F417475

General Info

Members Datasets Scaffolds Average Seq Length
348 251 338 96

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101110176|Ga0068863_1011101762
Length 114
Sequence MEAVDPTVFRLAIFVLAIFVGYYVVWSVTPALHTPLMAVTNAISSVIIVGALLAVAAHPVDGGAMTTNVWISKGSGAVAAAFASVNIFGGFLVVRRMLAMYKKKDPAVKKDGAK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
4 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
5 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
6 2643221672 Variovorax sp. Root434 Isolate Unclassified
7 2857564685 Duganella sp. R-74599 Isolate Unclassified
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
156 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
160 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
193 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
194 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
195 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
196 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
212 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
213 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
214 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
218 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
222 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
223 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
224 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
233 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
236 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
237 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0.86
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0.86
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 4.02
Rhizosphere 83.05
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_510765 2162886007 Bacteria 1254
2 JGI24740J21852_10000132 3300001979 Bacteria 28311
3 JGI24740J21852_10012538 3300001979 Bacteria 3193
4 JGI24739J22299_10018932 3300001989 Bacteria 2469
5 JGI24735J21928_10003435 3300002067 Bacteria 5395
6 JGI25158J39367_1004695 3300002739 Bacteria 2041
7 JGI25160J50197_1014825 3300003354 Bacteria 2587
8 Ga0065704_10126700 3300005289 Bacteria 1686
9 Ga0065715_10167043 3300005293 Bacteria 1571
10 Ga0065707_10137904 3300005295 Bacteria 1809
11 Ga0070683_101118690 3300005329 Bacteria 757
12 Ga0070670_100323379 3300005331 Bacteria 1352
13 Ga0070670_100671437 3300005331 Bacteria 930
14 Ga0070677_10002044 3300005333 Bacteria 6419
15 Ga0068869_100765431 3300005334 Bacteria 828
16 Ga0070680_100235285 3300005336 Bacteria 1547
17 Ga0070680_101763574 3300005336 Bacteria 536
18 Ga0070682_100015631 3300005337 Bacteria 4401
19 Ga0070682_100094836 3300005337 Bacteria 1958
20 Ga0070682_101044013 3300005337 Bacteria 681
21 Ga0068868_100311287 3300005338 Bacteria 1340
22 Ga0070660_100027995 3300005339 Bacteria 4212
23 Ga0070691_10021856 3300005341 Bacteria 2964
24 Ga0070661_100000165 3300005344 Bacteria 54127
25 Ga0070692_10750556 3300005345 Bacteria 661
26 Ga0070668_100189800 3300005347 Bacteria 1683
27 Ga0070668_101680216 3300005347 Bacteria 583
28 Ga0070675_100014713 3300005354 Bacteria 6172
29 Ga0070675_100017370 3300005354 Bacteria 5715
30 Ga0070671_100309734 3300005355 Bacteria 1345
31 Ga0070674_100110438 3300005356 Bacteria 2018
32 Ga0070673_101475750 3300005364 Bacteria 641
33 Ga0070659_100700370 3300005366 Bacteria 876
34 Ga0070667_100375467 3300005367 Bacteria 1291
35 Ga0070714_101578447 3300005435 Bacteria 641
36 Ga0070663_100171718 3300005455 Bacteria 1676
37 Ga0070678_101189287 3300005456 Bacteria 707
38 Ga0070678_101598690 3300005456 Bacteria 612
39 Ga0070662_100083429 3300005457 Bacteria 2385
40 Ga0070662_100247939 3300005457 Bacteria 1431
41 Ga0070681_10600922 3300005458 Bacteria 1014
42 Ga0070698_101308758 3300005471 Bacteria 675
43 Ga0070679_100708185 3300005530 Bacteria 950
44 Ga0070679_101182809 3300005530 Bacteria 710
45 Ga0068853_100033503 3300005539 Bacteria 4359
46 Ga0068853_101715302 3300005539 Bacteria 609
47 Ga0070672_100582914 3300005543 Bacteria 973
48 Ga0070686_100000284 3300005544 Bacteria 34135
49 Ga0070695_101309415 3300005545 Bacteria 599
50 Ga0070693_100659011 3300005547 Bacteria 762
51 Ga0070665_100460571 3300005548 Bacteria 1282
52 Ga0068855_100017926 3300005563 Bacteria 8507
53 Ga0068855_100319830 3300005563 Bacteria 1715
54 Ga0068855_100607662 3300005563 Bacteria 1178
55 Ga0068855_101213811 3300005563 Bacteria 784
56 Ga0068855_101849395 3300005563 Bacteria 613
57 Ga0068855_102046597 3300005563 Bacteria 577
58 Ga0070664_101070673 3300005564 Bacteria 759
59 Ga0068857_100048220 3300005577 Bacteria 3782
60 Ga0068857_101662244 3300005577 Bacteria 624
61 Ga0068854_100821464 3300005578 Bacteria 812
62 Ga0068856_100015151 3300005614 Bacteria 7448
63 Ga0068856_100339400 3300005614 Bacteria 1520
64 Ga0070702_101040006 3300005615 Bacteria 651
65 Ga0070702_101293680 3300005615 Bacteria 592
66 Ga0068852_100392431 3300005616 Bacteria 1364
67 Ga0068852_102369470 3300005616 Bacteria 552
68 Ga0068859_100412550 3300005617 Bacteria 1446
