F417201

General Info

Members Datasets Scaffolds Average Seq Length
347 236 694 156

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100564703|Ga0307408_1005647032
Length 183
Sequence MGWRNIYGASPAAPHRSHLHEAPTGGQRSAMDIVEGGLDDPRVVELLHTHLTRARSETARGSEHALDLSGLRAPEVAFWSVWEGEAVLGIGALRRLSADHGELKSMHTAEAARGRGVGSAMLRHIVAVARARGMARLSLETGSWAYFAPARAMYARHGFVECGPFGEYRDDPNSVFMTLELER

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
117 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
118 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
119 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
129 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
233 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
234 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
235 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
236 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0.29
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 1.15
Rhizoplane 6.63
Rhizosphere 85.59
Stem 0
Stem Tuber 0
Unclassified 18.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100564703 3300031548 Bacteria 1006
2 JGI25162J39368_1000725 3300002737 Bacteria 22709
3 rootH2_10081570 3300003320 Bacteria 8102
4 rootH1_10008777 3300003323 Bacteria 114505
5 Ga0055535_1027899 3300003761 Bacteria 612
6 Ga0055542_1000336 3300003762 Bacteria 50064
7 Ga0065714_10088087 3300005288 Bacteria 2032
8 Ga0065707_10674051 3300005295 Unclassified 652
9 Ga0070658_10009390 3300005327 Bacteria 7856
10 Ga0070658_10043653 3300005327 Unclassified 3621
11 Ga0070683_100836201 3300005329 Unclassified 883
12 Ga0070670_100161259 3300005331 Bacteria 1943
13 Ga0070680_100342024 3300005336 Bacteria 1271
14 Ga0070660_100831576 3300005339 Bacteria 777
15 Ga0070689_100004940 3300005340 Bacteria 9047
16 Ga0070709_10021886 3300005434 Bacteria 3731
17 Ga0070714_100086868 3300005435 Bacteria 2734
18 Ga0070714_100114857 3300005435 Bacteria 2389
19 Ga0070714_100795077 3300005435 Unclassified 916
20 Ga0070713_100010678 3300005436 Bacteria 6648
21 Ga0070713_100021541 3300005436 Bacteria 4960
22 Ga0070713_100537645 3300005436 Bacteria 1106
23 Ga0070713_101331046 3300005436 Bacteria 696
24 Ga0070711_100166629 3300005439 Bacteria 1676
25 Ga0070681_10017859 3300005458 Bacteria 7088
26 Ga0070681_10258012 3300005458 Bacteria 1655
27 Ga0070707_100021771 3300005468 Bacteria 6060
28 Ga0070698_100006016 3300005471 Bacteria 13213
29 Ga0070699_100016067 3300005518 Bacteria 6425
30 Ga0070679_101068116 3300005530 Bacteria 752
31 Ga0068853_100034312 3300005539 Bacteria 4307
32 Ga0068853_100157664 3300005539 Bacteria 2046
33 Ga0070693_100273223 3300005547 Bacteria 1129
34 Ga0070665_100301258 3300005548 Bacteria 1606
35 Ga0068855_100319183 3300005563 Bacteria 1717
36 Ga0068856_100315476 3300005614 Bacteria 1581
37 Ga0068852_100027729 3300005616 Bacteria 4620
38 Ga0068859_100000067 3300005617 Bacteria 98013
39 Ga0068859_100071844 3300005617 Bacteria 3496
40 Ga0068859_100167813 3300005617 Bacteria 2275
41 Ga0068859_100404778 3300005617 Bacteria 1461
42 Ga0068864_100173778 3300005618 Unclassified 1966
43 Ga0068864_100355861 3300005618 Bacteria 1382
44 Ga0068864_101268779 3300005618 Unclassified 736
45 Ga0068863_100000346 3300005841 Bacteria 47223
46 Ga0068863_100056964 3300005841 Bacteria 3699
47 Ga0068858_100004228 3300005842 Bacteria 14135
48 Ga0068862_100000061 3300005844 Bacteria 129972
49 Ga0068862_100214395 3300005844 Bacteria 1741
50 Ga0081539_10048276 3300005985 Unclassified 2423
51 Ga0070717_10109530 3300006028 Unclassified 2354
52 Ga0070717_10198591 3300006028 Bacteria 1756
53 Ga0070716_100671054 3300006173 Unclassified 788
54 Ga0070716_100817800 3300006173 Bacteria 723
