10105036 3300031239 Bacteria 1048
160 Ga0265331_10002830 3300031250 Bacteria 11505
161 Ga0265331_10166309 3300031250 Bacteria 999
162 Ga0265327_10000557 3300031251 Bacteria 63857
163 Ga0265327_10042078 3300031251 Bacteria 2455
164 Ga0265316_10010545 3300031344 Bacteria 8413
165 Ga0265316_10224196 3300031344 Bacteria 1386
166 Ga0307509_10002881 3300031507 Bacteria 27220
167 Ga0307508_10385217 3300031616 Bacteria 993
168 Ga0316576_10064098 3300031727 Bacteria 2699
169 Ga0316578_10075472 3300031728 Bacteria 2000
170 Ga0307416_102348089 3300032002 Bacteria 633
171 Ga0316593_10103091 3300032168 Bacteria 1014
172 Ga0373928_0095630 3300035084 Bacteria 768
173 Ga0373936_0047289 3300035113 Bacteria 1735
174 Ga0316574_0001272 3300035398 Bacteria 11776
175 Ga0373927_0606485 3300035695 Bacteria 724
176 Ga0373933_0594244 3300035724 Bacteria 727
177 Ga0373937_1259453 3300036401 Bacteria 688
178 Ga0316582_0071376 3300036647 Bacteria 2249
179 Ga0395900_1322576 3300037418 Bacteria 634
180 Ga0395898_0000023 3300037466 Bacteria 379477
181 Ga0395898_1653090 3300037466 Bacteria 564
182 Ga0395901_0002962 3300038443 Bacteria 17127
183 Ga0395901_0471954 3300038443 Bacteria 1281
184 Ga0395901_0887451 3300038443 Bacteria 874
185 Ga0436361_0149279 3300039447 Bacteria 16333
186 Ga0439436_0011746 3300041404 Bacteria 2658
187 Ga0439436_0035640 3300041404 Bacteria 1437
188 Ga0439438_007905 3300041405 Bacteria 3586
189 Ga0439438_012009 3300041405 Bacteria 2673
190 Ga0439447_001173 3300041407 Bacteria 9553
191 Ga0439447_017384 3300041407 Bacteria 1958
192 Ga0439466_0005626 3300041411 Bacteria 4780
193 Ga0451807_0546891 3300041486 Bacteria 1475
194 Ga0439437_000297 3300042000 Bacteria 4632
195 Ga0439437_001152 3300042000 Bacteria 2765
196 Ga0439448_0112853 3300042005 Bacteria 929
197 Ga0439432_018356 3300042006 Bacteria 2338
198 Ga0439452_003306 3300042010 Bacteria 5683
199 Ga0439455_0013243 3300042012 Bacteria 1865
200 Ga0439456_019964 3300042013 Bacteria 1411
201 Ga0450911_000004 3300042115 Bacteria 234537
202 Ga0450923_049702 3300042125 Bacteria 898
203 Ga0450900_033399 3300042136 Bacteria 754
204 Ga0450904_000093 3300042139 Bacteria 20207
205 Ga0439446_0001949 3300042156 Bacteria 4867
206 Ga0439446_0002306 3300042156 Bacteria 4562
207 Ga0439434_0011053 3300042435 Bacteria 2667
208 Ga0439459_0008460 3300042438 Bacteria 1759
209 Ga0439464_0222443 3300042439 Bacteria 606
210 Ga0450893_0103222 3300042532 Bacteria 583
211 Ga0451577_0000137 3300042876 Bacteria 163955
212 Ga0451577_0000408 3300042876 Bacteria 77937
213 Ga0451577_0060551 3300042876 Bacteria 3375
214 Ga0451577_0377551 3300042876 Bacteria 1286
215 Ga0466988_0199618 3300044536 Bacteria 1140
216 Ga0466969_0023220 3300044656 Bacteria 3196
217 Ga0466969_0036327 3300044656 Bacteria 2489
218 Ga0466982_0000007 3300044672 Bacteria 250854
219 Ga0453683_0154395 3300044673 Bacteria 1451
220 Ga0453683_0373259 3300044673 Bacteria 918
221 Ga0466965_0067297 3300044683 Bacteria 1797
222 Ga0466966_0004718 3300044684 Bacteria 8966
223 Ga0466966_0105531 3300044684 Bacteria 1739
224 Ga0466961_0036028 3300044693 Bacteria 3176
225 Ga0466961_0062734 3300044693 Bacteria 2361
226 Ga0466963_0194685 3300044694 Bacteria 1417
227 Ga0453684_0000014 3300044712 Bacteria 993311
228 Ga0453684_0000348 3300044712 Bacteria 192530
229 Ga0453684_0005696 3300044712 Bacteria 24404
230 Ga0453684_1876545 3300044712 Bacteria 607
231 Ga0466971_0031838 3300044719 Bacteria 2362
232 Ga0466971_0034444 3300044719 Bacteria 2269
233 Ga0466970_0006875 3300044765 Bacteria 5697
234 Ga0466957_0531105 3300044842 Bacteria 818
235 Ga0466960_0007960 3300044901 Bacteria 4327
236 Ga0466959_0030994 3300045049 Bacteria 3958
237 Ga0451576_0000169 3300045051 Bacteria 164329
238 Ga0451576_0009818 3300045051 Bacteria 11061
239 Ga0451576_0117766 3300045051 Bacteria 2765
240 Ga0451576_0153992 3300045051 Bacteria 2397
