F415951

General Info

Members Datasets Scaffolds Average Seq Length
344 248 689 86

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10344483|Ga0105237_103444832
Length 98
Sequence MKARPEIFAQAAMSHVTIYTKPYCPYCVRAVSLLEEKGIAFTEIEAASDPEKRQEMMRRSGRATFPQIFIGERHIGGCDDMMALEREGQLDPLLQAAA

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
59 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
60 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
146 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
214 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
220 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
221 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
228 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
231 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
232 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
233 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
234 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
235 2643221584 Caulobacter sp. Root656 Isolate Unclassified
236 2643221640 Caulobacter sp. Root342 Isolate Unclassified
237 2643221642 Caulobacter sp. Root343 Isolate Unclassified
238 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
239 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
240 2818991435 Caulobacter henricii 536 Isolate Unclassified
241 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
242 2849560528 Caulobacter zeae 410 Isolate Unclassified
243 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
244 2851153111 Caulobacter radicis 736 Isolate Unclassified
245 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
246 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
247 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
248 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.48
Metatranscriptomes 0
Isolates 5.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.37
Nodule 0.58
Rhizoplane 2.62
Rhizosphere 72.09
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10344483 3300009545 Bacteria 1494
2 JGI25153J46596_10025167 3300003215 Bacteria 2132
3 rootH1_10061495 3300003316 Bacteria 1865
4 rootH1_10061495 3300003323 Bacteria 5872
5 rootH1_10200505 3300003323 Bacteria 1328
6 Ga0055526_1039995 3300003771 Bacteria 1187
7 Ga0055528_1077528 3300003790 Bacteria 589
8 Ga0055531_10007308 3300003794 Bacteria 6054
9 Ga0065165_1001479 3300005262 Bacteria 25047
10 Ga0070658_10628610 3300005327 Bacteria 931
11 Ga0070683_101289801 3300005329 Bacteria 702
12 Ga0070690_100955567 3300005330 Bacteria 673
13 Ga0070670_100000044 3300005331 Bacteria 140263
14 Ga0070677_10251793 3300005333 Bacteria 877
15 Ga0070666_10051109 3300005335 Bacteria 2782
16 Ga0070680_100249486 3300005336 Bacteria 1500
17 Ga0070680_100881832 3300005336 Bacteria 772
18 Ga0070668_100009428 3300005347 Bacteria 7241
19 Ga0070675_100597185 3300005354 Bacteria 1001
20 Ga0070671_101017382 3300005355 Bacteria 726
21 Ga0070671_101982008 3300005355 Bacteria 518
22 Ga0070688_100932964 3300005365 Bacteria 686
23 Ga0070667_100000231 3300005367 Bacteria 63589
24 Ga0070710_11490436 3300005437 Bacteria 508
25 Ga0070681_10359767 3300005458 Bacteria 1365
26 Ga0068867_101316858 3300005459 Bacteria 667
27 Ga0070679_100398151 3300005530 Bacteria 1323
28 Ga0070679_100966011 3300005530 Bacteria 796
29 Ga0070684_101843623 3300005535 Bacteria 571
30 Ga0068853_100609825 3300005539 Bacteria 1037