69 Ga0068864_100261655 3300005618 Bacteria 1609
70 Ga0068866_10067413 3300005718 Bacteria 1879
71 Ga0068861_101094280 3300005719 Bacteria 766
72 Ga0068863_100343150 3300005841 Bacteria 1453
73 Ga0068863_101110176 3300005841 Bacteria 796
74 Ga0068858_100226494 3300005842 Bacteria 1772
75 Ga0068860_100256432 3300005843 Bacteria 1704
76 Ga0068862_101305317 3300005844 Bacteria 727
77 Ga0075364_10006257 3300006051 Bacteria 6983
78 Ga0075369_10033195 3300006186 Bacteria 2187
79 Ga0075370_10003552 3300006353 Bacteria 7450
80 Ga0075428_100165545 3300006844 Bacteria 2398
81 Ga0075429_101347481 3300006880 Bacteria 622
82 Ga0068865_100780446 3300006881 Bacteria 823
83 Ga0097620_100412550 3300006931 Bacteria 1446
84 Ga0105240_10234864 3300009093 Bacteria 2128
85 Ga0105240_12678535 3300009093 Bacteria 515
86 Ga0111539_11054904 3300009094 Bacteria 945
87 Ga0105245_10799101 3300009098 Bacteria 981
88 Ga0105245_12435666 3300009098 Bacteria 577
89 Ga0105247_10092648 3300009101 Bacteria 1920
90 Ga0105243_10453249 3300009148 Bacteria 1204
91 Ga0105242_12916234 3300009176 Bacteria 529
92 Ga0105248_11457737 3300009177 Bacteria 775
93 Ga0105248_12948753 3300009177 Bacteria 542
94 Ga0105238_11536865 3300009551 Bacteria 695
95 Ga0105238_12904679 3300009551 Bacteria 515
96 Ga0105249_10000106 3300009553 Bacteria 115526
97 Ga0105249_10671664 3300009553 Bacteria 1095
98 Ga0105249_11641082 3300009553 Bacteria 715
99 Ga0105246_10172648 3300011119 Bacteria 1657
100 Ga0157373_10198674 3300013100 Bacteria 1414
101 Ga0157371_10007335 3300013102 Bacteria 8941
102 Ga0157371_10052609 3300013102 Bacteria 2892
103 Ga0157371_10256956 3300013102 Bacteria 1259
104 Ga0163162_10060951 3300013306 Bacteria 3810
105 Ga0163162_11414149 3300013306 Bacteria 791
106 Ga0157372_10726619 3300013307 Bacteria 1155
107 Ga0157375_11981264 3300013308 Bacteria 692
108 Ga0157375_12312232 3300013308 Bacteria 641
109 Ga0157375_12721207 3300013308 Bacteria 591
110 Ga0163163_10038774 3300014325 Bacteria 4645
111 Ga0163163_10510478 3300014325 Bacteria 1264
112 Ga0157380_10759747 3300014326 Bacteria 982
113 Ga0182008_10198493 3300014497 Bacteria 1020
114 Ga0157379_10196769 3300014968 Bacteria 1822
115 Ga0157379_11995690 3300014968 Bacteria 573
116 Ga0157376_10996029 3300014969 Bacteria 860
117 Ga0183363_1007 3300015690 Bacteria 315687
118 Ga0163161_10870637 3300017792 Bacteria 761
119 Ga0213872_10026168 3300021361 Bacteria 2680
120 Ga0209256_1019646 3300025299 Bacteria 2142
121 Ga0207682_10029282 3300025893 Bacteria 2201
122 Ga0207682_10353522 3300025893 Bacteria 692
123 Ga0207642_10205224 3300025899 Bacteria 1091
124 Ga0207680_10670174 3300025903 Bacteria 743
125 Ga0207643_10306199 3300025908 Bacteria 990
126 Ga0207705_10000159 3300025909 Bacteria 72293
127 Ga0207707_10039795 3300025912 Bacteria 4108
128 Ga0207707_10078856 3300025912 Bacteria 2876
129 Ga0207695_10007642 3300025913 Bacteria 13697
130 Ga0207695_10128177 3300025913 Bacteria 2497
131 Ga0207695_10175556 3300025913 Bacteria 2065
132 Ga0207671_10308113 3300025914 Bacteria 1251
133 Ga0207663_10444127 3300025916 Bacteria 999
134 Ga0207660_10345229 3300025917 Bacteria 1192
135 Ga0207657_11415036 3300025919 Bacteria 522
136 Ga0207649_10000790 3300025920 Bacteria 20471
137 Ga0207649_10823702 3300025920 Bacteria 725
138 Ga0207652_10001571 3300025921 Bacteria 20110
139 Ga0207652_10660338 3300025921 Bacteria 935
140 Ga0207650_10463635 3300025925 Bacteria 1056
141 Ga0207650_10602307 3300025925 Bacteria 924
142 Ga0207659_10014957 3300025926 Bacteria 5018
143 Ga0207659_10103565 3300025926 Bacteria 2151
144 Ga0207644_10766949 3300025931 Bacteria 806
145 Ga0207690_10104844 3300025932 Bacteria 2026
146 Ga0207669_10185512 3300025937 Bacteria 1496
147 Ga0207691_10038762 3300025940 Bacteria 4410
148 Ga0207691_11651874 3300025940 Bacteria 520
149 Ga0207689_10757909 3300025942 Bacteria 819
150 Ga0207679_10107284 3300025945 Bacteria 2197
151 Ga0207667_10064337 3300025949 Bacteria 3830
152 Ga0207667_10232699 3300025949 Bacteria 1886
153 Ga0207667_10307270 3300025949 Bacteria 1620
154 Ga0207667_12201849 3300025949 Bacteria 508
155 Ga0207712_10000593 3300025961 Bacteria 28979
156 Ga0207712_10312284 3300025961 Bacteria 1294
157 Ga0207712_10446978 3300025961 Bacteria 1095
158 Ga0207668_10337589 3300025972 Bacteria 1256
159 Ga0207668_11001457 3300025972 Bacteria 747
160 Ga0207640_10510352 3300025981 Bacteria 1003
161 Ga0207640_10877506 3300025981 Bacteria 782
162 Ga0207677_10387456 3300026023 Bacteria 1181
163 Ga0207703_10021904 3300026035 Bacteria 5004
164 Ga0207639_10105895 3300026041 Bacteria 2282
165 Ga0207678_10001802 3300026067 Bacteria 19610
166 Ga0207702_10979038 3300026078 Bacteria 839
167 Ga0207702_11465845 3300026078 Bacteria 676
168 Ga0207674_10013676 3300026116 Bacteria 8990
169 Ga0207675_100966648 3300026118 Bacteria 869
170 Ga0207683_10159137 3300026121 Bacteria 2041
171 Ga0207683_10912072 3300026121 Bacteria 816
172 Ga0207683_11067222 3300026121 Bacteria 749
173 Ga0207698_10289052 3300026142 Bacteria 1520