241 Ga0451576_0795954 3300045051 Bacteria 993
242 Ga0451576_1442871 3300045051 Bacteria 716
243 Ga0466958_0015059 3300045836 Bacteria 4425
244 Ga0466967_0079229 3300045976 Bacteria 2961
245 Ga0495638_0000106 3300046460 Bacteria 133921
246 Ga0495605_0012367 3300046474 Bacteria 4737
247 Ga0495596_0002185 3300046500 Bacteria 10665
248 Ga0495607_0003409 3300046501 Bacteria 12183
249 Ga0495606_0000553 3300046507 Bacteria 59889
250 Ga0495610_0001929 3300046512 Bacteria 17873
251 Ga0495616_0006298 3300046513 Bacteria 7200
252 Ga0495643_0000017 3300046522 Bacteria 313381
253 Ga0495654_0148424 3300046530 Bacteria 1039
254 Ga0495640_0127017 3300046533 Bacteria 1653
255 Ga0495609_0001984 3300046538 Bacteria 12941
256 Ga0495597_0068360 3300046542 Bacteria 1535
257 Ga0495656_0254324 3300046615 Bacteria 888
258 Ga0495625_0407650 3300046660 Bacteria 848
259 Ga0495661_0019065 3300046665 Bacteria 4500
260 Ga0495671_0001178 3300046692 Bacteria 17906
261 Ga0495671_0001473 3300046692 Bacteria 15786
262 Ga0495671_0275486 3300046692 Bacteria 811
263 Ga0495649_0000033 3300046694 Bacteria 136854
264 Ga0495649_0006448 3300046694 Bacteria 7305
265 Ga0495649_0276124 3300046694 Bacteria 859
266 Ga0495685_033601 3300047447 Bacteria 1762
267 Ga0496101_0345835 3300048904 Bacteria 1168
268 Ga0496104_0680251 3300048907 Bacteria 937
269 Ga0496106_0309329 3300048909 Bacteria 1268
270 Ga0496109_0421489 3300048912 Bacteria 1261
271 Ga0496109_0445809 3300048912 Bacteria 1223
272 Ga0496118_0320555 3300048921 Bacteria 841
273 Ga0496119_0010208 3300048922 Bacteria 7925
274 Ga0496120_0002007 3300048923 Bacteria 22138
275 Ga0496121_0004837 3300048924 Bacteria 17723
276 Ga0496122_0009510 3300048925 Bacteria 10225
277 Ga0496123_0003430 3300048926 Bacteria 17799
278 Ga0496125_0000766 3300048928 Bacteria 52572
279 Ga0496126_0268856 3300048929 Bacteria 1415
280 Ga0501031_0133121 3300049568 Bacteria 1624
281 Ga0501031_0173133 3300049568 Bacteria 1410
282 Ga0501031_0251906 3300049568 Bacteria 1148
283 Ga0501031_0874089 3300049568 Bacteria 576
284 Ga0501032_0032035 3300049569 Bacteria 3603
285 Ga0501032_0684327 3300049569 Bacteria 650
286 Ga0501033_0145675 3300049570 Bacteria 1710
287 Ga0501034_0000334 3300049571 Bacteria 82414
288 Ga0501034_0034571 3300049571 Bacteria 5124
289 Ga0501034_0058236 3300049571 Bacteria 3883
290 Ga0501034_0357781 3300049571 Bacteria 1387
291 Ga0501037_0031161 3300049573 Bacteria 3938
292 Ga0501037_0137387 3300049573 Bacteria 1750
293 Ga0501037_0422404 3300049573 Bacteria 912
294 Ga0501038_0148420 3300049574 Bacteria 1913
295 Ga0501038_0173366 3300049574 Bacteria 1744
296 Ga0501038_0536096 3300049574 Bacteria 892
297 Ga0501039_0148215 3300049575 Bacteria 1844
298 Ga0501042_0184946 3300049578 Bacteria 1503
299 Ga0501043_0062645 3300049579 Bacteria 2920
300 Ga0501043_0226372 3300049579 Bacteria 1445
301 Ga0501043_0254929 3300049579 Bacteria 1351
302 Ga0501046_0058638 3300049580 Bacteria 3017
303 Ga0501046_0077382 3300049580 Bacteria 2575
304 Ga0501047_0067661 3300049581 Bacteria 3441
305 Ga0501047_0144705 3300049581 Bacteria 2254
306 Ga0501047_0521511 3300049581 Bacteria 1014
307 Ga0501047_0578118 3300049581 Bacteria 946
308 Ga0501047_1091302 3300049581 Bacteria 611
309 Ga0501048_0036958 3300049582 Bacteria 3508
310 Ga0501048_0059342 3300049582 Bacteria 2711
311 Ga0501070_0090314 3300049586 Bacteria 2535
312 Ga0501070_0208346 3300049586 Bacteria 1605
313 Ga0501073_0227796 3300049589 Bacteria 1287
314 Ga0501080_0029689 3300049742 Bacteria 5089
315 Ga0501080_0292650 3300049742 Bacteria 1478
316 Ga0501035_0114035 3300049822 Bacteria 2367
317 Ga0501035_0427104 3300049822 Bacteria 1099
318 Ga0501035_0533842 3300049822 Bacteria 962
319 Ga0501044_0117271 3300049823 Bacteria 2666
320 Ga0501044_0178089 3300049823 Bacteria 2094
321 Ga0501044_0299494 3300049823 Bacteria 1537
322 Ga0501044_0590428 3300049823 Bacteria 1004
323 Ga0501044_0764006 3300049823 Bacteria 848