55 Ga0070712_100101707 3300006175 Bacteria 2127
56 Ga0075428_100288294 3300006844 Bacteria 1766
57 Ga0075430_100040098 3300006846 Unclassified 3964
58 Ga0075433_10534975 3300006852 Bacteria 1031
59 Ga0075434_100108125 3300006871 Bacteria 2792
60 Ga0097620_100000067 3300006931 Bacteria 98013
61 Ga0097620_100071841 3300006931 Bacteria 3496
62 Ga0097620_100167802 3300006931 Bacteria 2275
63 Ga0097620_100404757 3300006931 Bacteria 1461
64 Ga0075435_100403088 3300007076 Bacteria 1176
65 Ga0099794_10031462 3300007265 Bacteria 2484
66 Ga0099795_10298946 3300007788 Bacteria 707
67 Ga0105240_10079913 3300009093 Bacteria 4023
68 Ga0105240_10625084 3300009093 Bacteria 1183
69 Ga0105240_10627410 3300009093 Bacteria 1180
70 Ga0105240_12394328 3300009093 Unclassified 546
71 Ga0111539_10088879 3300009094 Unclassified 3630
72 Ga0105247_10924690 3300009101 Unclassified 675
73 Ga0114129_11994473 3300009147 Unclassified 702
74 Ga0105241_10000031 3300009174 Bacteria 121342
75 Ga0105241_10242262 3300009174 Bacteria 1525
76 Ga0105248_10548985 3300009177 Bacteria 1303
77 Ga0105237_10027372 3300009545 Bacteria 5820
78 Ga0105237_10544016 3300009545 Bacteria 1168
79 Ga0105238_10043740 3300009551 Bacteria 4531
80 Ga0105249_10000990 3300009553 Bacteria 25194
81 Ga0099796_10089756 3300010159 Bacteria 1141
82 Ga0105246_11730722 3300011119 Unclassified 595
83 Ga0157373_10043557 3300013100 Bacteria 3206
84 Ga0157371_10004472 3300013102 Bacteria 12193
85 Ga0157371_10496652 3300013102 Unclassified 901
86 Ga0157370_10844966 3300013104 Bacteria 832
87 Ga0157369_10034942 3300013105 Bacteria 5512
88 Ga0157369_10144244 3300013105 Bacteria 2518
89 Ga0157369_10194023 3300013105 Bacteria 2133
90 Ga0157374_10284359 3300013296 Bacteria 1633
91 Ga0157374_11137161 3300013296 Unclassified 802
92 Ga0163162_10533449 3300013306 Bacteria 1303
93 Ga0157372_10076618 3300013307 Bacteria 3776
94 Ga0157372_10182241 3300013307 Bacteria 2431
95 Ga0157372_10219127 3300013307 Bacteria 2206
96 Ga0157372_11409649 3300013307 Bacteria 803
97 Ga0163163_10000002 3300014325 Bacteria 609846
98 Ga0163163_10008690 3300014325 Bacteria 9033
99 Ga0163163_10084637 3300014325 Bacteria 3178
100 Ga0157380_10275211 3300014326 Unclassified 1537
101 Ga0157379_10226902 3300014968 Bacteria 1693
102 Ga0157379_10342511 3300014968 Bacteria 1367
103 Ga0157379_10858283 3300014968 Unclassified 859
104 Ga0157376_10046972 3300014969 Bacteria 3563
105 Ga0157376_10124923 3300014969 Unclassified 2286
106 Ga0182007_10174660 3300015262 Unclassified 740
107 Ga0206353_10131249 3300020082 Bacteria 1245
108 Ga0214544_1029943 3300021320 Bacteria 1950
109 Ga0214542_1031605 3300021321 Bacteria 1950
110 Ga0214543_1032921 3300021327 Bacteria 1912
111 Ga0213876_10172194 3300021384 Bacteria 1152
112 Ga0213875_10000135 3300021388 Bacteria 82147
113 Ga0207427_101117 3300025231 Bacteria 10732
114 Ga0209437_100076 3300025233 Bacteria 295194
115 Ga0209258_102452 3300025242 Bacteria 4777
116 Ga0209148_1000002 3300025254 Bacteria 2399500
117 Ga0209233_1013758 3300025261 Bacteria 2303
118 Ga0207699_10017381 3300025906 Bacteria 3783
119 Ga0207705_10045345 3300025909 Bacteria 3160
120 Ga0207705_10093423 3300025909 Bacteria 2205
121 Ga0207684_10347115 3300025910 Bacteria 1278
122 Ga0207654_10000031 3300025911 Bacteria 121592
123 Ga0207707_10082629 3300025912 Bacteria 2804
124 Ga0207695_10028548 3300025913 Bacteria 6184
125 Ga0207695_10225422 3300025913 Unclassified 1781
126 Ga0207671_10080357 3300025914 Unclassified 2444
127 Ga0207671_10614856 3300025914 Bacteria 866
128 Ga0207660_11137983 3300025917 Bacteria 636
129 Ga0207657_10418445 3300025919 Unclassified 1053
130 Ga0207657_10668829 3300025919 Bacteria 808