31 Ga0068853_100999923 3300005539 Bacteria 805
32 Ga0070686_101478194 3300005544 Bacteria 572
33 Ga0070665_100023700 3300005548 Bacteria 6181
34 Ga0070665_100785583 3300005548 Bacteria 965
35 Ga0068855_101115619 3300005563 Bacteria 824
36 Ga0068855_101602300 3300005563 Bacteria 666
37 Ga0068855_102328022 3300005563 Bacteria 536
38 Ga0068857_101314122 3300005577 Bacteria 702
39 Ga0068856_101141803 3300005614 Bacteria 796
40 Ga0068864_100000060 3300005618 Bacteria 124506
41 Ga0068864_100000061 3300005618 Bacteria 123373
42 Ga0068861_100297172 3300005719 Bacteria 1397
43 Ga0068863_100000023 3300005841 Bacteria 186490
44 Ga0068863_100000810 3300005841 Bacteria 31370
45 Ga0068863_102547095 3300005841 Bacteria 521
46 Ga0068858_100000184 3300005842 Bacteria 66104
47 Ga0068858_100016611 3300005842 Bacteria 6913
48 Ga0068858_101066805 3300005842 Bacteria 793
49 Ga0068858_101513781 3300005842 Unclassified 662
50 Ga0068860_100000122 3300005843 Bacteria 125178
51 Ga0068862_100008565 3300005844 Bacteria 8464
52 Ga0070717_10410931 3300006028 Bacteria 1217
53 Ga0075365_10779952 3300006038 Bacteria 675
54 Ga0075363_100500585 3300006048 Bacteria 721
55 Ga0075362_10151526 3300006177 Bacteria 1112
56 Ga0075369_10014755 3300006186 Bacteria 3126
57 Ga0075366_10012447 3300006195 Bacteria 4826
58 Ga0075366_10369032 3300006195 Bacteria 882
59 Ga0075366_10578785 3300006195 Bacteria 696
60 Ga0097621_100608658 3300006237 Bacteria 999
61 Ga0097621_102028580 3300006237 Bacteria 550
62 Ga0075370_10075937 3300006353 Bacteria 1927
63 Ga0075370_10155076 3300006353 Bacteria 1343
64 Ga0068865_100697297 3300006881 Bacteria 867
65 Ga0079104_1011116 3300006946 Bacteria 2915
66 Ga0105251_10154474 3300009011 Bacteria 1035
67 Ga0105250_10013505 3300009092 Bacteria 3365
68 Ga0105240_10000679 3300009093 Bacteria 62613
69 Ga0105247_10240306 3300009101 Bacteria 1234
70 Ga0105241_11552728 3300009174 Bacteria 639
71 Ga0105242_11864815 3300009176 Bacteria 641
72 Ga0105248_10000279 3300009177 Bacteria 60271
73 Ga0105248_10011043 3300009177 Bacteria 9963
74 Ga0105248_10043124 3300009177 Bacteria 5059
75 Ga0105237_12348448 3300009545 Bacteria 543
76 Ga0105238_10412310 3300009551 Bacteria 1345
77 Ga0105238_10521929 3300009551 Bacteria 1190
78 Ga0105238_10797809 3300009551 Bacteria 960
79 Ga0105238_12933915 3300009551 Bacteria 513
80 Ga0105249_10000872 3300009553 Bacteria 26803
81 Ga0105239_10117107 3300010375 Bacteria 2957
82 Ga0105239_10158490 3300010375 Bacteria 2528
83 Ga0105239_11396112 3300010375 Bacteria 808
84 Ga0105239_11938443 3300010375 Bacteria 683
85 Ga0157325_1006923 3300012485 Bacteria 746
86 Ga0157322_1045316 3300012490 Bacteria 518
87 Ga0157347_1036051 3300012502 Bacteria 638
88 Ga0157370_10395958 3300013104 Bacteria 1271
89 Ga0157369_10642213 3300013105 Bacteria 1095
90 Ga0157374_12165084 3300013296 Bacteria 583
91 Ga0157378_12895561 3300013297 Archaea 532
92 Ga0157372_10918826 3300013307 Bacteria 1015
93 Ga0157372_11277012 3300013307 Bacteria 847
94 Ga0157375_10829591 3300013308 Bacteria 1072
95 Ga0157375_11835039 3300013308 Bacteria 719
96 Ga0157375_12790628 3300013308 Bacteria 584
97 Ga0163163_10516295 3300014325 Bacteria 1257
98 Ga0157380_12243399 3300014326 Bacteria 610
99 Ga0157377_10960188 3300014745 Bacteria 644
100 Ga0157379_10035088 3300014968 Bacteria 4471
101 Ga0157379_10126720 3300014968 Bacteria 2297
102 Ga0157379_10405800 3300014968 Bacteria 1253