324 Ga0501226_000003 3300049853 Bacteria 358977
325 nmdc:mga08y16_1002527_c1 3300050511 Bacteria 815
326 Ga0500659_0098967 3300053135 Bacteria 1513
327 Ga0466962_0005907 3300061719 Bacteria 5881
328 Ga0466962_0051631 3300061719 Bacteria 1966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2537561836 2538833738 161
2 iso_pu_bacteria 2643221562 2643831064 161
3 iso_pu_bacteria 2643221577 2643896892 161
4 iso_pu_bacteria 2643221685 2644479095 161
5 iso_pu_bacteria 2738543020 2739285523 161
6 iso_pu_bacteria 2738543021 2739290836 161
7 iso_pu_bacteria 2808606373 2808907951 161
8 iso_pu_bacteria 2808606379 2808942930 161
9 iso_pu_bacteria 2811994881 2812366042 161
10 iso_pu_bacteria 2842805378 2842809542 161
11 iso_pu_bacteria 2895395659 2895396258 161
12 iso_pu_bacteria 2923519811 2923520064 161
13 iso_pu_bacteria 2939611941 2939615479 161
14 iso_pu_bacteria 2945928738 2945933735 161
15 iso_pu_bacteria 2990196909 2990199351 161
16 iso_pu_bacteria 3007419365 3007422702 161
17 iso_pu_bacteria 640427133 640488129 161
18 iso_pu_bacteria 651053060 651176081 161
19 iso_pu_bacteria 8056161164 8056166342 161
20 iso_pu_bacteria 2526164512 2526211042 162
21 iso_pu_bacteria 2687453130 2687581857 162
22 iso_pu_bacteria 2871272651 2871274318 162
23 iso_pu_bacteria 2932406140 2932407680 162
24 iso_pu_bacteria 2939577877 2939581278 162
25 3300005546 Ga0070696_101287086 Ga0070696_1012870861 163
26 3300005614 Ga0068856_100821852 Ga0068856_1008218522 163
27 3300009545 Ga0105237_11573283 Ga0105237_115732832 163
28 3300013100 Ga0157373_10117691 Ga0157373_101176911 163
29 3300025906 Ga0207699_10756666 Ga0207699_107566661 163
30 3300025914 Ga0207671_11226466 Ga0207671_112264661 163
31 3300026078 Ga0207702_10533051 Ga0207702_105330511 163
32 3300038443 Ga0395901_0471954 Ga0395901_0471954_494_994 163
33 3300048909 Ga0496106_0309329 Ga0496106_0309329_232_732 163
34 3300048912 Ga0496109_0445809 Ga0496109_0445809_53_553 163
35 3300049571 Ga0501034_0058236 Ga0501034_0058236_2089_2586 163
36 3300049574 Ga0501038_0536096 Ga0501038_0536096_335_832 163
37 3300050511 nmdc:mga08y16_1002527_c1 nmdc:mga08y16_1002527_c1_300_794 163
38 3300001979 JGI24740J21852_10002699 JGI24740J21852_100026991 165
39 3300001989 JGI24739J22299_10000803 JGI24739J22299_1000080311 165
40 3300001990 JGI24737J22298_10001352 JGI24737J22298_100013529 165
41 3300002067 JGI24735J21928_10020202 JGI24735J21928_100202023 165
42 3300002067 JGI24735J21928_10036332 JGI24735J21928_100363322 165
43 3300002705 JGI25156J39149_1000637 JGI25156J39149_100063720 165
44 3300002737 JGI25162J39368_1001075 JGI25162J39368_10010752 165
45 3300002738 JGI25154J39366_1003890 JGI25154J39366_10038905 165
46 3300002741 JGI25157J39369_1000425 JGI25157J39369_100042522 165
47 3300002741 JGI25157J39369_1000501 JGI25157J39369_10005018 165
48 3300002772 JGI25164J39214_1000024 JGI25164J39214_100002446 165
49 3300003214 JGI25165J46597_1000394 JGI25165J46597_10003942 165
50 3300003214 JGI25165J46597_1000446 JGI25165J46597_100044617 165
51 3300003215 JGI25153J46596_10008670 JGI25153J46596_100086702 165
52 3300003322 rootL2_10007329 rootL2_100073296 165
53 3300003578 Ga0006562J51391_1058394 Ga0006562J51391_10583943 165
54 3300003578 Ga0006562J51391_1058395 Ga0006562J51391_10583952 165
55 3300003760 Ga0055527_1002581 Ga0055527_10025812 165
56 3300003761 Ga0055535_1000576 Ga0055535_100057629 165
57 3300003762 Ga0055542_1000598 Ga0055542_100059829 165
58 3300003763 Ga0055529_1000387 Ga0055529_100038746 165
59 3300003856 Ga0058692_1059688 Ga0058692_10596881 165
60 3300005337 Ga0070682_100344439 Ga0070682_1003444391 165
61 3300005344 Ga0070661_100041135 Ga0070661_1000411355 165
62 3300005345 Ga0070692_10250588 Ga0070692_102505881 165
63 3300005366 Ga0070659_100071132 Ga0070659_1000711321 165
64 3300005435 Ga0070714_100007413 Ga0070714_1000074135 165
65 3300005435 Ga0070714_100029432 Ga0070714_1000294326 165