174 Ga0268265_11844442 3300028380 Bacteria 611
175 Ga0268264_10197838 3300028381 Bacteria 1836
176 Ga0268264_12120785 3300028381 Bacteria 570
177 Ga0265338_10330353 3300028800 Bacteria 1101
178 Ga0265320_10242682 3300031240 Bacteria 800
179 Ga0265331_10000193 3300031250 Bacteria 75140
180 Ga0307513_10034448 3300031456 Bacteria 5683
181 Ga0307513_10062187 3300031456 Bacteria 3947
182 Ga0307408_101685199 3300031548 Bacteria 604
183 Ga0265314_10075763 3300031711 Bacteria 2237
184 Ga0265314_10633292 3300031711 Bacteria 547
185 Ga0307413_10021740 3300031824 Bacteria 3442
186 Ga0307413_10974181 3300031824 Bacteria 725
187 Ga0307413_11862175 3300031824 Bacteria 540
188 Ga0307410_10007528 3300031852 Bacteria 5968
189 Ga0307410_11489822 3300031852 Bacteria 596
190 Ga0307410_12056364 3300031852 Bacteria 510
191 Ga0307406_10031035 3300031901 Bacteria 3251
192 Ga0307407_10681783 3300031903 Bacteria 772
193 Ga0307407_11034465 3300031903 Bacteria 636
194 Ga0307409_100161319 3300031995 Bacteria 1961
195 Ga0307409_100217856 3300031995 Bacteria 1721
196 Ga0307409_100396373 3300031995 Bacteria 1317
197 Ga0307409_101009909 3300031995 Bacteria 850
198 Ga0307416_100547347 3300032002 Bacteria 1230
199 Ga0307416_103473222 3300032002 Bacteria 527
200 Ga0307414_10048240 3300032004 Bacteria 2937
201 Ga0307414_10070622 3300032004 Bacteria 2515
202 Ga0307414_10109029 3300032004 Bacteria 2102
203 Ga0307414_10403050 3300032004 Bacteria 1188
204 Ga0307414_11002021 3300032004 Bacteria 769
205 Ga0307414_11230282 3300032004 Bacteria 694
206 Ga0307414_11647076 3300032004 Bacteria 598
207 Ga0307411_10113535 3300032005 Bacteria 1944
208 Ga0307411_11131927 3300032005 Bacteria 707
209 Ga0307411_11902175 3300032005 Bacteria 554
210 Ga0373960_0177443 3300035121 Bacteria 742
211 Ga0373935_0517144 3300035692 Bacteria 868
212 Ga0316582_1033126 3300036647 Bacteria 561
213 Ga0316584_0326898 3300036712 Bacteria 1105
214 Ga0395905_0287217 3300037471 Bacteria 1532
215 Ga0395901_0425473 3300038443 Bacteria 1361
216 Ga0400486_21634 3300038742 Bacteria 1224
217 Ga0436361_0084823 3300039447 Bacteria 6063
218 Ga0439465_0360472 3300041413 Bacteria 550
219 Ga0451791_1532159 3300041451 Bacteria 565
220 Ga0451802_1634235 3300041460 Bacteria 572
221 Ga0451807_0048526 3300041486 Bacteria 608
222 Ga0451835_0380692 3300041492 Bacteria 1185
223 Ga0451855_0733954 3300041511 Bacteria 567
224 Ga0451853_1309178 3300041512 Bacteria 978
225 Ga0451853_1585237 3300041512 Bacteria 1469
226 Ga0439462_0003188 3300042015 Bacteria 3916
227 Ga0439458_0128017 3300042157 Bacteria 672
228 Ga0439435_0107276 3300042436 Bacteria 864
229 Ga0439459_0166554 3300042438 Bacteria 585
230 Ga0439464_0270974 3300042439 Bacteria 551
231 Ga0439460_0140945 3300042461 Bacteria 800
232 Ga0466965_0905124 3300044683 Bacteria 515
233 Ga0466963_0359524 3300044694 Bacteria 1026
234 Ga0466971_0342771 3300044719 Bacteria 722
235 Ga0466957_0805238 3300044842 Bacteria 668
236 Ga0466960_0706702 3300044901 Bacteria 605
237 Ga0495603_0287051 3300046455 Bacteria 946
238 Ga0495580_0224719 3300046472 Bacteria 1290
239 Ga0495606_0009363 3300046507 Bacteria 8295
240 Ga0495610_0000534 3300046512 Bacteria 38300
241 Ga0495631_0140532 3300046518 Bacteria 1037
242 Ga0495640_0037746 3300046533 Bacteria 3404
243 Ga0495669_0265887 3300046684 Bacteria 824
244 Ga0495589_0006154 3300046794 Bacteria 6338
245 Ga0495672_0008327 3300047320 Bacteria 7675
246 Ga0495677_0134998 3300047445 Bacteria 946
247 Ga0495626_0004263 3300048091 Bacteria 8832
248 Ga0496101_0799666 3300048904 Bacteria 744
249 Ga0496105_1157160 3300048908 Bacteria 572
250 Ga0496108_0082876 3300048911 Bacteria 2720
251 Ga0496108_0519889 3300048911 Bacteria 1039
252 Ga0496109_0270782 3300048912 Bacteria 1600
253 Ga0496109_0373430 3300048912 Bacteria 1347
254 Ga0496109_0706476 3300048912 Bacteria 946
255 Ga0496110_0115155 3300048913 Bacteria 2420
256 Ga0496111_0490153 3300048914 Bacteria 905
257 Ga0496114_0768036 3300048917 Bacteria 842
258 Ga0496115_0864129 3300048918 Bacteria 700
259 Ga0501290_002478 3300049513 Bacteria 2380
260 Ga0501292_002926 3300049515 Bacteria 2240
261 Ga0501294_002147 3300049517 Bacteria 1893
262 Ga0501300_033488 3300049523 Bacteria 762
263 Ga0501317_027719 3300049533 Bacteria 806
264 Ga0501034_0281233 3300049571 Bacteria 1603
265 Ga0501034_0566994 3300049571 Bacteria 1044
266 Ga0501034_0801939 3300049571 Bacteria 834
267 Ga0501034_1456592 3300049571 Bacteria 559
268 Ga0501036_0050128 3300049572 Bacteria 3536
269 Ga0501042_1245231 3300049578 Bacteria 543
270 Ga0501043_1218259 3300049579 Bacteria 528
271 Ga0501046_0017754 3300049580 Bacteria 5935
272 Ga0501046_0137552 3300049580 Bacteria 1850
273 Ga0501046_0216691 3300049580 Bacteria 1419
274 Ga0501047_0005776 3300049581 Bacteria 11654
275 Ga0501047_0294586 3300049581 Bacteria 1466
276 Ga0501048_0640509 3300049582 Bacteria 763
277 Ga0501067_0017338 3300049583 Bacteria 3980
278 Ga0501067_0064735 3300049583 Bacteria 2024
279 Ga0501067_0185373 3300049583 Bacteria 1159
280 Ga0501069_0248209 3300049585 Bacteria 1038