103 Ga0157376_11813469 3300014969 Bacteria 646
104 Ga0157376_11968336 3300014969 Bacteria 622
105 Ga0163161_11446846 3300017792 Bacteria 602
106 Ga0213874_10004764 3300021377 Bacteria 3125
107 Ga0213876_10000074 3300021384 Bacteria 120394
108 Ga0213876_10434673 3300021384 Bacteria 698
109 Ga0213875_10088546 3300021388 Bacteria 1444
110 Ga0213875_10125969 3300021388 Bacteria 1197
111 Ga0209564_1006888 3300025295 Bacteria 5991
112 Ga0209758_1002274 3300025297 Bacteria 19896
113 Ga0209050_1057327 3300025298 Bacteria 942
114 Ga0209256_1002598 3300025299 Bacteria 14328
115 Ga0209257_1000036 3300025304 Bacteria 616006
116 Ga0207696_1151122 3300025711 Bacteria 620
117 Ga0207642_10735833 3300025899 Bacteria 624
118 Ga0207710_10046909 3300025900 Bacteria 1929
119 Ga0207680_10014890 3300025903 Bacteria 4042
120 Ga0207680_10323450 3300025903 Bacteria 1079
121 Ga0207645_10294772 3300025907 Bacteria 1079
122 Ga0207705_10440288 3300025909 Bacteria 1010
123 Ga0207705_10468389 3300025909 Bacteria 978
124 Ga0207654_11102947 3300025911 Bacteria 578
125 Ga0207695_10002817 3300025913 Bacteria 25263
126 Ga0207671_11048495 3300025914 Bacteria 641
127 Ga0207660_11231659 3300025917 Bacteria 609
128 Ga0207652_10848124 3300025921 Bacteria 809
129 Ga0207681_10865425 3300025923 Bacteria 756
130 Ga0207694_10260184 3300025924 Bacteria 1421
131 Ga0207694_10482607 3300025924 Bacteria 1037
132 Ga0207694_11707139 3300025924 Bacteria 530
133 Ga0207650_10000065 3300025925 Bacteria 140452
134 Ga0207659_10712066 3300025926 Bacteria 860
135 Ga0207686_11402178 3300025934 Bacteria 575
136 Ga0207670_10785181 3300025936 Bacteria 793
137 Ga0207711_10000732 3300025941 Bacteria 32211
138 Ga0207711_10022802 3300025941 Bacteria 5239
139 Ga0207711_10338508 3300025941 Bacteria 1392
140 Ga0207689_10254434 3300025942 Bacteria 1453
141 Ga0207689_10429657 3300025942 Bacteria 1103
142 Ga0207661_10752959 3300025944 Bacteria 897
143 Ga0207667_10811337 3300025949 Bacteria 932
144 Ga0207667_11281351 3300025949 Bacteria 710
145 Ga0207667_12113225 3300025949 Bacteria 521
146 Ga0207712_10000478 3300025961 Bacteria 33656
147 Ga0207668_10000340 3300025972 Bacteria 30277
148 Ga0207640_10809771 3300025981 Bacteria 812
149 Ga0207658_10000168 3300025986 Bacteria 70040
150 Ga0207703_10000273 3300026035 Bacteria 57186
151 Ga0207703_10011280 3300026035 Bacteria 6950
152 Ga0207703_10244740 3300026035 Bacteria 1614
153 Ga0207639_11272170 3300026041 Bacteria 690
154 Ga0207678_10800048 3300026067 Bacteria 832
155 Ga0207702_10636259 3300026078 Bacteria 1048
156 Ga0207641_10000067 3300026088 Bacteria 155379
157 Ga0207641_10001551 3300026088 Bacteria 22508
158 Ga0207641_11753489 3300026088 Bacteria 623
159 Ga0207648_10428999 3300026089 Bacteria 1201
160 Ga0207676_10000127 3300026095 Bacteria 66733
161 Ga0207676_10000501 3300026095 Bacteria 33019
162 Ga0207675_100315124 3300026118 Bacteria 1526
163 Ga0209281_1012517 3300027111 Bacteria 1860
164 Ga0268266_10003074 3300028379 Bacteria 17059
165 Ga0268266_10639615 3300028379 Bacteria 1023
166 Ga0268265_10001199 3300028380 Bacteria 22587
167 Ga0268265_12194679 3300028380 Unclassified 559
168 Ga0268264_10000172 3300028381 Bacteria 140393
169 Ga0307517_10027467 3300028786 Bacteria 6835
170 Ga0307517_10257858 3300028786 Bacteria 1016
171 Ga0307515_10035485 3300028794 Bacteria 8110
172 Ga0265338_10048201 3300028800 Bacteria 3880