66 3300005436 Ga0070713_100020822 Ga0070713_1000208221 165
67 3300005458 Ga0070681_10011625 Ga0070681_100116258 165
68 3300005458 Ga0070681_10044794 Ga0070681_100447945 165
69 3300005530 Ga0070679_100045299 Ga0070679_1000452993 165
70 3300005530 Ga0070679_100055400 Ga0070679_1000554004 165
71 3300005535 Ga0070684_100929622 Ga0070684_1009296222 165
72 3300005539 Ga0068853_100127325 Ga0068853_1001273252 165
73 3300005546 Ga0070696_100005938 Ga0070696_1000059387 165
74 3300005546 Ga0070696_100007255 Ga0070696_1000072557 165
75 3300005547 Ga0070693_100035269 Ga0070693_1000352693 165
76 3300005547 Ga0070693_100043499 Ga0070693_1000434993 165
77 3300005547 Ga0070693_100428810 Ga0070693_1004288102 165
78 3300005563 Ga0068855_100199160 Ga0068855_1001991603 165
79 3300005563 Ga0068855_101298042 Ga0068855_1012980422 165
80 3300005577 Ga0068857_100004160 Ga0068857_1000041606 165
81 3300005577 Ga0068857_100050147 Ga0068857_1000501473 165
82 3300005577 Ga0068857_100411228 Ga0068857_1004112282 165
83 3300005578 Ga0068854_100000218 Ga0068854_10000021821 165
84 3300005578 Ga0068854_100010073 Ga0068854_1000100735 165
85 3300005614 Ga0068856_100147017 Ga0068856_1001470171 165
86 3300005616 Ga0068852_100004500 Ga0068852_10000450010 165
87 3300005617 Ga0068859_102109833 Ga0068859_1021098331 165
88 3300005834 Ga0068851_10001830 Ga0068851_100018303 165
89 3300005842 Ga0068858_100106637 Ga0068858_1001066372 165
90 3300006175 Ga0070712_100460210 Ga0070712_1004602102 165
91 3300006931 Ga0097620_102110632 Ga0097620_1021106321 165
92 3300009093 Ga0105240_10007845 Ga0105240_1000784510 165
93 3300009093 Ga0105240_10012345 Ga0105240_100123453 165
94 3300009174 Ga0105241_10136697 Ga0105241_101366972 165
95 3300009545 Ga0105237_10000436 Ga0105237_1000043636 165
96 3300009545 Ga0105237_10818030 Ga0105237_108180301 165
97 3300009545 Ga0105237_11483014 Ga0105237_114830141 165
98 3300009553 Ga0105249_10567417 Ga0105249_105674172 165
99 3300010375 Ga0105239_10006753 Ga0105239_100067539 165
100 3300013100 Ga0157373_10034389 Ga0157373_100343894 165
101 3300013100 Ga0157373_10372922 Ga0157373_103729221 165
102 3300013100 Ga0157373_10473325 Ga0157373_104733251 165
103 3300013100 Ga0157373_10487423 Ga0157373_104874231 165
104 3300013100 Ga0157373_10621841 Ga0157373_106218411 165
105 3300013102 Ga0157371_10038324 Ga0157371_100383243 165
106 3300013102 Ga0157371_10096878 Ga0157371_100968781 165
107 3300013102 Ga0157371_11023991 Ga0157371_110239912 165
108 3300013104 Ga0157370_10000514 Ga0157370_1000051418 165
109 3300013104 Ga0157370_10630292 Ga0157370_106302922 165
110 3300013104 Ga0157370_11236089 Ga0157370_112360891 165
111 3300013105 Ga0157369_10067284 Ga0157369_100672842 165
112 3300013105 Ga0157369_10254767 Ga0157369_102547672 165
113 3300013105 Ga0157369_10604782 Ga0157369_106047822 165
114 3300013307 Ga0157372_10099609 Ga0157372_100996093 165
115 3300014497 Ga0182008_10046533 Ga0182008_100465332 165
116 3300014497 Ga0182008_10192548 Ga0182008_101925482 165
117 3300014497 Ga0182008_10332075 Ga0182008_103320752 165
118 3300014969 Ga0157376_10107030 Ga0157376_101070304 165
119 3300015261 Ga0182006_1013080 Ga0182006_10130803 165
120 3300015261 Ga0182006_1063470 Ga0182006_10634703 165
121 3300015262 Ga0182007_10016232 Ga0182007_100162323 165
122 3300015262 Ga0182007_10044997 Ga0182007_100449972 165
123 3300015262 Ga0182007_10053509 Ga0182007_100535091 165
124 3300015685 Ga0183369_1003 Ga0183369_1003148 165
125 3300020082 Ga0206353_11948309 Ga0206353_119483092 165
126 3300021361 Ga0213872_10002452 Ga0213872_1000245212 165
127 3300021361 Ga0213872_10002573 Ga0213872_1000257310 165
128 3300025226 Ga0209674_103721 Ga0209674_1037213 165
129 3300025228 Ga0209672_100332 Ga0209672_10033229 165
130 3300025231 Ga0207427_100058 Ga0207427_100058147 165
131 3300025233 Ga0209437_100142 Ga0209437_10014245 165