281 Ga0501072_0806440 3300049588 Bacteria 735
282 Ga0501073_0032603 3300049589 Bacteria 3714
283 Ga0501074_0020416 3300049590 Bacteria 4815
284 Ga0501076_1424273 3300049592 Bacteria 569
285 Ga0501077_0952786 3300049593 Bacteria 552
286 Ga0501222_010113 3300049662 Bacteria 1246
287 Ga0501222_069270 3300049662 Bacteria 546
288 Ga0501223_008831 3300049663 Bacteria 2051
289 Ga0501233_028574 3300049668 Bacteria 1246
290 Ga0501235_010549 3300049669 Bacteria 2018
291 Ga0501257_036664 3300049686 Bacteria 1195
292 Ga0501259_010579 3300049688 Bacteria 1509
293 Ga0501261_002874 3300049690 Bacteria 2116
294 Ga0501221_015764 3300049704 Bacteria 1422
295 Ga0501080_0036160 3300049742 Bacteria 4610
296 Ga0501080_0435552 3300049742 Bacteria 1176
297 Ga0501083_0014934 3300049744 Bacteria 5433
298 Ga0501083_0023711 3300049744 Bacteria 4255
299 Ga0501083_0306464 3300049744 Bacteria 1033
300 Ga0501279_000182 3300049775 Bacteria 8660
301 Ga0501280_004298 3300049776 Bacteria 2102
302 Ga0501282_000324 3300049778 Bacteria 5782
303 Ga0501283_008748 3300049779 Bacteria 1465
304 Ga0501035_0113608 3300049822 Bacteria 2372
305 Ga0501044_0591063 3300049823 Bacteria 1004
306 Ga0501044_1313721 3300049823 Bacteria 590
307 nmdc:mga00v17_4911_c1 3300050491 Bacteria 7008
308 nmdc:mga0k408_73827_c1 3300050493 Bacteria 1992
309 nmdc:mga07m45_98643_c1 3300050496 Bacteria 819
310 nmdc:mga07m45_99792_c1 3300050496 Bacteria 1667
311 nmdc:mga09592_969162_c1 3300050508 Bacteria 712
312 nmdc:mga08y16_1893262_c1 3300050511 Bacteria 547
313 nmdc:mga0sz30_33634_c1 3300050516 Bacteria 2131
314 Ga0500578_0468243 3300053086 Bacteria 714
315 Ga0500643_006134 3300053087 Bacteria 5072
316 Ga0500643_189860 3300053087 Bacteria 551
317 Ga0500566_0001217 3300053094 Bacteria 15061
318 Ga0500592_023533 3300053116 Bacteria 993
319 Ga0500607_085787 3300053121 Bacteria 1595
320 Ga0500559_0023386 3300053136 Bacteria 2623
321 Ga0500559_0079391 3300053136 Bacteria 1489
322 Ga0500564_205247 3300053138 Bacteria 807
323 Ga0500568_0002985 3300053139 Bacteria 9677
324 Ga0500590_335546 3300053148 Bacteria 548
325 Ga0500616_0000101 3300053153 Bacteria 172722
326 Ga0500616_0011723 3300053153 Bacteria 5161
327 Ga0500622_0128280 3300053156 Bacteria 1222
328 Ga0500627_0386756 3300053158 Bacteria 598
329 Ga0500637_0148949 3300053178 Bacteria 1352
330 Ga0500645_043680 3300053730 Bacteria 1319
331 Ga0501084_0126076 3300054114 Bacteria 2154
332 Ga0501084_1639174 3300054114 Bacteria 538
333 Ga0587091_116984 3300059511 Bacteria 643
334 Ga0587107_135290 3300059652 Bacteria 522
335 Ga0501082_0006870 3300060353 Bacteria 9842
336 Ga0501082_0108057 3300060353 Bacteria 2407
337 Ga0501082_0373990 3300060353 Bacteria 1243
338 Ga0530510_1484072 3300061734 Bacteria 521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0037746 Ga0495640_0037746_2578_2925 70
2 3300005367 Ga0070667_100375467 Ga0070667_1003754672 78
3 3300035692 Ga0373935_0517144 Ga0373935_0517144_146_490 78
4 3300005563 Ga0068855_100319830 Ga0068855_1003198302 80
5 3300025913 Ga0207695_10175556 Ga0207695_101755562 80
6 3300025949 Ga0207667_10307270 Ga0207667_103072702 80
7 3300028800 Ga0265338_10330353 Ga0265338_103303531 80
8 3300014325 Ga0163163_10038774 Ga0163163_100387742 81
9 3300031240 Ga0265320_10242682 Ga0265320_102426821 81
10 3300009093 Ga0105240_12678535 Ga0105240_126785352 82
11 3300053158 Ga0500627_0386756 Ga0500627_0386756_59_361 82
12 3300005364 Ga0070673_101475750 Ga0070673_1014757501 83
13 3300009551 Ga0105238_11536865 Ga0105238_115368651 83
14 3300021361 Ga0213872_10026168 Ga0213872_100261682 83
15 3300039447 Ga0436361_0084823 Ga0436361_0084823_2518_2829 83
16 3300049581 Ga0501047_0294586 Ga0501047_0294586_732_1049 83
17 3300049583 Ga0501067_0064735 Ga0501067_0064735_145_462 83
18 3300049583 Ga0501067_0185373 Ga0501067_0185373_617_934 83
19 3300049588 Ga0501072_0806440 Ga0501072_0806440_34_351 83
20 3300049742 Ga0501080_0036160 Ga0501080_0036160_1588_1905 83
21 3300049744 Ga0501083_0014934 Ga0501083_0014934_1866_2183 83
22 3300060353 Ga0501082_0108057 Ga0501082_0108057_319_636 83
23 3300061734 Ga0530510_1484072 Ga0530510_1484072_151_492 83
24 3300049581 Ga0501047_0005776 Ga0501047_0005776_8983_9300 84
25 3300005334 Ga0068869_100765431 Ga0068869_1007654312 85
26 3300006881 Ga0068865_100780446 Ga0068865_1007804462 85
27 3300013308 Ga0157375_11981264 Ga0157375_119812642 85
28 3300017792 Ga0163161_10870637 Ga0163161_108706372 85
29 3300025299 Ga0209256_1019646 Ga0209256_10196462 85
30 3300025942 Ga0207689_10757909 Ga0207689_107579092 85
31 3300005563 Ga0068855_102046597 Ga0068855_1020465971 86
32 3300009177 Ga0105248_12948753 Ga0105248_129487532 86
33 3300028381 Ga0268264_12120785 Ga0268264_121207852 86
34 3300005333 Ga0070677_10002044 Ga0070677_100020446 87
35 3300005530 Ga0070679_101182809 Ga0070679_1011828092 87
36 3300025893 Ga0207682_10029282 Ga0207682_100292823 87
37 3300041460 Ga0451802_1634235 Ga0451802_1634235_275_559 87
38 3300049571 Ga0501034_0566994 Ga0501034_0566994_700_1005 87