173 Ga0265330_10305262 3300031235 Bacteria 671
174 Ga0265327_10000454 3300031251 Bacteria 73503
175 Ga0265316_10082871 3300031344 Bacteria 2457
176 Ga0307513_10007633 3300031456 Bacteria 13977
177 Ga0307508_10308175 3300031616 Bacteria 1176
178 Ga0307516_10000020 3300031730 Bacteria 195931
179 Ga0307413_10399606 3300031824 Bacteria 1076
180 Ga0307407_11310902 3300031903 Bacteria 568
181 Ga0307412_11402829 3300031911 Bacteria 632
182 Ga0307412_12098167 3300031911 Bacteria 525
183 Ga0307409_100643494 3300031995 Bacteria 1053
184 Ga0307409_101253000 3300031995 Bacteria 766
185 Ga0307414_10342226 3300032004 Bacteria 1281
186 Ga0307411_10139130 3300032005 Bacteria 1788
187 Ga0307411_10144816 3300032005 Bacteria 1757
188 Ga0373936_0071426 3300035113 Bacteria 1431
189 Ga0395899_0000003 3300037312 Bacteria 1232684
190 Ga0395899_0193431 3300037312 Bacteria 1422
191 Ga0395899_0323395 3300037312 Bacteria 1038
192 Ga0395900_0114155 3300037418 Bacteria 2772
193 Ga0395900_0176571 3300037418 Bacteria 2172
194 Ga0395900_0316364 3300037418 Bacteria 1543
195 Ga0395900_0671682 3300037418 Bacteria 971
196 Ga0395898_0070959 3300037466 Bacteria 3366
197 Ga0395898_0394066 3300037466 Bacteria 1320
198 Ga0395898_0487653 3300037466 Bacteria 1172
199 Ga0395898_1670193 3300037466 Bacteria 560
200 Ga0395905_0000022 3300037471 Bacteria 321527
201 Ga0395905_0378517 3300037471 Bacteria 1309
202 Ga0395905_0477935 3300037471 Bacteria 1145
203 Ga0395905_0484083 3300037471 Bacteria 1137
204 Ga0395905_1066385 3300037471 Bacteria 711
205 Ga0395905_1746481 3300037471 Bacteria 528
206 Ga0436364_0679205 3300037853 Bacteria 724
207 Ga0436364_0822348 3300037853 Bacteria 1648
208 Ga0395901_0118281 3300038443 Bacteria 2784
209 Ga0395901_0390198 3300038443 Bacteria 1431
210 Ga0395901_0747446 3300038443 Bacteria 971
211 Ga0436365_1728448 3300039437 Bacteria 2360
212 Ga0436365_1797099 3300039437 Bacteria 84930
213 Ga0436363_0503229 3300039450 Bacteria 3189
214 Ga0451841_0995997 3300041498 Bacteria 686
215 Ga0451849_1453555 3300041505 Bacteria 581
216 Ga0451853_0707576 3300041512 Bacteria 1472
217 Ga0439441_016870 3300042001 Bacteria 1306
218 Ga0450890_060102 3300042127 Bacteria 594
219 Ga0439435_0021734 3300042436 Bacteria 1668
220 Ga0439459_0041209 3300042438 Bacteria 982
221 Ga0466969_0344902 3300044656 Bacteria 674
222 Ga0466970_0306747 3300044765 Bacteria 896
223 Ga0466960_0570101 3300044901 Bacteria 669
224 Ga0466959_0075831 3300045049 Bacteria 2429
225 Ga0466959_0079301 3300045049 Bacteria 2368
226 Ga0495617_061289 3300046452 Bacteria 1244
227 Ga0495590_0004604 3300046457 Bacteria 5541
228 Ga0495638_0002411 3300046460 Bacteria 15279
229 Ga0495638_0006686 3300046460 Bacteria 8355
230 Ga0495638_0017416 3300046460 Bacteria 4789
231 Ga0495638_0234905 3300046460 Bacteria 1018
232 Ga0495650_0120372 3300046471 Bacteria 967
233 Ga0495664_0819080 3300046477 Bacteria 547
234 Ga0495585_0559107 3300046492 Bacteria 540
235 Ga0495594_0219018 3300046499 Bacteria 1085
236 Ga0495607_0493102 3300046501 Bacteria 544
237 Ga0495606_0187742 3300046507 Bacteria 1187
238 Ga0495610_0003215 3300046512 Bacteria 12928
239 Ga0495610_0008833 3300046512 Bacteria 6461
240 Ga0495610_0054306 3300046512 Bacteria 1936
241 Ga0495616_0002094 3300046513 Bacteria 13405
242 Ga0495631_0000827 3300046518 Bacteria 19791
243 Ga0495632_0001771 3300046519 Bacteria 17444
244 Ga0495632_0048616 3300046519 Bacteria 2099