132 3300025242 Ga0209258_100307 Ga0209258_1003073 165
133 3300025242 Ga0209258_112676 Ga0209258_1126762 165
134 3300025246 Ga0209646_1002888 Ga0209646_10028882 165
135 3300025250 Ga0209026_1000114 Ga0209026_1000114126 165
136 3300025250 Ga0209026_1000346 Ga0209026_100034651 165
137 3300025254 Ga0209148_1000062 Ga0209148_1000062327 165
138 3300025256 Ga0209759_1000602 Ga0209759_100060226 165
139 3300025256 Ga0209759_1012829 Ga0209759_10128293 165
140 3300025258 Ga0209129_1000721 Ga0209129_10007213 165
141 3300025261 Ga0209233_1000141 Ga0209233_1000141147 165
142 3300025272 Ga0209455_1000040 Ga0209455_1000040334 165
143 3300025297 Ga0209758_1002501 Ga0209758_10025016 165
144 3300025297 Ga0209758_1044140 Ga0209758_10441403 165
145 3300025321 Ga0207656_10003096 Ga0207656_100030965 165
146 3300025904 Ga0207647_10036983 Ga0207647_100369831 165
147 3300025904 Ga0207647_10054793 Ga0207647_100547932 165
148 3300025909 Ga0207705_10067718 Ga0207705_100677184 165
149 3300025911 Ga0207654_10076702 Ga0207654_100767022 165
150 3300025912 Ga0207707_10005525 Ga0207707_100055255 165
151 3300025912 Ga0207707_10367382 Ga0207707_103673822 165
152 3300025913 Ga0207695_10002464 Ga0207695_1000246421 165
153 3300025913 Ga0207695_10014229 Ga0207695_100142299 165
154 3300025914 Ga0207671_10000422 Ga0207671_1000042221 165
155 3300025915 Ga0207693_10384877 Ga0207693_103848772 165
156 3300025917 Ga0207660_10109411 Ga0207660_101094112 165
157 3300025921 Ga0207652_10229185 Ga0207652_102291852 165
158 3300025924 Ga0207694_10213052 Ga0207694_102130521 165
159 3300025928 Ga0207700_10006738 Ga0207700_100067387 165
160 3300025929 Ga0207664_10000792 Ga0207664_100007925 165
161 3300025929 Ga0207664_10008842 Ga0207664_100088426 165
162 3300025932 Ga0207690_10009433 Ga0207690_100094335 165
163 3300025945 Ga0207679_10717350 Ga0207679_107173502 165
164 3300025949 Ga0207667_10000752 Ga0207667_100007528 165
165 3300025949 Ga0207667_10002209 Ga0207667_1000220921 165
166 3300025949 Ga0207667_10125098 Ga0207667_101250982 165
167 3300025949 Ga0207667_10207014 Ga0207667_102070141 165
168 3300025961 Ga0207712_10695216 Ga0207712_106952161 165
169 3300025981 Ga0207640_10000275 Ga0207640_100002755 165
170 3300025981 Ga0207640_10000512 Ga0207640_100005123 165
171 3300026035 Ga0207703_10095983 Ga0207703_100959832 165
172 3300026078 Ga0207702_10594602 Ga0207702_105946021 165
173 3300026116 Ga0207674_10001200 Ga0207674_1000120011 165
174 3300026116 Ga0207674_10038923 Ga0207674_100389235 165
175 3300026116 Ga0207674_10529099 Ga0207674_105290992 165
176 3300026142 Ga0207698_10577798 Ga0207698_105777982 165
177 3300026142 Ga0207698_10841246 Ga0207698_108412462 165
178 3300027252 Ga0209973_1018570 Ga0209973_10185701 165
179 3300027312 Ga0209371_1001897 Ga0209371_10018977 165
180 3300027471 Ga0209995_1004935 Ga0209995_10049352 165
181 3300027552 Ga0209982_1011684 Ga0209982_10116841 165
182 3300027614 Ga0209970_1044328 Ga0209970_10443281 165
183 3300027665 Ga0209983_1032916 Ga0209983_10329162 165
184 3300027666 Ga0209282_1000076 Ga0209282_100007658 165
185 3300027682 Ga0209971_1000265 Ga0209971_100026511 165
186 3300027876 Ga0209974_10016862 Ga0209974_100168622 165
187 3300029957 Ga0265324_10040743 Ga0265324_100407432 165
188 3300030500 Ga0268256_1001912 Ga0268256_10019126 165
189 3300031239 Ga0265328_10105036 Ga0265328_101050362 165
190 3300031250 Ga0265331_10002830 Ga0265331_100028306 165
191 3300031250 Ga0265331_10166309 Ga0265331_101663091 165
192 3300031251 Ga0265327_10000557 Ga0265327_1000055734 165
193 3300031251 Ga0265327_10042078 Ga0265327_100420782 165
194 3300031344 Ga0265316_10010545 Ga0265316_100105454 165
195 3300031344 Ga0265316_10224196 Ga0265316_102241962 165
196 3300031507 Ga0307509_10002881 Ga0307509_100028815 165
197 3300031616 Ga0307508_10385217 Ga0307508_103852172 165
198 3300031727 Ga0316576_10064098 Ga0316576_100640982 165