39 3300049580 Ga0501046_0216691 Ga0501046_0216691_929_1276 87
40 iso_pu_bacteria 2643221614 2644088746 87
41 iso_pu_bacteria 2643221661 2644343981 87
42 iso_pu_bacteria 2643221666 2644368540 87
43 3300005331 Ga0070670_100671437 Ga0070670_1006714372 88
44 3300005337 Ga0070682_100094836 Ga0070682_1000948362 88
45 3300005338 Ga0068868_100311287 Ga0068868_1003112872 88
46 3300005347 Ga0070668_100189800 Ga0070668_1001898002 88
47 3300005356 Ga0070674_100110438 Ga0070674_1001104382 88
48 3300005366 Ga0070659_100700370 Ga0070659_1007003701 88
49 3300005435 Ga0070714_101578447 Ga0070714_1015784471 88
50 3300005456 Ga0070678_101598690 Ga0070678_1015986902 88
51 3300005457 Ga0070662_100247939 Ga0070662_1002479392 88
52 3300005539 Ga0068853_101715302 Ga0068853_1017153021 88
53 3300005543 Ga0070672_100582914 Ga0070672_1005829142 88
54 3300005547 Ga0070693_100659011 Ga0070693_1006590111 88
55 3300005548 Ga0070665_100460571 Ga0070665_1004605712 88
56 3300005563 Ga0068855_101213811 Ga0068855_1012138112 88
57 3300005577 Ga0068857_101662244 Ga0068857_1016622442 88
58 3300005578 Ga0068854_100821464 Ga0068854_1008214642 88
59 3300005614 Ga0068856_100339400 Ga0068856_1003394002 88
60 3300005615 Ga0070702_101293680 Ga0070702_1012936802 88
61 3300005616 Ga0068852_100392431 Ga0068852_1003924312 88
62 3300005617 Ga0068859_100412550 Ga0068859_1004125502 88
63 3300005618 Ga0068864_100261655 Ga0068864_1002616552 88
64 3300005718 Ga0068866_10067413 Ga0068866_100674132 88
65 3300005719 Ga0068861_101094280 Ga0068861_1010942802 88
66 3300005841 Ga0068863_100343150 Ga0068863_1003431502 88
67 3300005842 Ga0068858_100226494 Ga0068858_1002264942 88
68 3300005843 Ga0068860_100256432 Ga0068860_1002564322 88
69 3300005844 Ga0068862_101305317 Ga0068862_1013053172 88
70 3300006844 Ga0075428_100165545 Ga0075428_1001655453 88
71 3300006880 Ga0075429_101347481 Ga0075429_1013474812 88
72 3300006931 Ga0097620_100412550 Ga0097620_1004125502 88
73 3300009094 Ga0111539_11054904 Ga0111539_110549042 88
74 3300009101 Ga0105247_10092648 Ga0105247_100926482 88
75 3300009148 Ga0105243_10453249 Ga0105243_104532492 88
76 3300009177 Ga0105248_11457737 Ga0105248_114577371 88
77 3300009553 Ga0105249_11641082 Ga0105249_116410821 88
78 3300011119 Ga0105246_10172648 Ga0105246_101726482 88
79 3300013306 Ga0163162_11414149 Ga0163162_114141492 88
80 3300013308 Ga0157375_12312232 Ga0157375_123122322 88
81 3300014325 Ga0163163_10510478 Ga0163163_105104782 88
82 3300014326 Ga0157380_10759747 Ga0157380_107597472 88
83 3300014497 Ga0182008_10198493 Ga0182008_101984932 88
84 3300015690 Ga0183363_1007 Ga0183363_1007237 88
85 3300025899 Ga0207642_10205224 Ga0207642_102052242 88
86 3300025908 Ga0207643_10306199 Ga0207643_103061992 88
87 3300025925 Ga0207650_10463635 Ga0207650_104636352 88
88 3300025937 Ga0207669_10185512 Ga0207669_101855122 88
89 3300025940 Ga0207691_11651874 Ga0207691_116518742 88
90 3300025949 Ga0207667_12201849 Ga0207667_122018491 88
91 3300025961 Ga0207712_10312284 Ga0207712_103122842 88
92 3300025972 Ga0207668_10337589 Ga0207668_103375892 88
93 3300025981 Ga0207640_10877506 Ga0207640_108775062 88
94 3300026023 Ga0207677_10387456 Ga0207677_103874562 88
95 3300026078 Ga0207702_11465845 Ga0207702_114658452 88
96 3300026118 Ga0207675_100966648 Ga0207675_1009666482 88
97 3300026121 Ga0207683_10159137 Ga0207683_101591372 88
98 3300026142 Ga0207698_10289052 Ga0207698_102890521 88
99 3300028380 Ga0268265_11844442 Ga0268265_118444422 88
100 3300028381 Ga0268264_10197838 Ga0268264_101978382 88
101 3300031548 Ga0307408_101685199 Ga0307408_1016851991 88
102 3300031824 Ga0307413_10974181 Ga0307413_109741812 88
103 3300031852 Ga0307410_11489822 Ga0307410_114898221 88
104 3300031903 Ga0307407_11034465 Ga0307407_110344652 88
105 3300031995 Ga0307409_100217856 Ga0307409_1002178562 88
106 3300031995 Ga0307409_101009909 Ga0307409_1010099091 88
107 3300032002 Ga0307416_100547347 Ga0307416_1005473472 88
108 3300032004 Ga0307414_10109029 Ga0307414_101090291 88
109 3300032004 Ga0307414_11230282 Ga0307414_112302822 88
110 3300032004 Ga0307414_11647076 Ga0307414_116470762 88
111 3300035121 Ga0373960_0177443 Ga0373960_0177443_228_512 88
112 3300042157 Ga0439458_0128017 Ga0439458_0128017_323_607 88
113 3300042436 Ga0439435_0107276 Ga0439435_0107276_51_335 88
114 3300042438 Ga0439459_0166554 Ga0439459_0166554_21_305 88
115 3300042439 Ga0439464_0270974 Ga0439464_0270974_256_540 88
116 3300042461 Ga0439460_0140945 Ga0439460_0140945_357_641 88
117 3300044683 Ga0466965_0905124 Ga0466965_0905124_125_409 88
118 3300044694 Ga0466963_0359524 Ga0466963_0359524_198_482 88
119 3300044719 Ga0466971_0342771 Ga0466971_0342771_243_527 88
120 3300046455 Ga0495603_0287051 Ga0495603_0287051_22_306 88
121 3300048904 Ga0496101_0799666 Ga0496101_0799666_240_524 88
122 3300048908 Ga0496105_1157160 Ga0496105_1157160_260_544 88
123 3300048911 Ga0496108_0082876 Ga0496108_0082876_983_1267 88
124 3300048911 Ga0496108_0519889 Ga0496108_0519889_699_983 88
125 3300048912 Ga0496109_0373430 Ga0496109_0373430_699_983 88
