F415951
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 344 | 248 | 689 | 86 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10344483|Ga0105237_103444832 |
| Length | 98 |
| Sequence | MKARPEIFAQAAMSHVTIYTKPYCPYCVRAVSLLEEKGIAFTEIEAASDPEKRQEMMRRSGRATFPQIFIGERHIGGCDDMMALEREGQLDPLLQAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 40 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 48 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 59 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 60 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 74 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 119 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 127 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 132 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 133 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 134 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 135 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 138 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 139 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 140 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 141 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 142 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 143 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 146 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 147 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 148 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 184 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 191 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 192 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 205 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 206 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 209 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 210 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 211 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 212 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 214 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 215 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 217 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 218 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 219 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 220 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 221 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 222 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 223 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 224 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 225 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 226 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 228 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 231 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 232 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 233 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 234 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 235 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 236 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 237 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 238 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 239 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 240 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 241 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 242 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 243 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 244 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 245 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 246 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 247 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 248 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.48 |
| Metatranscriptomes | 0 |
| Isolates | 5.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.37 |
| Nodule | 0.58 |
| Rhizoplane | 2.62 |
| Rhizosphere | 72.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105237_10344483 | 3300009545 | Bacteria | 1494 |
| 2 | JGI25153J46596_10025167 | 3300003215 | Bacteria | 2132 |
| 3 | rootH1_10061495 | 3300003316 | Bacteria | 1865 |
| 4 | rootH1_10061495 | 3300003323 | Bacteria | 5872 |
| 5 | rootH1_10200505 | 3300003323 | Bacteria | 1328 |
| 6 | Ga0055526_1039995 | 3300003771 | Bacteria | 1187 |
| 7 | Ga0055528_1077528 | 3300003790 | Bacteria | 589 |
| 8 | Ga0055531_10007308 | 3300003794 | Bacteria | 6054 |
| 9 | Ga0065165_1001479 | 3300005262 | Bacteria | 25047 |
| 10 | Ga0070658_10628610 | 3300005327 | Bacteria | 931 |
| 11 | Ga0070683_101289801 | 3300005329 | Bacteria | 702 |
| 12 | Ga0070690_100955567 | 3300005330 | Bacteria | 673 |
| 13 | Ga0070670_100000044 | 3300005331 | Bacteria | 140263 |
| 14 | Ga0070677_10251793 | 3300005333 | Bacteria | 877 |
| 15 | Ga0070666_10051109 | 3300005335 | Bacteria | 2782 |
| 16 | Ga0070680_100249486 | 3300005336 | Bacteria | 1500 |
| 17 | Ga0070680_100881832 | 3300005336 | Bacteria | 772 |
| 18 | Ga0070668_100009428 | 3300005347 | Bacteria | 7241 |
| 19 | Ga0070675_100597185 | 3300005354 | Bacteria | 1001 |
| 20 | Ga0070671_101017382 | 3300005355 | Bacteria | 726 |
| 21 | Ga0070671_101982008 | 3300005355 | Bacteria | 518 |
| 22 | Ga0070688_100932964 | 3300005365 | Bacteria | 686 |
| 23 | Ga0070667_100000231 | 3300005367 | Bacteria | 63589 |
| 24 | Ga0070710_11490436 | 3300005437 | Bacteria | 508 |
| 25 | Ga0070681_10359767 | 3300005458 | Bacteria | 1365 |
| 26 | Ga0068867_101316858 | 3300005459 | Bacteria | 667 |
| 27 | Ga0070679_100398151 | 3300005530 | Bacteria | 1323 |
| 28 | Ga0070679_100966011 | 3300005530 | Bacteria | 796 |
| 29 | Ga0070684_101843623 | 3300005535 | Bacteria | 571 |
| 30 | Ga0068853_100609825 | 3300005539 | Bacteria | 1037 |
| 31 | Ga0068853_100999923 | 3300005539 | Bacteria | 805 |
| 32 | Ga0070686_101478194 | 3300005544 | Bacteria | 572 |
| 33 | Ga0070665_100023700 | 3300005548 | Bacteria | 6181 |
| 34 | Ga0070665_100785583 | 3300005548 | Bacteria | 965 |
| 35 | Ga0068855_101115619 | 3300005563 | Bacteria | 824 |
| 36 | Ga0068855_101602300 | 3300005563 | Bacteria | 666 |
| 37 | Ga0068855_102328022 | 3300005563 | Bacteria | 536 |
| 38 | Ga0068857_101314122 | 3300005577 | Bacteria | 702 |
| 39 | Ga0068856_101141803 | 3300005614 | Bacteria | 796 |
| 40 | Ga0068864_100000060 | 3300005618 | Bacteria | 124506 |
| 41 | Ga0068864_100000061 | 3300005618 | Bacteria | 123373 |
| 42 | Ga0068861_100297172 | 3300005719 | Bacteria | 1397 |
| 43 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 44 | Ga0068863_100000810 | 3300005841 | Bacteria | 31370 |
| 45 | Ga0068863_102547095 | 3300005841 | Bacteria | 521 |
| 46 | Ga0068858_100000184 | 3300005842 | Bacteria | 66104 |
| 47 | Ga0068858_100016611 | 3300005842 | Bacteria | 6913 |
| 48 | Ga0068858_101066805 | 3300005842 | Bacteria | 793 |
| 49 | Ga0068858_101513781 | 3300005842 | Unclassified | 662 |
| 50 | Ga0068860_100000122 | 3300005843 | Bacteria | 125178 |
| 51 | Ga0068862_100008565 | 3300005844 | Bacteria | 8464 |
| 52 | Ga0070717_10410931 | 3300006028 | Bacteria | 1217 |
| 53 | Ga0075365_10779952 | 3300006038 | Bacteria | 675 |
| 54 | Ga0075363_100500585 | 3300006048 | Bacteria | 721 |
| 55 | Ga0075362_10151526 | 3300006177 | Bacteria | 1112 |