131 Ga0207652_10843405 3300025921 Bacteria 812
132 Ga0207646_10012220 3300025922 Bacteria 8261
133 Ga0207694_11142233 3300025924 Unclassified 659
134 Ga0207700_10011099 3300025928 Bacteria 5729
135 Ga0207664_10084247 3300025929 Bacteria 2593
136 Ga0207664_10131478 3300025929 Bacteria 2107
137 Ga0207664_10395964 3300025929 Bacteria 1228
138 Ga0207670_10004460 3300025936 Bacteria 7540
139 Ga0207667_10184517 3300025949 Bacteria 2142
140 Ga0207712_10003760 3300025961 Bacteria 9583
141 Ga0207640_10886295 3300025981 Unclassified 778
142 Ga0207703_10005042 3300026035 Bacteria 10701
143 Ga0207639_10562064 3300026041 Bacteria 1048
144 Ga0207678_10039693 3300026067 Bacteria 4084
145 Ga0207641_10007741 3300026088 Bacteria 8928
146 Ga0207641_10115268 3300026088 Viruses 2389
147 Ga0207676_10094184 3300026095 Unclassified 2467
148 Ga0207676_10169181 3300026095 Unclassified 1902
149 Ga0209588_1018924 3300027671 Bacteria 2146
150 Ga0268265_10000033 3300028380 Bacteria 223950
151 Ga0268264_10069000 3300028381 Bacteria 2989
152 Ga0265334_10012611 3300028573 Bacteria 3549
153 Ga0265320_10270277 3300031240 Bacteria 753
154 Ga0265316_10101105 3300031344 Bacteria 2191
155 Ga0307408_100282828 3300031548 Bacteria 1382
156 Ga0307413_10545274 3300031824 Bacteria 940
157 Ga0307406_10586399 3300031901 Unclassified 917
158 Ga0307412_10097793 3300031911 Bacteria 2069
159 Ga0307416_100318363 3300032002 Unclassified 1556
160 Ga0307414_10186198 3300032004 Bacteria 1675
161 Ga0307415_100148667 3300032126 Unclassified 1800
162 Ga0307415_100360112 3300032126 Bacteria 1228
163 Ga0373930_0030356 3300034816 Unclassified 1109
164 Ga0373926_0003476 3300035083 Bacteria 5088
165 Ga0373929_0031806 3300035085 Unclassified 1132
166 Ga0373934_0138334 3300035086 Unclassified 995
167 Ga0373940_0008291 3300035088 Unclassified 2378
168 Ga0373932_0056270 3300035112 Bacteria 1182
169 Ga0373932_0144874 3300035112 Unclassified 811
170 Ga0373936_0246105 3300035113 Bacteria 798
171 Ga0373953_0003059 3300035117 Bacteria 5137
172 Ga0373956_0403415 3300035119 Bacteria 652
173 Ga0373957_0101744 3300035120 Bacteria 1151
174 Ga0373955_0007565 3300035172 Bacteria 5000
175 Ga0373942_0079045 3300035207 Unclassified 973
176 Ga0373961_0156632 3300035241 Bacteria 780
177 Ga0373962_0128379 3300035242 Bacteria 814
178 Ga0373924_0005046 3300035410 Bacteria 4647
179 Ga0373924_0453269 3300035410 Unclassified 575
180 Ga0373931_0066426 3300035691 Bacteria 1957
181 Ga0373931_0130420 3300035691 Bacteria 1446
182 Ga0373935_0013153 3300035692 Unclassified 4989
183 Ga0373935_0392823 3300035692 Bacteria 995
184 Ga0373927_0051349 3300035695 Bacteria 2666
185 Ga0373933_0007728 3300035724 Bacteria 5871
186 Ga0373947_0027340 3300035725 Bacteria 3339
187 Ga0373947_0065288 3300035725 Bacteria 2220
188 Ga0373947_0073049 3300035725 Bacteria 2107
189 Ga0373937_0005533 3300036401 Bacteria 10832
190 Ga0373937_0558507 3300036401 Unclassified 1087
191 Ga0373925_0014813 3300037068 Bacteria 5636
192 Ga0373925_0239608 3300037068 Unclassified 1452
193 Ga0373925_0677283 3300037068 Bacteria 850
194 Ga0395905_0209251 3300037471 Bacteria 1828
195 Ga0436364_0986946 3300037853 Bacteria 208509
196 Ga0395901_0237510 3300038443 Bacteria 1902
197 Ga0242420_052224 3300038996 Bacteria 801
198 Ga0436360_0457071 3300039438 Unclassified 2018
199 Ga0439445_0038891 3300042004 Bacteria 1259
200 Ga0466961_0500074 3300044693 Unclassified 734
201 Ga0466958_0214639 3300045836 Unclassified 1227
202 Ga0495592_0004826 3300046454 Bacteria 9913
203 Ga0495592_0035049 3300046454 Bacteria 3782
204 Ga0495629_0002961 3300046459 Bacteria 12929
205 Ga0495638_0000104 3300046460 Bacteria 135059