245 Ga0495637_0034782 3300046520 Bacteria 2204
246 Ga0495648_0244029 3300046524 Bacteria 871
247 Ga0495654_0181832 3300046530 Bacteria 910
248 Ga0495598_0071356 3300046537 Bacteria 1094
249 Ga0495609_0325228 3300046538 Bacteria 623
250 Ga0495668_0001352 3300046616 Bacteria 24072
251 Ga0495668_0022043 3300046616 Bacteria 3644
252 Ga0495625_0299735 3300046660 Bacteria 1029
253 Ga0495613_0013443 3300046689 Bacteria 6080
254 Ga0495670_0069287 3300046691 Bacteria 1783
255 Ga0495670_0250356 3300046691 Bacteria 944
256 Ga0495671_0463496 3300046692 Bacteria 605
257 Ga0495672_0334128 3300047320 Bacteria 708
258 Ga0495683_0250087 3300047323 Bacteria 778
259 Ga0495686_0001958 3300047472 Bacteria 20461
260 Ga0495686_0021994 3300047472 Bacteria 4223
261 Ga0496100_0212702 3300048903 Bacteria 1415
262 Ga0496102_0017132 3300048905 Bacteria 6344
263 Ga0496102_0080447 3300048905 Bacteria 3002
264 Ga0496103_0602569 3300048906 Bacteria 700
265 Ga0496104_0551374 3300048907 Bacteria 1064
266 Ga0496106_0147379 3300048909 Bacteria 1855
267 Ga0496107_0264830 3300048910 Bacteria 1279
268 Ga0496113_0152819 3300048916 Bacteria 1822
269 Ga0496115_0715128 3300048918 Bacteria 786
270 Ga0496117_0040521 3300048920 Bacteria 3424
271 Ga0496118_0002461 3300048921 Bacteria 24906
272 Ga0496119_0090934 3300048922 Bacteria 1734
273 Ga0496121_0000053 3300048924 Bacteria 312611
274 Ga0496124_0010685 3300048927 Bacteria 9261
275 Ga0496125_0027084 3300048928 Bacteria 5205
276 Ga0496126_0001854 3300048929 Bacteria 30807
277 Ga0495678_001041 3300049459 Bacteria 23510
278 Ga0501033_0001020 3300049570 Bacteria 25444
279 Ga0501034_0919734 3300049571 Bacteria 762
280 Ga0501034_1620365 3300049571 Bacteria 520
281 Ga0501037_0758436 3300049573 Bacteria 643
282 Ga0501043_0296837 3300049579 Bacteria 1236
283 Ga0501047_0037496 3300049581 Bacteria 4687
284 Ga0501047_0276943 3300049581 Bacteria 1523
285 Ga0501047_0323437 3300049581 Bacteria 1382
286 Ga0501047_0767950 3300049581 Bacteria 779
287 Ga0501048_1210031 3300049582 Bacteria 543
288 Ga0501069_1005844 3300049585 Bacteria 509
289 Ga0501070_1053932 3300049586 Bacteria 629
290 Ga0501071_0274240 3300049587 Bacteria 1276
291 Ga0501252_079448 3300049682 Bacteria 541
292 Ga0501257_001529 3300049686 Bacteria 4826
293 Ga0501035_0000612 3300049822 Bacteria 39349
294 Ga0501035_0027083 3300049822 Bacteria 5241
295 Ga0501035_0378572 3300049822 Bacteria 1181
296 Ga0501035_0712134 3300049822 Bacteria 809
297 Ga0501044_0017867 3300049823 Bacteria 7608
298 Ga0501044_0544716 3300049823 Bacteria 1058
299 nmdc:mga03683_550436_c1 3300050489 Bacteria 562
300 nmdc:mga03n38_728657_c1 3300050490 Bacteria 573
301 nmdc:mga0k408_563276_c1 3300050493 Bacteria 673
302 nmdc:mga0k408_570782_c1 3300050493 Bacteria 668
303 nmdc:mga0k408_88202_c1 3300050493 Bacteria 1822
304 nmdc:mga07m45_385564_c1 3300050496 Bacteria 814
305 nmdc:mga0sz30_3025_c1 3300050516 Bacteria 6025
306 Ga0500578_0000309 3300053086 Bacteria 59973
307 Ga0500643_037409 3300053087 Bacteria 1445
308 Ga0500641_0218043 3300053096 Bacteria 810
309 Ga0500650_0129004 3300053098 Bacteria 1176
310 Ga0500556_0032669 3300053104 Bacteria 1780
311 Ga0500562_000770 3300053108 Bacteria 7798
312 Ga0500594_0000456 3300053118 Bacteria 9009
313 Ga0500594_0300521 3300053118 Bacteria 538
314 Ga0500595_007363 3300053119 Bacteria 4572
315 Ga0500595_033943 3300053119 Bacteria 1691
316 Ga0500642_0165812 3300053130 Bacteria 1035