199 3300031728 Ga0316578_10075472 Ga0316578_100754722 165
200 3300032002 Ga0307416_102348089 Ga0307416_1023480891 165
201 3300032168 Ga0316593_10103091 Ga0316593_101030912 165
202 3300035084 Ga0373928_0095630 Ga0373928_0095630_13_513 165
203 3300035113 Ga0373936_0047289 Ga0373936_0047289_535_1038 165
204 3300035398 Ga0316574_0001272 Ga0316574_0001272_9519_10016 165
205 3300035695 Ga0373927_0606485 Ga0373927_0606485_168_671 165
206 3300035724 Ga0373933_0594244 Ga0373933_0594244_124_627 165
207 3300036401 Ga0373937_1259453 Ga0373937_1259453_54_557 165
208 3300036647 Ga0316582_0071376 Ga0316582_0071376_319_816 165
209 3300037418 Ga0395900_1322576 Ga0395900_1322576_43_543 165
210 3300037466 Ga0395898_0000023 Ga0395898_0000023_40660_41160 165
211 3300037466 Ga0395898_1653090 Ga0395898_1653090_48_548 165
212 3300038443 Ga0395901_0002962 Ga0395901_0002962_2262_2762 165
213 3300038443 Ga0395901_0887451 Ga0395901_0887451_316_816 165
214 3300039447 Ga0436361_0149279 Ga0436361_0149279_9926_10426 165
215 3300041404 Ga0439436_0011746 Ga0439436_0011746_399_896 165
216 3300041404 Ga0439436_0035640 Ga0439436_0035640_387_887 165
217 3300041405 Ga0439438_007905 Ga0439438_007905_2667_3170 165
218 3300041405 Ga0439438_012009 Ga0439438_012009_2067_2564 165
219 3300041407 Ga0439447_001173 Ga0439447_001173_2052_2549 165
220 3300041407 Ga0439447_017384 Ga0439447_017384_1182_1685 165
221 3300041411 Ga0439466_0005626 Ga0439466_0005626_2179_2676 165
222 3300041486 Ga0451807_0546891 Ga0451807_0546891_470_967 165
223 3300042000 Ga0439437_000297 Ga0439437_000297_2560_3060 165
224 3300042000 Ga0439437_001152 Ga0439437_001152_1015_1515 165
225 3300042005 Ga0439448_0112853 Ga0439448_0112853_351_848 165
226 3300042006 Ga0439432_018356 Ga0439432_018356_1608_2105 165
227 3300042010 Ga0439452_003306 Ga0439452_003306_1455_1952 165
228 3300042012 Ga0439455_0013243 Ga0439455_0013243_458_958 165
229 3300042013 Ga0439456_019964 Ga0439456_019964_61_561 165
230 3300042115 Ga0450911_000004 Ga0450911_000004_5254_5754 165
231 3300042125 Ga0450923_049702 Ga0450923_049702_310_807 165
232 3300042136 Ga0450900_033399 Ga0450900_033399_141_641 165
233 3300042139 Ga0450904_000093 Ga0450904_000093_6434_6934 165
234 3300042156 Ga0439446_0001949 Ga0439446_0001949_1537_2037 165
235 3300042156 Ga0439446_0002306 Ga0439446_0002306_3460_3957 165
236 3300042435 Ga0439434_0011053 Ga0439434_0011053_50_547 165
237 3300042438 Ga0439459_0008460 Ga0439459_0008460_683_1183 165
238 3300042439 Ga0439464_0222443 Ga0439464_0222443_59_562 165
239 3300042532 Ga0450893_0103222 Ga0450893_0103222_41_541 165
240 3300042876 Ga0451577_0000137 Ga0451577_0000137_129145_129645 165
241 3300042876 Ga0451577_0000408 Ga0451577_0000408_10542_11042 165
242 3300042876 Ga0451577_0060551 Ga0451577_0060551_276_779 165
243 3300042876 Ga0451577_0377551 Ga0451577_0377551_104_607 165
244 3300044536 Ga0466988_0199618 Ga0466988_0199618_339_839 165
245 3300044656 Ga0466969_0023220 Ga0466969_0023220_1002_1502 165
246 3300044656 Ga0466969_0036327 Ga0466969_0036327_832_1332 165
247 3300044672 Ga0466982_0000007 Ga0466982_0000007_228356_228856 165
248 3300044673 Ga0453683_0154395 Ga0453683_0154395_301_801 165
249 3300044673 Ga0453683_0373259 Ga0453683_0373259_193_696 165
250 3300044683 Ga0466965_0067297 Ga0466965_0067297_292_792 165
251 3300044684 Ga0466966_0004718 Ga0466966_0004718_3001_3501 165
252 3300044684 Ga0466966_0105531 Ga0466966_0105531_384_884 165
253 3300044693 Ga0466961_0036028 Ga0466961_0036028_2342_2842 165
254 3300044693 Ga0466961_0062734 Ga0466961_0062734_1725_2225 165
255 3300044694 Ga0466963_0194685 Ga0466963_0194685_622_1122 165
256 3300044712 Ga0453684_0000014 Ga0453684_0000014_60235_60735 165
257 3300044712 Ga0453684_0000348 Ga0453684_0000348_55185_55688 165
258 3300044712 Ga0453684_0005696 Ga0453684_0005696_10116_10616 165
259 3300044712 Ga0453684_1876545 Ga0453684_1876545_93_593 165