206 Ga0495651_0000521 3300046462 Bacteria 29890
207 Ga0495651_0000655 3300046462 Bacteria 26780
208 Ga0495651_0356835 3300046462 Unclassified 964
209 Ga0495653_0002222 3300046463 Bacteria 15345
210 Ga0495653_0006073 3300046463 Bacteria 9894
211 Ga0495653_0102166 3300046463 Bacteria 2075
212 Ga0495650_0000242 3300046471 Bacteria 108533
213 Ga0495582_0044689 3300046473 Bacteria 2440
214 Ga0495582_0129986 3300046473 Bacteria 1422
215 Ga0495662_0044924 3300046476 Bacteria 2133
216 Ga0495664_0018822 3300046477 Bacteria 3963
217 Ga0495594_0072995 3300046499 Bacteria 1909
218 Ga0495608_0098717 3300046511 Bacteria 1884
219 Ga0495608_0175527 3300046511 Unclassified 1357
220 Ga0495616_0000010 3300046513 Bacteria 224378
221 Ga0495618_0001676 3300046514 Bacteria 14715
222 Ga0495618_0603934 3300046514 Bacteria 653
223 Ga0495628_0000599 3300046516 Bacteria 33143
224 Ga0495628_0102421 3300046516 Unclassified 2209
225 Ga0495628_0153665 3300046516 Bacteria 1752
226 Ga0495630_0022446 3300046517 Bacteria 4661
227 Ga0495630_0284399 3300046517 Bacteria 1263
228 Ga0495648_0019030 3300046524 Bacteria 4843
229 Ga0495666_0251941 3300046526 Bacteria 804
230 Ga0495652_0000815 3300046529 Bacteria 35951
231 Ga0495652_0029334 3300046529 Unclassified 4834
232 Ga0495652_0373681 3300046529 Bacteria 1015
233 Ga0495665_0001199 3300046531 Bacteria 13813
234 Ga0495640_0010157 3300046533 Bacteria 7294
235 Ga0495587_0000317 3300046536 Bacteria 34274
236 Ga0495645_0005884 3300046543 Bacteria 8471
237 Ga0495645_0061616 3300046543 Bacteria 2718
238 Ga0495645_0151740 3300046543 Bacteria 1609
239 Ga0495667_0000297 3300046559 Bacteria 32051
240 Ga0495668_0004155 3300046616 Bacteria 10458
241 Ga0495635_0001603 3300046663 Bacteria 15222
242 Ga0495635_0039812 3300046663 Bacteria 3250
243 Ga0495588_0157463 3300046674 Bacteria 1201
244 Ga0495657_0020448 3300046675 Bacteria 4756
245 Ga0495657_0282246 3300046675 Unclassified 993
246 Ga0495599_0002555 3300046678 Bacteria 10600
247 Ga0495599_0054465 3300046678 Bacteria 2506
248 Ga0495599_0065423 3300046678 Bacteria 2271
249 Ga0495623_0005074 3300046679 Bacteria 8634
250 Ga0495623_0057975 3300046679 Bacteria 2435
251 Ga0495646_0452827 3300046680 Bacteria 663
252 Ga0495658_0015407 3300046683 Bacteria 3921
253 Ga0495613_0031884 3300046689 Bacteria 3914
254 Ga0495613_0052549 3300046689 Bacteria 3001
255 Ga0495613_0218253 3300046689 Unclassified 1339
256 Ga0495624_0005543 3300046690 Bacteria 9083
257 Ga0495624_0251668 3300046690 Unclassified 1068
258 Ga0495624_0519763 3300046690 Bacteria 711
259 Ga0495600_0002075 3300046809 Bacteria 11313
260 Ga0495600_0130587 3300046809 Bacteria 1633
261 Ga0495600_0445806 3300046809 Unclassified 801
262 Ga0495604_0000198 3300047317 Bacteria 54624
263 Ga0495604_0001451 3300047317 Bacteria 19471
264 Ga0495604_0002659 3300047317 Bacteria 14344
265 Ga0495674_0000953 3300047319 Bacteria 27632
266 Ga0495674_0032276 3300047319 Bacteria 4750
267 Ga0495676_0331114 3300047321 Bacteria 1021
268 Ga0495680_0000900 3300047322 Bacteria 33014
269 Ga0495680_0001692 3300047322 Bacteria 23414
270 Ga0495680_0459623 3300047322 Unclassified 870
271 Ga0495675_0000001 3300047444 Bacteria 231230
272 Ga0495675_0005391 3300047444 Bacteria 7794
273 Ga0495684_0004790 3300047471 Bacteria 10564
274 Ga0495684_0012532 3300047471 Bacteria 6535
275 Ga0495684_0093349 3300047471 Bacteria 2279
276 Ga0495684_0126757 3300047471 Bacteria 1920
277 Ga0495593_0098085 3300047673 Bacteria 1505
278 Ga0495593_0161379 3300047673 Bacteria 1131
279 Ga0495602_0002340 3300048088 Bacteria 19175
280 Ga0495602_0012048 3300048088 Bacteria 8913
281 Ga0495602_0085117 3300048088 Bacteria 2643
282 Ga0495602_0621352 3300048088 Bacteria 741