317 Ga0500559_0000018 3300053136 Bacteria 140924
318 Ga0500559_0048744 3300053136 Bacteria 1864
319 Ga0500603_196675 3300053150 Bacteria 638
320 Ga0500616_0137727 3300053153 Bacteria 1145
321 Ga0500622_0001059 3300053156 Bacteria 22916
322 Ga0500622_0003258 3300053156 Bacteria 11015
323 Ga0500636_0094200 3300053177 Bacteria 1711
324 Ga0500611_126872 3300053727 Bacteria 684
325 Ga0500609_000806 3300053731 Bacteria 4709
326 Ga0466962_0589339 3300061719 Bacteria 566
327 2585146486 2582581279 Bacteria 4980720
328 2585151921 2582581280 Bacteria 5994497
329 2585194594 2582581293 Bacteria 5907401
330 2587918447 2585428106 Bacteria 5179711
331 2643779518 2643221552 Bacteria 5708754
332 2643931087 2643221584 Bacteria 5511711
333 2644224991 2643221640 Bacteria 5258820
334 2644234075 2643221642 Bacteria 5357871
335 2739351891 2738543031 Bacteria 5769731
336 2739793554 2739367756 Bacteria 4553612
337 2819537401 2818991435 Bacteria 5433759
338 2819646537 2818991454 Bacteria 5563326
339 2849561863 2849560528 Bacteria 5393480
340 2849574073 2849573788 Bacteria 5421256
341 2851157751 2851153111 Bacteria 5542585
342 2857505356 2857504554 Bacteria 5369913
343 2884962382 2884960567 Bacteria 5437054
344 2898332600 2898329390 Bacteria 5168154
345 2917554352 2917554339 Bacteria 4987857
346 Ga0105237_10344483
347 JGI25153J46596_10025167
348 rootH1_10061495
349 rootH1_10200505
350 Ga0055526_1039995
351 Ga0055528_1077528
352 Ga0055531_10007308
353 Ga0065165_1001479
354 Ga0070658_10628610
355 Ga0070683_101289801
356 Ga0070690_100955567
357 Ga0070670_100000044
358 Ga0070677_10251793
359 Ga0070666_10051109
360 Ga0070680_100249486
361 Ga0070680_100881832
362 Ga0070668_100009428
363 Ga0070675_100597185
364 Ga0070671_101017382
365 Ga0070671_101982008
366 Ga0070688_100932964
367 Ga0070667_100000231
368 Ga0070710_11490436
369 Ga0070681_10359767
370 Ga0068867_101316858
371 Ga0070679_100398151
372 Ga0070679_100966011
373 Ga0070684_101843623
374 Ga0068853_100609825
375 Ga0068853_100999923
376 Ga0070686_101478194
377 Ga0070665_100023700
378 Ga0070665_100785583
379 Ga0068855_101115619
380 Ga0068855_101602300
381 Ga0068855_102328022
382 Ga0068857_101314122
383 Ga0068856_101141803
384 Ga0068864_100000060
385 Ga0068864_100000061
386 Ga0068861_100297172
387 Ga0068863_100000023
388 Ga0068863_100000810
389 Ga0068863_102547095
390 Ga0068858_100000184
391 Ga0068858_100016611
392 Ga0068858_101066805
393 Ga0068858_101513781
394 Ga0068860_100000122
395 Ga0068862_100008565
396 Ga0070717_10410931
397 Ga0075365_10779952
398 Ga0075363_100500585
399 Ga0075362_10151526
400 Ga0075369_10014755
401 Ga0075366_10012447
402 Ga0075366_10369032
403 Ga0075366_10578785
404 Ga0097621_100608658
405 Ga0097621_102028580
406 Ga0075370_10075937
407 Ga0075370_10155076
408 Ga0068865_100697297
409 Ga0079104_1011116
410 Ga0105251_10154474
411 Ga0105250_10013505
412 Ga0105240_10000679
413 Ga0105247_10240306
414 Ga0105241_11552728
415 Ga0105242_11864815
416 Ga0105248_10000279
417 Ga0105248_10011043
418 Ga0105248_10043124
419 Ga0105237_12348448
420 Ga0105238_10412310
421 Ga0105238_10521929
422 Ga0105238_10797809
423 Ga0105238_12933915
424 Ga0105249_10000872
425 Ga0105239_10117107
426 Ga0105239_10158490
427 Ga0105239_11396112
428 Ga0105239_11938443
429 Ga0157325_1006923
430 Ga0157322_1045316
431 Ga0157347_1036051
432 Ga0157370_10395958
433 Ga0157369_10642213
434 Ga0157374_12165084