126 3300048912 Ga0496109_0706476 Ga0496109_0706476_403_687 88
127 3300048914 Ga0496111_0490153 Ga0496111_0490153_442_726 88
128 3300048918 Ga0496115_0864129 Ga0496115_0864129_389_673 88
129 3300049592 Ga0501076_1424273 Ga0501076_1424273_278_556 88
130 3300050508 nmdc:mga09592_969162_c1 nmdc:mga09592_969162_c1_271_555 88
131 3300050511 nmdc:mga08y16_1893262_c1 nmdc:mga08y16_1893262_c1_172_456 88
132 3300059652 Ga0587107_135290 Ga0587107_135290_150_434 88
133 3300049580 Ga0501046_0137552 Ga0501046_0137552_1538_1834 89
134 3300049582 Ga0501048_0640509 Ga0501048_0640509_331_627 89
135 3300049823 Ga0501044_1313721 Ga0501044_1313721_10_306 89
136 3300053087 Ga0500643_189860 Ga0500643_189860_111_407 89
137 3300053156 Ga0500622_0128280 Ga0500622_0128280_197_493 89
138 iso_pu_bacteria 2643221588 2643949798 89
139 iso_pu_bacteria 2643221672 2644397081 89
140 iso_pu_bacteria 2857564685 2857566330 89
141 3300005344 Ga0070661_100000165 Ga0070661_10000016564 90
142 3300009093 Ga0105240_10234864 Ga0105240_102348642 90
143 3300014968 Ga0157379_11995690 Ga0157379_119956902 90
144 3300025913 Ga0207695_10128177 Ga0207695_101281772 90
145 3300025920 Ga0207649_10000790 Ga0207649_1000079016 90
146 3300025920 Ga0207649_10823702 Ga0207649_108237022 90
147 3300031250 Ga0265331_10000193 Ga0265331_100001937 90
148 3300031711 Ga0265314_10075763 Ga0265314_100757632 90
149 3300031711 Ga0265314_10633292 Ga0265314_106332921 90
150 3300044842 Ga0466957_0805238 Ga0466957_0805238_198_521 90
151 3300044901 Ga0466960_0706702 Ga0466960_0706702_122_412 90
152 3300049571 Ga0501034_0281233 Ga0501034_0281233_579_881 90
153 3300049571 Ga0501034_0801939 Ga0501034_0801939_28_330 90
154 3300049572 Ga0501036_0050128 Ga0501036_0050128_2983_3285 90
155 3300049579 Ga0501043_1218259 Ga0501043_1218259_124_426 90
156 3300049580 Ga0501046_0017754 Ga0501046_0017754_2204_2506 90
157 3300049822 Ga0501035_0113608 Ga0501035_0113608_41_343 90
158 3300049823 Ga0501044_0591063 Ga0501044_0591063_531_833 90
159 3300053121 Ga0500607_085787 Ga0500607_085787_1223_1501 90
160 3300053136 Ga0500559_0023386 Ga0500559_0023386_850_1128 90
161 3300053136 Ga0500559_0079391 Ga0500559_0079391_1169_1447 90
162 3300053138 Ga0500564_205247 Ga0500564_205247_266_544 90
163 3300053148 Ga0500590_335546 Ga0500590_335546_217_495 90
164 3300053178 Ga0500637_0148949 Ga0500637_0148949_42_320 90
165 3300053730 Ga0500645_043680 Ga0500645_043680_25_303 90
166 3300060353 Ga0501082_0373990 Ga0501082_0373990_180_482 90
167 3300005336 Ga0070680_101763574 Ga0070680_1017635742 91
168 3300005337 Ga0070682_101044013 Ga0070682_1010440132 91
169 3300005339 Ga0070660_100027995 Ga0070660_1000279957 91
170 3300005341 Ga0070691_10021856 Ga0070691_100218564 91
171 3300005563 Ga0068855_100017926 Ga0068855_10001792611 91
172 3300009551 Ga0105238_12904679 Ga0105238_129046792 91
173 3300013100 Ga0157373_10198674 Ga0157373_101986742 91
174 3300013102 Ga0157371_10256956 Ga0157371_102569562 91
175 3300013307 Ga0157372_10726619 Ga0157372_107266192 91
176 3300025909 Ga0207705_10000159 Ga0207705_1000015973 91
177 3300025912 Ga0207707_10078856 Ga0207707_100788562 91
178 3300025917 Ga0207660_10345229 Ga0207660_103452292 91
179 3300025921 Ga0207652_10001571 Ga0207652_1000157113 91
180 3300025932 Ga0207690_10104844 Ga0207690_101048442 91
181 3300025949 Ga0207667_10064337 Ga0207667_100643375 91
182 3300041413 Ga0439465_0360472 Ga0439465_0360472_32_334 91
183 3300046472 Ga0495580_0224719 Ga0495580_0224719_668_973 91
184 3300049593 Ga0501077_0952786 Ga0501077_0952786_67_378 91
185 3300053153 Ga0500616_0011723 Ga0500616_0011723_282_602 91
186 3300059511 Ga0587091_116984 Ga0587091_116984_107_400 91
187 iso_pu_bacteria 2928027323 2928029456 91
188 iso_pu_bacteria 2984555340 2984556972 91
189 iso_pu_bacteria 2984564862 2984568721 91
190 iso_pu_bacteria 2993356040 2993359712 91
191 3300002739 JGI25158J39367_1004695 JGI25158J39367_10046952 92
192 3300003354 JGI25160J50197_1014825 JGI25160J50197_10148252 92
193 3300005456 Ga0070678_101189287 Ga0070678_1011892872 92
194 3300005545 Ga0070695_101309415 Ga0070695_1013094152 92
195 3300025913 Ga0207695_10007642 Ga0207695_100076424 92
196 3300025914 Ga0207671_10308113 Ga0207671_103081132 92
197 3300025916 Ga0207663_10444127 Ga0207663_104441271 92
198 3300026078 Ga0207702_10979038 Ga0207702_109790382 92
199 3300026121 Ga0207683_10912072 Ga0207683_109120722 92
200 3300038742 Ga0400486_21634 Ga0400486_21634_424_834 92
201 3300046507 Ga0495606_0009363 Ga0495606_0009363_4901_5236 92
202 3300046512 Ga0495610_0000534 Ga0495610_0000534_37692_38027 92
203 3300046518 Ga0495631_0140532 Ga0495631_0140532_454_789 92
204 3300047320 Ga0495672_0008327 Ga0495672_0008327_2225_2560 92
205 3300048091 Ga0495626_0004263 Ga0495626_0004263_8363_8668 92
206 3300049533 Ga0501317_027719 Ga0501317_027719_72_350 92
207 3300049571 Ga0501034_1456592 Ga0501034_1456592_38_316 92
208 3300049744 Ga0501083_0306464 Ga0501083_0306464_148_456 92
209 3300053086 Ga0500578_0468243 Ga0500578_0468243_89_424 92