283 Ga0495614_0022632 3300048089 Unclassified 2711
284 Ga0496102_0054863 3300048905 Bacteria 3634
285 Ga0496102_0670091 3300048905 Bacteria 960
286 Ga0496102_1365947 3300048905 Unclassified 627
287 Ga0496104_0008982 3300048907 Bacteria 8888
288 Ga0496104_0080273 3300048907 Bacteria 3110
289 Ga0496104_0683861 3300048907 Unclassified 934
290 Ga0496105_0063416 3300048908 Bacteria 3049
291 Ga0496106_1245997 3300048909 Bacteria 579
292 Ga0496107_0790888 3300048910 Bacteria 695
293 Ga0496108_0080540 3300048911 Unclassified 2758
294 Ga0496108_0372510 3300048911 Bacteria 1247
295 Ga0496109_0090770 3300048912 Bacteria 2825
296 Ga0496109_0145184 3300048912 Bacteria 2220
297 Ga0496110_0002000 3300048913 Bacteria 15156
298 Ga0496111_0015961 3300048914 Bacteria 5167
299 Ga0496112_0018623 3300048915 Bacteria 6542
300 Ga0496112_0081684 3300048915 Bacteria 3196
301 Ga0496112_0740528 3300048915 Unclassified 910
302 Ga0496113_0038084 3300048916 Bacteria 3533
303 Ga0496113_0059951 3300048916 Bacteria 2867
304 Ga0496114_0336384 3300048917 Bacteria 1335
305 Ga0496115_0017271 3300048918 Bacteria 5510
306 Ga0496115_0409805 3300048918 Bacteria 1099
307 Ga0496117_0216288 3300048920 Bacteria 1070
308 Ga0496121_0006656 3300048924 Bacteria 14227
309 Ga0496125_0120976 3300048928 Bacteria 1868
310 Ga0501041_0086884 3300049577 Bacteria 1930
311 Ga0501042_1242852 3300049578 Bacteria 543
312 Ga0501067_0804586 3300049583 Unclassified 529
313 Ga0501077_0746007 3300049593 Bacteria 629
314 Ga0501257_072223 3300049686 Unclassified 883
315 Ga0501221_046893 3300049704 Bacteria 962
316 Ga0501079_0212485 3300049741 Bacteria 1511
317 Ga0501079_0460365 3300049741 Bacteria 999
318 Ga0501267_011530 3300049764 Bacteria 902
319 Ga0501045_0015441 3300049824 Bacteria 5418
320 nmdc:mga0k408_11267_c1 3300050493 Bacteria 3728
321 nmdc:mga05p37_614207_c1 3300050507 Unclassified 1225
322 nmdc:mga08y16_695698_c1 3300050511 Unclassified 1017
323 nmdc:mga0n895_220610_c1 3300050512 Bacteria 1925
324 nmdc:mga0rr50_461119_c1 3300050513 Bacteria 1078
325 nmdc:mga0rr50_982824_c1 3300050513 Bacteria 719
326 nmdc:mga0a205_732786_c1 3300050515 Bacteria 837
327 Ga0495601_0254536 3300053077 Bacteria 1146
328 Ga0495601_0635381 3300053077 Bacteria 683
329 Ga0495612_0018662 3300053078 Bacteria 2777
330 Ga0495612_0069897 3300053078 Bacteria 1463
331 Ga0495612_0224452 3300053078 Unclassified 832
332 Ga0495595_0001059 3300053084 Bacteria 10638
333 Ga0495619_0000504 3300053085 Bacteria 26022
334 Ga0495619_0236523 3300053085 Bacteria 1266
335 Ga0500627_0000446 3300053158 Bacteria 11187
336 Ga0500637_0051735 3300053178 Bacteria 2341
337 Ga0590071_001026 3300059421 Bacteria 7601
338 Ga0590074_048190 3300059423 Bacteria 776
339 Ga0590075_044545 3300059424 Bacteria 1136
340 Ga0590077_070816 3300059426 Bacteria 796
341 Ga0501082_0714017 3300060353 Bacteria 877
342 Ga0466962_0215282 3300061719 Bacteria 940
343 2824687167 2824679649 Bacteria 8248951
344 2919500921 2919497567 Bacteria 4408621
345 2922400251 2922393267 Bacteria 8285685
346 3005490982 3005483717 Bacteria 7877331
347 3005594258 3005587118 Bacteria 7794411
348 Ga0307408_100564703
349 JGI25162J39368_1000725
350 rootH2_10081570
351 rootH1_10008777
352 Ga0055535_1027899
353 Ga0055542_1000336
354 Ga0065714_10088087
355 Ga0065707_10674051
356 Ga0070658_10009390
357 Ga0070658_10043653
358 Ga0070683_100836201
359 Ga0070670_100161259
360 Ga0070680_100342024
361 Ga0070660_100831576
362 Ga0070689_100004940
363 Ga0070709_10021886
364 Ga0070714_100086868
365 Ga0070714_100114857
366 Ga0070714_100795077
367 Ga0070713_100010678
368 Ga0070713_100021541
369 Ga0070713_100537645
370 Ga0070713_101331046
371 Ga0070711_100166629