435 Ga0157378_12895561
436 Ga0157372_10918826
437 Ga0157372_11277012
438 Ga0157375_10829591
439 Ga0157375_11835039
440 Ga0157375_12790628
441 Ga0163163_10516295
442 Ga0157380_12243399
443 Ga0157377_10960188
444 Ga0157379_10035088
445 Ga0157379_10126720
446 Ga0157379_10405800
447 Ga0157376_11813469
448 Ga0157376_11968336
449 Ga0163161_11446846
450 Ga0213874_10004764
451 Ga0213876_10000074
452 Ga0213876_10434673
453 Ga0213875_10088546
454 Ga0213875_10125969
455 Ga0209564_1006888
456 Ga0209758_1002274
457 Ga0209050_1057327
458 Ga0209256_1002598
459 Ga0209257_1000036
460 Ga0207696_1151122
461 Ga0207642_10735833
462 Ga0207710_10046909
463 Ga0207680_10014890
464 Ga0207680_10323450
465 Ga0207645_10294772
466 Ga0207705_10440288
467 Ga0207705_10468389
468 Ga0207654_11102947
469 Ga0207695_10002817
470 Ga0207671_11048495
471 Ga0207660_11231659
472 Ga0207652_10848124
473 Ga0207681_10865425
474 Ga0207694_10260184
475 Ga0207694_10482607
476 Ga0207694_11707139
477 Ga0207650_10000065
478 Ga0207659_10712066
479 Ga0207686_11402178
480 Ga0207670_10785181
481 Ga0207711_10000732
482 Ga0207711_10022802
483 Ga0207711_10338508
484 Ga0207689_10254434
485 Ga0207689_10429657
486 Ga0207661_10752959
487 Ga0207667_10811337
488 Ga0207667_11281351
489 Ga0207667_12113225
490 Ga0207712_10000478
491 Ga0207668_10000340
492 Ga0207640_10809771
493 Ga0207658_10000168
494 Ga0207703_10000273
495 Ga0207703_10011280
496 Ga0207703_10244740
497 Ga0207639_11272170
498 Ga0207678_10800048
499 Ga0207702_10636259
500 Ga0207641_10000067
501 Ga0207641_10001551
502 Ga0207641_11753489
503 Ga0207648_10428999
504 Ga0207676_10000127
505 Ga0207676_10000501
506 Ga0207675_100315124
507 Ga0209281_1012517
508 Ga0268266_10003074
509 Ga0268266_10639615
510 Ga0268265_10001199
511 Ga0268265_12194679
512 Ga0268264_10000172
513 Ga0307517_10027467
514 Ga0307517_10257858
515 Ga0307515_10035485
516 Ga0265338_10048201
517 Ga0265330_10305262
518 Ga0265327_10000454
519 Ga0265316_10082871
520 Ga0307513_10007633
521 Ga0307508_10308175
522 Ga0307516_10000020
523 Ga0307413_10399606
524 Ga0307407_11310902
525 Ga0307412_11402829
526 Ga0307412_12098167
527 Ga0307409_100643494
528 Ga0307409_101253000
529 Ga0307414_10342226
530 Ga0307411_10139130
531 Ga0307411_10144816
532 Ga0373936_0071426
533 Ga0395899_0000003
534 Ga0395899_0193431
535 Ga0395899_0323395
536 Ga0395900_0114155
537 Ga0395900_0176571
538 Ga0395900_0316364
539 Ga0395900_0671682
540 Ga0395898_0070959
541 Ga0395898_0394066
542 Ga0395898_0487653
543 Ga0395898_1670193
544 Ga0395905_0000022
545 Ga0395905_0378517
546 Ga0395905_0477935
547 Ga0395905_0484083
548 Ga0395905_1066385
549 Ga0395905_1746481
550 Ga0436364_0679205
551 Ga0436364_0822348
552 Ga0395901_0118281
553 Ga0395901_0390198
554 Ga0395901_0747446
555 Ga0436365_1728448
556 Ga0436365_1797099
557 Ga0436363_0503229
558 Ga0451841_0995997
559 Ga0451849_1453555
560 Ga0451853_0707576
561 Ga0439441_016870
562 Ga0450890_060102
563 Ga0439435_0021734
564 Ga0439459_0041209
565 Ga0466969_0344902
566 Ga0466970_0306747
567 Ga0466960_0570101
568 Ga0466959_0075831
569 Ga0466959_0079301
570 Ga0495617_061289
571 Ga0495590_0004604
572 Ga0495638_0002411
573 Ga0495638_0006686
574 Ga0495638_0017416
575 Ga0495638_0234905
576 Ga0495650_0120372
577 Ga0495664_0819080
578 Ga0495585_0559107
579 Ga0495594_0219018
580 Ga0495607_0493102
581 Ga0495606_0187742
582 Ga0495610_0003215
583 Ga0495610_0008833
584 Ga0495610_0054306