| 56 | Ga0075369_10014755 | 3300006186 | Bacteria | 3126 |
| 57 | Ga0075366_10012447 | 3300006195 | Bacteria | 4826 |
| 58 | Ga0075366_10369032 | 3300006195 | Bacteria | 882 |
| 59 | Ga0075366_10578785 | 3300006195 | Bacteria | 696 |
| 60 | Ga0097621_100608658 | 3300006237 | Bacteria | 999 |
| 61 | Ga0097621_102028580 | 3300006237 | Bacteria | 550 |
| 62 | Ga0075370_10075937 | 3300006353 | Bacteria | 1927 |
| 63 | Ga0075370_10155076 | 3300006353 | Bacteria | 1343 |
| 64 | Ga0068865_100697297 | 3300006881 | Bacteria | 867 |
| 65 | Ga0079104_1011116 | 3300006946 | Bacteria | 2915 |
| 66 | Ga0105251_10154474 | 3300009011 | Bacteria | 1035 |
| 67 | Ga0105250_10013505 | 3300009092 | Bacteria | 3365 |
| 68 | Ga0105240_10000679 | 3300009093 | Bacteria | 62613 |
| 69 | Ga0105247_10240306 | 3300009101 | Bacteria | 1234 |
| 70 | Ga0105241_11552728 | 3300009174 | Bacteria | 639 |
| 71 | Ga0105242_11864815 | 3300009176 | Bacteria | 641 |
| 72 | Ga0105248_10000279 | 3300009177 | Bacteria | 60271 |
| 73 | Ga0105248_10011043 | 3300009177 | Bacteria | 9963 |
| 74 | Ga0105248_10043124 | 3300009177 | Bacteria | 5059 |
| 75 | Ga0105237_12348448 | 3300009545 | Bacteria | 543 |
| 76 | Ga0105238_10412310 | 3300009551 | Bacteria | 1345 |
| 77 | Ga0105238_10521929 | 3300009551 | Bacteria | 1190 |
| 78 | Ga0105238_10797809 | 3300009551 | Bacteria | 960 |
| 79 | Ga0105238_12933915 | 3300009551 | Bacteria | 513 |
| 80 | Ga0105249_10000872 | 3300009553 | Bacteria | 26803 |
| 81 | Ga0105239_10117107 | 3300010375 | Bacteria | 2957 |
| 82 | Ga0105239_10158490 | 3300010375 | Bacteria | 2528 |
| 83 | Ga0105239_11396112 | 3300010375 | Bacteria | 808 |
| 84 | Ga0105239_11938443 | 3300010375 | Bacteria | 683 |
| 85 | Ga0157325_1006923 | 3300012485 | Bacteria | 746 |
| 86 | Ga0157322_1045316 | 3300012490 | Bacteria | 518 |
| 87 | Ga0157347_1036051 | 3300012502 | Bacteria | 638 |
| 88 | Ga0157370_10395958 | 3300013104 | Bacteria | 1271 |
| 89 | Ga0157369_10642213 | 3300013105 | Bacteria | 1095 |
| 90 | Ga0157374_12165084 | 3300013296 | Bacteria | 583 |
| 91 | Ga0157378_12895561 | 3300013297 | Archaea | 532 |
| 92 | Ga0157372_10918826 | 3300013307 | Bacteria | 1015 |
| 93 | Ga0157372_11277012 | 3300013307 | Bacteria | 847 |
| 94 | Ga0157375_10829591 | 3300013308 | Bacteria | 1072 |
| 95 | Ga0157375_11835039 | 3300013308 | Bacteria | 719 |
| 96 | Ga0157375_12790628 | 3300013308 | Bacteria | 584 |
| 97 | Ga0163163_10516295 | 3300014325 | Bacteria | 1257 |
| 98 | Ga0157380_12243399 | 3300014326 | Bacteria | 610 |
| 99 | Ga0157377_10960188 | 3300014745 | Bacteria | 644 |
| 100 | Ga0157379_10035088 | 3300014968 | Bacteria | 4471 |
| 101 | Ga0157379_10126720 | 3300014968 | Bacteria | 2297 |
| 102 | Ga0157379_10405800 | 3300014968 | Bacteria | 1253 |
| 103 | Ga0157376_11813469 | 3300014969 | Bacteria | 646 |
| 104 | Ga0157376_11968336 | 3300014969 | Bacteria | 622 |
| 105 | Ga0163161_11446846 | 3300017792 | Bacteria | 602 |
| 106 | Ga0213874_10004764 | 3300021377 | Bacteria | 3125 |
| 107 | Ga0213876_10000074 | 3300021384 | Bacteria | 120394 |
| 108 | Ga0213876_10434673 | 3300021384 | Bacteria | 698 |
| 109 | Ga0213875_10088546 | 3300021388 | Bacteria | 1444 |
| 110 | Ga0213875_10125969 | 3300021388 | Bacteria | 1197 |
| 111 | Ga0209564_1006888 | 3300025295 | Bacteria | 5991 |
| 112 | Ga0209758_1002274 | 3300025297 | Bacteria | 19896 |
| 113 | Ga0209050_1057327 | 3300025298 | Bacteria | 942 |
| 114 | Ga0209256_1002598 | 3300025299 | Bacteria | 14328 |
| 115 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 116 | Ga0207696_1151122 | 3300025711 | Bacteria | 620 |