372 Ga0070681_10017859
373 Ga0070681_10258012
374 Ga0070707_100021771
375 Ga0070698_100006016
376 Ga0070699_100016067
377 Ga0070679_101068116
378 Ga0068853_100034312
379 Ga0068853_100157664
380 Ga0070693_100273223
381 Ga0070665_100301258
382 Ga0068855_100319183
383 Ga0068856_100315476
384 Ga0068852_100027729
385 Ga0068859_100000067
386 Ga0068859_100071844
387 Ga0068859_100167813
388 Ga0068859_100404778
389 Ga0068864_100173778
390 Ga0068864_100355861
391 Ga0068864_101268779
392 Ga0068863_100000346
393 Ga0068863_100056964
394 Ga0068858_100004228
395 Ga0068862_100000061
396 Ga0068862_100214395
397 Ga0081539_10048276
398 Ga0070717_10109530
399 Ga0070717_10198591
400 Ga0070716_100671054
401 Ga0070716_100817800
402 Ga0070712_100101707
403 Ga0075428_100288294
404 Ga0075430_100040098
405 Ga0075433_10534975
406 Ga0075434_100108125
407 Ga0097620_100000067
408 Ga0097620_100071841
409 Ga0097620_100167802
410 Ga0097620_100404757
411 Ga0075435_100403088
412 Ga0099794_10031462
413 Ga0099795_10298946
414 Ga0105240_10079913
415 Ga0105240_10625084
416 Ga0105240_10627410
417 Ga0105240_12394328
418 Ga0111539_10088879
419 Ga0105247_10924690
420 Ga0114129_11994473
421 Ga0105241_10000031
422 Ga0105241_10242262
423 Ga0105248_10548985
424 Ga0105237_10027372
425 Ga0105237_10544016
426 Ga0105238_10043740
427 Ga0105249_10000990
428 Ga0099796_10089756
429 Ga0105246_11730722
430 Ga0157373_10043557
431 Ga0157371_10004472
432 Ga0157371_10496652
433 Ga0157370_10844966
434 Ga0157369_10034942
435 Ga0157369_10144244
436 Ga0157369_10194023
437 Ga0157374_10284359
438 Ga0157374_11137161
439 Ga0163162_10533449
440 Ga0157372_10076618
441 Ga0157372_10182241
442 Ga0157372_10219127
443 Ga0157372_11409649
444 Ga0163163_10000002
445 Ga0163163_10008690
446 Ga0163163_10084637
447 Ga0157380_10275211
448 Ga0157379_10226902
449 Ga0157379_10342511
450 Ga0157379_10858283
451 Ga0157376_10046972
452 Ga0157376_10124923
453 Ga0182007_10174660
454 Ga0206353_10131249
455 Ga0214544_1029943
456 Ga0214542_1031605
457 Ga0214543_1032921
458 Ga0213876_10172194
459 Ga0213875_10000135
460 Ga0207427_101117
461 Ga0209437_100076
462 Ga0209258_102452
463 Ga0209148_1000002
464 Ga0209233_1013758
465 Ga0207699_10017381
466 Ga0207705_10045345
467 Ga0207705_10093423
468 Ga0207684_10347115
469 Ga0207654_10000031
470 Ga0207707_10082629
471 Ga0207695_10028548
472 Ga0207695_10225422
473 Ga0207671_10080357
474 Ga0207671_10614856
475 Ga0207660_11137983
476 Ga0207657_10418445
477 Ga0207657_10668829
478 Ga0207652_10843405
479 Ga0207646_10012220
480 Ga0207694_11142233
481 Ga0207700_10011099
482 Ga0207664_10084247
483 Ga0207664_10131478
484 Ga0207664_10395964
485 Ga0207670_10004460
486 Ga0207667_10184517
487 Ga0207712_10003760
488 Ga0207640_10886295
489 Ga0207703_10005042
490 Ga0207639_10562064
491 Ga0207678_10039693
492 Ga0207641_10007741
493 Ga0207641_10115268
494 Ga0207676_10094184
495 Ga0207676_10169181
496 Ga0209588_1018924
497 Ga0268265_10000033
498 Ga0268264_10069000
499 Ga0265334_10012611
500 Ga0265320_10270277
501 Ga0265316_10101105
502 Ga0307408_100282828
503 Ga0307413_10545274
504 Ga0307406_10586399
505 Ga0307412_10097793
506 Ga0307416_100318363
507 Ga0307414_10186198
508 Ga0307415_100148667
509 Ga0307415_100360112
510 Ga0373930_0030356
511 Ga0373926_0003476
512 Ga0373929_0031806
513 Ga0373934_0138334
514 Ga0373940_0008291
515 Ga0373932_0056270
516 Ga0373932_0144874
517 Ga0373936_0246105
518 Ga0373953_0003059
519 Ga0373956_0403415
520 Ga0373957_0101744
521 Ga0373955_0007565
522 Ga0373942_0079045
523 Ga0373961_0156632
524 Ga0373962_0128379
525 Ga0373924_0005046
526 Ga0373924_0453269
527 Ga0373931_0066426
528 Ga0373931_0130420
529 Ga0373935_0013153
530 Ga0373935_0392823