585 Ga0495616_0002094
586 Ga0495631_0000827
587 Ga0495632_0001771
588 Ga0495632_0048616
589 Ga0495637_0034782
590 Ga0495648_0244029
591 Ga0495654_0181832
592 Ga0495598_0071356
593 Ga0495609_0325228
594 Ga0495668_0001352
595 Ga0495668_0022043
596 Ga0495625_0299735
597 Ga0495613_0013443
598 Ga0495670_0069287
599 Ga0495670_0250356
600 Ga0495671_0463496
601 Ga0495672_0334128
602 Ga0495683_0250087
603 Ga0495686_0001958
604 Ga0495686_0021994
605 Ga0496100_0212702
606 Ga0496102_0017132
607 Ga0496102_0080447
608 Ga0496103_0602569
609 Ga0496104_0551374
610 Ga0496106_0147379
611 Ga0496107_0264830
612 Ga0496113_0152819
613 Ga0496115_0715128
614 Ga0496117_0040521
615 Ga0496118_0002461
616 Ga0496119_0090934
617 Ga0496121_0000053
618 Ga0496124_0010685
619 Ga0496125_0027084
620 Ga0496126_0001854
621 Ga0495678_001041
622 Ga0501033_0001020
623 Ga0501034_0919734
624 Ga0501034_1620365
625 Ga0501037_0758436
626 Ga0501043_0296837
627 Ga0501047_0037496
628 Ga0501047_0276943
629 Ga0501047_0323437
630 Ga0501047_0767950
631 Ga0501048_1210031
632 Ga0501069_1005844
633 Ga0501070_1053932
634 Ga0501071_0274240
635 Ga0501252_079448
636 Ga0501257_001529
637 Ga0501035_0000612
638 Ga0501035_0027083
639 Ga0501035_0378572
640 Ga0501035_0712134
641 Ga0501044_0017867
642 Ga0501044_0544716
643 nmdc:mga03683_550436_c1
644 nmdc:mga03n38_728657_c1
645 nmdc:mga0k408_563276_c1
646 nmdc:mga0k408_570782_c1
647 nmdc:mga0k408_88202_c1
648 nmdc:mga07m45_385564_c1
649 nmdc:mga0sz30_3025_c1
650 Ga0500578_0000309
651 Ga0500643_037409
652 Ga0500641_0218043
653 Ga0500650_0129004
654 Ga0500556_0032669
655 Ga0500562_000770
656 Ga0500594_0000456
657 Ga0500594_0300521
658 Ga0500595_007363
659 Ga0500595_033943
660 Ga0500642_0165812
661 Ga0500559_0000018
662 Ga0500559_0048744
663 Ga0500603_196675
664 Ga0500616_0137727
665 Ga0500622_0001059
666 Ga0500622_0003258
667 Ga0500636_0094200
668 Ga0500611_126872
669 Ga0500609_000806
670 Ga0466962_0589339
671 2585146486
672 2585151921
673 2585194594
674 2587918447
675 2643779518
676 2643931087
677 2644224991
678 2644234075
679 2739351891
680 2739793554
681 2819537401
682 2819646537
683 2849561863
684 2849574073
685 2851157751
686 2857505356
687 2884962382
688 2898332600
689 2917554352

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

16

75

0.99

PF04908

SH3BGR

SH3-binding, glutamic acid-rich protein

20

96

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

18

84

0.86

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

23

84

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tr1-assembly1.cif.gz_A crystal structure of gsh-bound cgrx2/c15s 0.9715 1 82
4tr0-assembly2.cif.gz_B crystal structure of gssg-bound cgrx2 0.9713 1 83
4mjb-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a79s 0.9675 2 84
4mja-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a-a75i 0.9667 2 84
4mjc-assembly1.cif.gz_A synechocystis sp. pcc 6803 glutaredoxin a - p84r 0.9659 2 84
ID Description Score Start End Superfamily
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9707 1 83 3.40.30.10
af_A0A1D6GDU0_1_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9519 14 82 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9373 1 83 3.40.30.10
af_A0A368UIM3_131_233_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9334 2 83 3.40.30.10
af_A4HRD2_90_192_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.929 4 83 3.40.30.10

Map