210 3300053116 Ga0500592_023533 Ga0500592_023533_288_566 92
211 3300001979 JGI24740J21852_10000132 JGI24740J21852_100001326 93
212 3300001979 JGI24740J21852_10012538 JGI24740J21852_100125383 93
213 3300001989 JGI24739J22299_10018932 JGI24739J22299_100189322 93
214 3300002067 JGI24735J21928_10003435 JGI24735J21928_100034356 93
215 3300005329 Ga0070683_101118690 Ga0070683_1011186902 93
216 3300005336 Ga0070680_100235285 Ga0070680_1002352852 93
217 3300005337 Ga0070682_100015631 Ga0070682_1000156316 93
218 3300005345 Ga0070692_10750556 Ga0070692_107505562 93
219 3300005347 Ga0070668_101680216 Ga0070668_1016802162 93
220 3300005354 Ga0070675_100017370 Ga0070675_1000173702 93
221 3300005455 Ga0070663_100171718 Ga0070663_1001717182 93
222 3300005457 Ga0070662_100083429 Ga0070662_1000834292 93
223 3300005458 Ga0070681_10600922 Ga0070681_106009222 93
224 3300005471 Ga0070698_101308758 Ga0070698_1013087582 93
225 3300005530 Ga0070679_100708185 Ga0070679_1007081851 93
226 3300005539 Ga0068853_100033503 Ga0068853_1000335033 93
227 3300005544 Ga0070686_100000284 Ga0070686_10000028426 93
228 3300005563 Ga0068855_100607662 Ga0068855_1006076622 93
229 3300005563 Ga0068855_101849395 Ga0068855_1018493952 93
230 3300005577 Ga0068857_100048220 Ga0068857_1000482202 93
231 3300005841 Ga0068863_101110176 Ga0068863_1011101762 93
232 3300006051 Ga0075364_10006257 Ga0075364_100062579 93
233 3300006186 Ga0075369_10033195 Ga0075369_100331952 93
234 3300006353 Ga0075370_10003552 Ga0075370_100035524 93
235 3300009098 Ga0105245_10799101 Ga0105245_107991011 93
236 3300009098 Ga0105245_12435666 Ga0105245_124356662 93
237 3300009176 Ga0105242_12916234 Ga0105242_129162341 93
238 3300013102 Ga0157371_10052609 Ga0157371_100526092 93
239 3300014969 Ga0157376_10996029 Ga0157376_109960292 93
240 3300025893 Ga0207682_10353522 Ga0207682_103535222 93
241 3300025912 Ga0207707_10039795 Ga0207707_100397952 93
242 3300025919 Ga0207657_11415036 Ga0207657_114150362 93
243 3300025926 Ga0207659_10103565 Ga0207659_101035652 93
244 3300025945 Ga0207679_10107284 Ga0207679_101072842 93
245 3300025949 Ga0207667_10232699 Ga0207667_102326992 93
246 3300025972 Ga0207668_11001457 Ga0207668_110014572 93
247 3300026041 Ga0207639_10105895 Ga0207639_101058952 93
248 3300026067 Ga0207678_10001802 Ga0207678_1000180211 93
249 3300026116 Ga0207674_10013676 Ga0207674_1001367610 93
250 3300031456 Ga0307513_10034448 Ga0307513_100344483 93
251 3300031852 Ga0307410_12056364 Ga0307410_120563642 93
252 3300031995 Ga0307409_100161319 Ga0307409_1001613194 93
253 3300032004 Ga0307414_11002021 Ga0307414_110020212 93
254 3300037471 Ga0395905_0287217 Ga0395905_0287217_985_1266 93
255 3300038443 Ga0395901_0425473 Ga0395901_0425473_298_582 93
256 3300041451 Ga0451791_1532159 Ga0451791_1532159_246_545 93
257 3300041492 Ga0451835_0380692 Ga0451835_0380692_656_937 93
258 3300041511 Ga0451855_0733954 Ga0451855_0733954_230_511 93
259 3300041512 Ga0451853_1585237 Ga0451853_1585237_1002_1283 93
260 3300042015 Ga0439462_0003188 Ga0439462_0003188_1878_2159 93
261 3300046794 Ga0495589_0006154 Ga0495589_0006154_694_1017 93
262 3300049578 Ga0501042_1245231 Ga0501042_1245231_26_307 93
263 3300049583 Ga0501067_0017338 Ga0501067_0017338_1085_1423 93
264 3300049585 Ga0501069_0248209 Ga0501069_0248209_608_946 93
265 3300049589 Ga0501073_0032603 Ga0501073_0032603_1331_1669 93
266 3300049590 Ga0501074_0020416 Ga0501074_0020416_1010_1348 93
267 3300049742 Ga0501080_0435552 Ga0501080_0435552_360_698 93
268 3300049744 Ga0501083_0023711 Ga0501083_0023711_2716_3054 93
269 3300050491 nmdc:mga00v17_4911_c1 nmdc:mga00v17_4911_c1_6284_6565 93
270 3300050493 nmdc:mga0k408_73827_c1 nmdc:mga0k408_73827_c1_490_813 93
271 3300050496 nmdc:mga07m45_98643_c1 nmdc:mga07m45_98643_c1_495_776 93
272 3300050496 nmdc:mga07m45_99792_c1 nmdc:mga07m45_99792_c1_503_784 93
273 3300050516 nmdc:mga0sz30_33634_c1 nmdc:mga0sz30_33634_c1_973_1254 93
274 3300053087 Ga0500643_006134 Ga0500643_006134_4014_4295 93
275 3300053094 Ga0500566_0001217 Ga0500566_0001217_6296_6589 93
276 3300053139 Ga0500568_0002985 Ga0500568_0002985_1196_1477 93
277 3300053153 Ga0500616_0000101 Ga0500616_0000101_29519_29800 93
278 3300054114 Ga0501084_0126076 Ga0501084_0126076_461_799 93
279 3300054114 Ga0501084_1639174 Ga0501084_1639174_90_485 93
280 3300060353 Ga0501082_0006870 Ga0501082_0006870_5595_5933 93
281 3300005614 Ga0068856_100015151 Ga0068856_1000151512 94
282 3300005616 Ga0068852_102369470 Ga0068852_1023694702 94
283 3300013102 Ga0157371_10007335 Ga0157371_100073355 94
284 3300025921 Ga0207652_10660338 Ga0207652_106603382 94
285 3300025981 Ga0207640_10510352 Ga0207640_105103522 94
286 3300031901 Ga0307406_10031035 Ga0307406_100310352 94
287 3300032004 Ga0307414_10070622 Ga0307414_100706223 94
288 3300036647 Ga0316582_1033126 Ga0316582_1033126_216_500 94
289 3300036712 Ga0316584_0326898 Ga0316584_0326898_748_1032 94
290 2162886007 SwRhRL2b_contig_510765 SwRhRL2b_0873.00004840 95
291 3300005289 Ga0065704_10126700 Ga0065704_101267002 95
292 3300005293 Ga0065715_10167043 Ga0065715_101670431 95