260 3300044719 Ga0466971_0031838 Ga0466971_0031838_733_1233 165
261 3300044719 Ga0466971_0034444 Ga0466971_0034444_523_1023 165
262 3300044765 Ga0466970_0006875 Ga0466970_0006875_541_1041 165
263 3300044842 Ga0466957_0531105 Ga0466957_0531105_211_711 165
264 3300044901 Ga0466960_0007960 Ga0466960_0007960_261_761 165
265 3300045049 Ga0466959_0030994 Ga0466959_0030994_1862_2362 165
266 3300045051 Ga0451576_0000169 Ga0451576_0000169_43593_44093 165
267 3300045051 Ga0451576_0009818 Ga0451576_0009818_6857_7360 165
268 3300045051 Ga0451576_0117766 Ga0451576_0117766_2220_2723 165
269 3300045051 Ga0451576_0153992 Ga0451576_0153992_913_1416 165
270 3300045051 Ga0451576_0795954 Ga0451576_0795954_308_811 165
271 3300045051 Ga0451576_1442871 Ga0451576_1442871_62_565 165
272 3300045836 Ga0466958_0015059 Ga0466958_0015059_3295_3795 165
273 3300045976 Ga0466967_0079229 Ga0466967_0079229_951_1451 165
274 3300046460 Ga0495638_0000106 Ga0495638_0000106_53034_53534 165
275 3300046474 Ga0495605_0012367 Ga0495605_0012367_874_1374 165
276 3300046500 Ga0495596_0002185 Ga0495596_0002185_7041_7541 165
277 3300046501 Ga0495607_0003409 Ga0495607_0003409_6128_6628 165
278 3300046507 Ga0495606_0000553 Ga0495606_0000553_11566_12066 165
279 3300046512 Ga0495610_0001929 Ga0495610_0001929_3144_3644 165
280 3300046513 Ga0495616_0006298 Ga0495616_0006298_3569_4069 165
281 3300046522 Ga0495643_0000017 Ga0495643_0000017_200759_201259 165
282 3300046530 Ga0495654_0148424 Ga0495654_0148424_23_523 165
283 3300046533 Ga0495640_0127017 Ga0495640_0127017_320_922 165
284 3300046538 Ga0495609_0001984 Ga0495609_0001984_2908_3408 165
285 3300046542 Ga0495597_0068360 Ga0495597_0068360_887_1387 165
286 3300046615 Ga0495656_0254324 Ga0495656_0254324_182_682 165
287 3300046660 Ga0495625_0407650 Ga0495625_0407650_288_788 165
288 3300046665 Ga0495661_0019065 Ga0495661_0019065_2494_2994 165
289 3300046692 Ga0495671_0001178 Ga0495671_0001178_14462_14962 165
290 3300046692 Ga0495671_0001473 Ga0495671_0001473_11335_11835 165
291 3300046692 Ga0495671_0275486 Ga0495671_0275486_143_643 165
292 3300046694 Ga0495649_0000033 Ga0495649_0000033_24105_24605 165
293 3300046694 Ga0495649_0006448 Ga0495649_0006448_3760_4260 165
294 3300046694 Ga0495649_0276124 Ga0495649_0276124_275_775 165
295 3300047447 Ga0495685_033601 Ga0495685_033601_170_670 165
296 3300048904 Ga0496101_0345835 Ga0496101_0345835_85_585 165
297 3300048907 Ga0496104_0680251 Ga0496104_0680251_35_535 165
298 3300048912 Ga0496109_0421489 Ga0496109_0421489_62_559 165
299 3300048921 Ga0496118_0320555 Ga0496118_0320555_180_680 165
300 3300048922 Ga0496119_0010208 Ga0496119_0010208_1134_1634 165
301 3300048923 Ga0496120_0002007 Ga0496120_0002007_7903_8403 165
302 3300048924 Ga0496121_0004837 Ga0496121_0004837_2985_3485 165
303 3300048925 Ga0496122_0009510 Ga0496122_0009510_6800_7300 165
304 3300048926 Ga0496123_0003430 Ga0496123_0003430_14202_14702 165
305 3300048928 Ga0496125_0000766 Ga0496125_0000766_29698_30195 165
306 3300048929 Ga0496126_0268856 Ga0496126_0268856_841_1341 165
307 3300049568 Ga0501031_0133121 Ga0501031_0133121_157_657 165
308 3300049568 Ga0501031_0173133 Ga0501031_0173133_707_1207 165
309 3300049568 Ga0501031_0251906 Ga0501031_0251906_86_586 165
310 3300049568 Ga0501031_0874089 Ga0501031_0874089_46_546 165
311 3300049569 Ga0501032_0032035 Ga0501032_0032035_68_565 165
312 3300049569 Ga0501032_0684327 Ga0501032_0684327_21_521 165
313 3300049570 Ga0501033_0145675 Ga0501033_0145675_93_593 165
314 3300049571 Ga0501034_0000334 Ga0501034_0000334_81685_82185 165
315 3300049571 Ga0501034_0034571 Ga0501034_0034571_4569_5069 165
316 3300049571 Ga0501034_0357781 Ga0501034_0357781_430_930 165
317 3300049573 Ga0501037_0031161 Ga0501037_0031161_2075_2572 165
318 3300049573 Ga0501037_0137387 Ga0501037_0137387_1232_1732 165
319 3300049573 Ga0501037_0422404 Ga0501037_0422404_394_894 165