531 Ga0373927_0051349
532 Ga0373933_0007728
533 Ga0373947_0027340
534 Ga0373947_0065288
535 Ga0373947_0073049
536 Ga0373937_0005533
537 Ga0373937_0558507
538 Ga0373925_0014813
539 Ga0373925_0239608
540 Ga0373925_0677283
541 Ga0395905_0209251
542 Ga0436364_0986946
543 Ga0395901_0237510
544 Ga0242420_052224
545 Ga0436360_0457071
546 Ga0439445_0038891
547 Ga0466961_0500074
548 Ga0466958_0214639
549 Ga0495592_0004826
550 Ga0495592_0035049
551 Ga0495629_0002961
552 Ga0495638_0000104
553 Ga0495651_0000521
554 Ga0495651_0000655
555 Ga0495651_0356835
556 Ga0495653_0002222
557 Ga0495653_0006073
558 Ga0495653_0102166
559 Ga0495650_0000242
560 Ga0495582_0044689
561 Ga0495582_0129986
562 Ga0495662_0044924
563 Ga0495664_0018822
564 Ga0495594_0072995
565 Ga0495608_0098717
566 Ga0495608_0175527
567 Ga0495616_0000010
568 Ga0495618_0001676
569 Ga0495618_0603934
570 Ga0495628_0000599
571 Ga0495628_0102421
572 Ga0495628_0153665
573 Ga0495630_0022446
574 Ga0495630_0284399
575 Ga0495648_0019030
576 Ga0495666_0251941
577 Ga0495652_0000815
578 Ga0495652_0029334
579 Ga0495652_0373681
580 Ga0495665_0001199
581 Ga0495640_0010157
582 Ga0495587_0000317
583 Ga0495645_0005884
584 Ga0495645_0061616
585 Ga0495645_0151740
586 Ga0495667_0000297
587 Ga0495668_0004155
588 Ga0495635_0001603
589 Ga0495635_0039812
590 Ga0495588_0157463
591 Ga0495657_0020448
592 Ga0495657_0282246
593 Ga0495599_0002555
594 Ga0495599_0054465
595 Ga0495599_0065423
596 Ga0495623_0005074
597 Ga0495623_0057975
598 Ga0495646_0452827
599 Ga0495658_0015407
600 Ga0495613_0031884
601 Ga0495613_0052549
602 Ga0495613_0218253
603 Ga0495624_0005543
604 Ga0495624_0251668
605 Ga0495624_0519763
606 Ga0495600_0002075
607 Ga0495600_0130587
608 Ga0495600_0445806
609 Ga0495604_0000198
610 Ga0495604_0001451
611 Ga0495604_0002659
612 Ga0495674_0000953
613 Ga0495674_0032276
614 Ga0495676_0331114
615 Ga0495680_0000900
616 Ga0495680_0001692
617 Ga0495680_0459623
618 Ga0495675_0000001
619 Ga0495675_0005391
620 Ga0495684_0004790
621 Ga0495684_0012532
622 Ga0495684_0093349
623 Ga0495684_0126757
624 Ga0495593_0098085
625 Ga0495593_0161379
626 Ga0495602_0002340
627 Ga0495602_0012048
628 Ga0495602_0085117
629 Ga0495602_0621352
630 Ga0495614_0022632
631 Ga0496102_0054863
632 Ga0496102_0670091
633 Ga0496102_1365947
634 Ga0496104_0008982
635 Ga0496104_0080273
636 Ga0496104_0683861
637 Ga0496105_0063416
638 Ga0496106_1245997
639 Ga0496107_0790888
640 Ga0496108_0080540
641 Ga0496108_0372510
642 Ga0496109_0090770
643 Ga0496109_0145184
644 Ga0496110_0002000
645 Ga0496111_0015961
646 Ga0496112_0018623
647 Ga0496112_0081684
648 Ga0496112_0740528
649 Ga0496113_0038084
650 Ga0496113_0059951
651 Ga0496114_0336384
652 Ga0496115_0017271
653 Ga0496115_0409805
654 Ga0496117_0216288
655 Ga0496121_0006656
656 Ga0496125_0120976
657 Ga0501041_0086884
658 Ga0501042_1242852
659 Ga0501067_0804586
660 Ga0501077_0746007
661 Ga0501257_072223
662 Ga0501221_046893
663 Ga0501079_0212485
664 Ga0501079_0460365
665 Ga0501267_011530
666 Ga0501045_0015441
667 nmdc:mga0k408_11267_c1
668 nmdc:mga05p37_614207_c1
669 nmdc:mga08y16_695698_c1
670 nmdc:mga0n895_220610_c1
671 nmdc:mga0rr50_461119_c1
672 nmdc:mga0rr50_982824_c1
673 nmdc:mga0a205_732786_c1
674 Ga0495601_0254536
675 Ga0495601_0635381
676 Ga0495612_0018662
677 Ga0495612_0069897
678 Ga0495612_0224452
679 Ga0495595_0001059
680 Ga0495619_0000504
681 Ga0495619_0236523
682 Ga0500627_0000446
683 Ga0500637_0051735
684 Ga0590071_001026
685 Ga0590074_048190
686 Ga0590075_044545
687 Ga0590077_070816
688 Ga0501082_0714017
689 Ga0466962_0215282
690 2824687167
691 2919500921
692 2922400251
693 3005490982
694 3005594258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