293 3300005295 Ga0065707_10137904 Ga0065707_101379042 95
294 3300005331 Ga0070670_100323379 Ga0070670_1003233792 95
295 3300005354 Ga0070675_100014713 Ga0070675_1000147134 95
296 3300005355 Ga0070671_100309734 Ga0070671_1003097342 95
297 3300005564 Ga0070664_101070673 Ga0070664_1010706732 95
298 3300005615 Ga0070702_101040006 Ga0070702_1010400062 95
299 3300009553 Ga0105249_10000106 Ga0105249_10000106118 95
300 3300009553 Ga0105249_10671664 Ga0105249_106716641 95
301 3300013306 Ga0163162_10060951 Ga0163162_100609515 95
302 3300013308 Ga0157375_12721207 Ga0157375_127212071 95
303 3300014968 Ga0157379_10196769 Ga0157379_101967692 95
304 3300025903 Ga0207680_10670174 Ga0207680_106701742 95
305 3300025925 Ga0207650_10602307 Ga0207650_106023072 95
306 3300025926 Ga0207659_10014957 Ga0207659_100149572 95
307 3300025931 Ga0207644_10766949 Ga0207644_107669492 95
308 3300025940 Ga0207691_10038762 Ga0207691_100387621 95
309 3300025961 Ga0207712_10000593 Ga0207712_1000059325 95
310 3300025961 Ga0207712_10446978 Ga0207712_104469782 95
311 3300026035 Ga0207703_10021904 Ga0207703_100219042 95
312 3300026121 Ga0207683_11067222 Ga0207683_110672222 95
313 3300031456 Ga0307513_10062187 Ga0307513_100621872 95
314 3300031824 Ga0307413_10021740 Ga0307413_100217402 95
315 3300031824 Ga0307413_11862175 Ga0307413_118621751 95
316 3300031852 Ga0307410_10007528 Ga0307410_100075282 95
317 3300031903 Ga0307407_10681783 Ga0307407_106817832 95
318 3300031995 Ga0307409_100396373 Ga0307409_1003963732 95
319 3300032002 Ga0307416_103473222 Ga0307416_1034732221 95
320 3300032004 Ga0307414_10048240 Ga0307414_100482402 95
321 3300032004 Ga0307414_10403050 Ga0307414_104030502 95
322 3300032005 Ga0307411_10113535 Ga0307411_101135352 95
323 3300032005 Ga0307411_11131927 Ga0307411_111319271 95
324 3300032005 Ga0307411_11902175 Ga0307411_119021752 95
325 3300041486 Ga0451807_0048526 Ga0451807_0048526_147_449 95
326 3300041512 Ga0451853_1309178 Ga0451853_1309178_508_813 95
327 3300046684 Ga0495669_0265887 Ga0495669_0265887_405_695 95
328 3300047445 Ga0495677_0134998 Ga0495677_0134998_203_493 95
329 3300048912 Ga0496109_0270782 Ga0496109_0270782_292_582 95
330 3300048913 Ga0496110_0115155 Ga0496110_0115155_325_615 95
331 3300048917 Ga0496114_0768036 Ga0496114_0768036_434_793 95
332 3300049513 Ga0501290_002478 Ga0501290_002478_997_1284 95
333 3300049515 Ga0501292_002926 Ga0501292_002926_1139_1426 95
334 3300049517 Ga0501294_002147 Ga0501294_002147_674_961 95
335 3300049523 Ga0501300_033488 Ga0501300_033488_290_577 95
336 3300049662 Ga0501222_010113 Ga0501222_010113_47_334 95
337 3300049662 Ga0501222_069270 Ga0501222_069270_213_500 95
338 3300049663 Ga0501223_008831 Ga0501223_008831_843_1130 95
339 3300049668 Ga0501233_028574 Ga0501233_028574_355_642 95
340 3300049669 Ga0501235_010549 Ga0501235_010549_913_1200 95
341 3300049686 Ga0501257_036664 Ga0501257_036664_299_586 95
342 3300049688 Ga0501259_010579 Ga0501259_010579_341_628 95
343 3300049690 Ga0501261_002874 Ga0501261_002874_700_987 95
344 3300049704 Ga0501221_015764 Ga0501221_015764_545_832 95
345 3300049775 Ga0501279_000182 Ga0501279_000182_7375_7662 95
346 3300049776 Ga0501280_004298 Ga0501280_004298_934_1221 95
347 3300049778 Ga0501282_000324 Ga0501282_000324_999_1286 95
348 3300049779 Ga0501283_008748 Ga0501283_008748_828_1115 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12769

PNTB_4TM

4TM region of pyridine nucleotide transhydrogenase, mitoch

10

103

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ffd-assembly1.cif.gz_A copm in the ag-bound form (by co-crystallization) 0.9108 31 76
5fej-assembly2.cif.gz_B copm in the cu(i)-bound form 0.9038 31 76
5ffc-assembly1.cif.gz_A copm in the cu(ii)-bound form 0.8252 33 76
2ic6-assembly2.cif.gz_B the coiled-coil domain (residues 1-75) structure of the sin nombre virus nucleocapsid protein 0.8135 31 92
7q21-assembly1.cif.gz_k iii2-iv2 respiratory supercomplex from corynebacterium glutamicum 0.8073 33 84
ID Description Score Start End Superfamily
5ffdA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9105 31 76 1.20.1260.10
5fejA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9086 31 76 1.20.1260.10
af_I1KLR6_11_546_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8827 33 73 1.25.10.10
af_Q2FX96_176_237_1.20.5.1930 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.8748 37 79 1.20.5.1930
af_Q5N7Y5_177_268_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8714 37 82 1.20.58.160
ID Description Score Start End GO Terms
AF-A0A1F6DB04-F1-model_v4 Uncharacterized protein 0.8892 27 87 GO:0016020
AF-A0A6L5XVB0-F1-model_v4 Uncharacterized protein 0.8535 27 90
AF-A0A812Q2C0-F1-model_v4 DUF202 domain-containing protein 0.8324 30 94 GO:0016020
AF-F8C4K4-F1-model_v4 Histidine kinase HAMP region domain protein 0.8288 31 92 GO:0016020
GO:0016301
AF-A0A2E2UXA5-F1-model_v4 Uncharacterized protein 0.8269 27 94 GO:0016020

Feature Viewer

pLDDT pTM Quality
80.73 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map