320 3300049574 Ga0501038_0148420 Ga0501038_0148420_50_550 165
321 3300049574 Ga0501038_0173366 Ga0501038_0173366_723_1223 165
322 3300049575 Ga0501039_0148215 Ga0501039_0148215_430_927 165
323 3300049578 Ga0501042_0184946 Ga0501042_0184946_77_577 165
324 3300049579 Ga0501043_0062645 Ga0501043_0062645_24_524 165
325 3300049579 Ga0501043_0226372 Ga0501043_0226372_771_1271 165
326 3300049579 Ga0501043_0254929 Ga0501043_0254929_123_623 165
327 3300049580 Ga0501046_0058638 Ga0501046_0058638_842_1342 165
328 3300049580 Ga0501046_0077382 Ga0501046_0077382_279_779 165
329 3300049581 Ga0501047_0067661 Ga0501047_0067661_1858_2358 165
330 3300049581 Ga0501047_0144705 Ga0501047_0144705_1144_1644 165
331 3300049581 Ga0501047_0521511 Ga0501047_0521511_482_982 165
332 3300049581 Ga0501047_0578118 Ga0501047_0578118_313_813 165
333 3300049581 Ga0501047_1091302 Ga0501047_1091302_62_562 165
334 3300049582 Ga0501048_0036958 Ga0501048_0036958_2664_3167 165
335 3300049582 Ga0501048_0059342 Ga0501048_0059342_254_754 165
336 3300049586 Ga0501070_0090314 Ga0501070_0090314_41_541 165
337 3300049586 Ga0501070_0208346 Ga0501070_0208346_989_1489 165
338 3300049589 Ga0501073_0227796 Ga0501073_0227796_725_1225 165
339 3300049742 Ga0501080_0029689 Ga0501080_0029689_3695_4225 165
340 3300049742 Ga0501080_0292650 Ga0501080_0292650_890_1390 165
341 3300049822 Ga0501035_0114035 Ga0501035_0114035_1332_1832 165
342 3300049822 Ga0501035_0427104 Ga0501035_0427104_111_614 165
343 3300049822 Ga0501035_0533842 Ga0501035_0533842_313_813 165
344 3300049823 Ga0501044_0117271 Ga0501044_0117271_1495_1995 165
345 3300049823 Ga0501044_0178089 Ga0501044_0178089_718_1218 165
346 3300049823 Ga0501044_0299494 Ga0501044_0299494_601_1104 165
347 3300049823 Ga0501044_0590428 Ga0501044_0590428_99_599 165
348 3300049823 Ga0501044_0764006 Ga0501044_0764006_158_658 165
349 3300049853 Ga0501226_000003 Ga0501226_000003_34280_34780 165
350 3300053135 Ga0500659_0098967 Ga0500659_0098967_839_1339 165
351 3300061719 Ga0466962_0005907 Ga0466962_0005907_3201_3701 165
352 3300061719 Ga0466962_0051631 Ga0466962_0051631_1323_1823 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

53

196

0.97

PF00578

AhpC-TSA

AhpC/TSA family

54

180

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i43-assembly1.cif.gz_A escherichia coli thiol peroxidase (tpx) wild type disulfide form 0.9722 1 164
1q98-assembly1.cif.gz_B structure of a thiol peroxidase from haemophilus influenzae rd 0.9702 3 164
2xpe-assembly1.cif.gz_A oxidised thiol peroxidase (tpx) from yersinia pseudotuberculosis 0.9685 3 164
4je1-assembly1.cif.gz_B crystal structure of thiol peroxidase from burkholderia cenocepacia j2315 0.9659 2 165
3hvx-assembly1.cif.gz_A-2 escherichia coli thiol peroxidase (tpx) resolving cysteine to serine mutant (c95s) with an intermolecular disulfide bond 0.9655 1 164
ID Description Score Start End Superfamily
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9409 2 165 3.40.30.10
4af2A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9299 2 165 3.40.30.10
1psqB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9152 4 163 3.40.30.10
1xvqA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.905 2 164 3.40.30.10
2yzhD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8933 1 164 3.40.30.10
ID Description Score Start End GO Terms
AF-D4DPA3-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9876 1 165 GO:0008379
AF-A0A1T0ARY6-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9841 1 165 GO:0008379
AF-I2DJQ9-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9829 1 164 GO:0008379
AF-A0A837C1X2-F1-model_v4 deleted 0.9802 1 165
AF-A0A1M3ED54-F1-model_v4 Thiol peroxidase (Tpx) (EC 1.11.1.24) (Peroxiredoxin tpx) (Prx) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin) 0.9796 1 165 GO:0008379

Feature Viewer

pLDDT pTM Quality
89.12 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map