63

180

0.89

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

43

159

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

74

161

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.8747 3 154
3lod-assembly1.cif.gz_A the crystal structure of the putative acyl-coa n-acyltransferase from klebsiella pneumoniae subsp.pneumoniae mgh 78578 0.858 3 154
5g22-assembly3.cif.gz_C plasmodium vivax n-myristoyltransferase in complex with a quinoline inhibitor (compound 26) 0.8541 52 117
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.8221 49 151
1yx0-assembly1.cif.gz_A solution structure of bacillus subtilis protein ysne: the northeast structural genomics consortium target sr220 0.8191 6 154
ID Description Score Start End Superfamily
af_Q54IL8_181_295_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8794 52 131 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8747 3 154 3.40.630.30
3lodA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.858 3 154 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8511 49 141 3.40.630.30
af_E7FBQ5_16_147_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8299 60 148 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A352GKP1-F1-model_v4 GNAT family N-acetyltransferase 0.9913 40 154 GO:0016747
AF-F9T4X7-F1-model_v4 Acetyltransferase 0.986 6 153 GO:0016747
AF-A0A838TCK6-F1-model_v4 GNAT family N-acetyltransferase 0.9844 6 153 GO:0016747
AF-A0A4R6U2M0-F1-model_v4 Putative acetyltransferase 0.9833 3 154 GO:0016747
AF-A0A158KGE9-F1-model_v4 GCN5-related N-acetyltransferase 0.9799 6 154 GO:0016747

Map