| 117 | Ga0207642_10735833 | 3300025899 | Bacteria | 624 |
| 118 | Ga0207710_10046909 | 3300025900 | Bacteria | 1929 |
| 119 | Ga0207680_10014890 | 3300025903 | Bacteria | 4042 |
| 120 | Ga0207680_10323450 | 3300025903 | Bacteria | 1079 |
| 121 | Ga0207645_10294772 | 3300025907 | Bacteria | 1079 |
| 122 | Ga0207705_10440288 | 3300025909 | Bacteria | 1010 |
| 123 | Ga0207705_10468389 | 3300025909 | Bacteria | 978 |
| 124 | Ga0207654_11102947 | 3300025911 | Bacteria | 578 |
| 125 | Ga0207695_10002817 | 3300025913 | Bacteria | 25263 |
| 126 | Ga0207671_11048495 | 3300025914 | Bacteria | 641 |
| 127 | Ga0207660_11231659 | 3300025917 | Bacteria | 609 |
| 128 | Ga0207652_10848124 | 3300025921 | Bacteria | 809 |
| 129 | Ga0207681_10865425 | 3300025923 | Bacteria | 756 |
| 130 | Ga0207694_10260184 | 3300025924 | Bacteria | 1421 |
| 131 | Ga0207694_10482607 | 3300025924 | Bacteria | 1037 |
| 132 | Ga0207694_11707139 | 3300025924 | Bacteria | 530 |
| 133 | Ga0207650_10000065 | 3300025925 | Bacteria | 140452 |
| 134 | Ga0207659_10712066 | 3300025926 | Bacteria | 860 |
| 135 | Ga0207686_11402178 | 3300025934 | Bacteria | 575 |
| 136 | Ga0207670_10785181 | 3300025936 | Bacteria | 793 |
| 137 | Ga0207711_10000732 | 3300025941 | Bacteria | 32211 |
| 138 | Ga0207711_10022802 | 3300025941 | Bacteria | 5239 |
| 139 | Ga0207711_10338508 | 3300025941 | Bacteria | 1392 |
| 140 | Ga0207689_10254434 | 3300025942 | Bacteria | 1453 |
| 141 | Ga0207689_10429657 | 3300025942 | Bacteria | 1103 |
| 142 | Ga0207661_10752959 | 3300025944 | Bacteria | 897 |
| 143 | Ga0207667_10811337 | 3300025949 | Bacteria | 932 |
| 144 | Ga0207667_11281351 | 3300025949 | Bacteria | 710 |
| 145 | Ga0207667_12113225 | 3300025949 | Bacteria | 521 |
| 146 | Ga0207712_10000478 | 3300025961 | Bacteria | 33656 |
| 147 | Ga0207668_10000340 | 3300025972 | Bacteria | 30277 |
| 148 | Ga0207640_10809771 | 3300025981 | Bacteria | 812 |
| 149 | Ga0207658_10000168 | 3300025986 | Bacteria | 70040 |
| 150 | Ga0207703_10000273 | 3300026035 | Bacteria | 57186 |
| 151 | Ga0207703_10011280 | 3300026035 | Bacteria | 6950 |
| 152 | Ga0207703_10244740 | 3300026035 | Bacteria | 1614 |
| 153 | Ga0207639_11272170 | 3300026041 | Bacteria | 690 |
| 154 | Ga0207678_10800048 | 3300026067 | Bacteria | 832 |
| 155 | Ga0207702_10636259 | 3300026078 | Bacteria | 1048 |
| 156 | Ga0207641_10000067 | 3300026088 | Bacteria | 155379 |
| 157 | Ga0207641_10001551 | 3300026088 | Bacteria | 22508 |
| 158 | Ga0207641_11753489 | 3300026088 | Bacteria | 623 |
| 159 | Ga0207648_10428999 | 3300026089 | Bacteria | 1201 |
| 160 | Ga0207676_10000127 | 3300026095 | Bacteria | 66733 |
| 161 | Ga0207676_10000501 | 3300026095 | Bacteria | 33019 |
| 162 | Ga0207675_100315124 | 3300026118 | Bacteria | 1526 |
| 163 | Ga0209281_1012517 | 3300027111 | Bacteria | 1860 |
| 164 | Ga0268266_10003074 | 3300028379 | Bacteria | 17059 |
| 165 | Ga0268266_10639615 | 3300028379 | Bacteria | 1023 |
| 166 | Ga0268265_10001199 | 3300028380 | Bacteria | 22587 |
| 167 | Ga0268265_12194679 | 3300028380 | Unclassified | 559 |
| 168 | Ga0268264_10000172 | 3300028381 | Bacteria | 140393 |
| 169 | Ga0307517_10027467 | 3300028786 | Bacteria | 6835 |
| 170 | Ga0307517_10257858 | 3300028786 | Bacteria | 1016 |
| 171 | Ga0307515_10035485 | 3300028794 | Bacteria | 8110 |
| 172 | Ga0265338_10048201 | 3300028800 | Bacteria | 3880 |
| 173 | Ga0265330_10305262 | 3300031235 | Bacteria | 671 |
| 174 | Ga0265327_10000454 | 3300031251 | Bacteria | 73503 |
| 175 | Ga0265316_10082871 | 3300031344 | Bacteria | 2457 |
| 176 | Ga0307513_10007633 | 3300031456 | Bacteria | 13977 |
| 177 | Ga0307508_10308175 | 3300031616 | Bacteria | 1176 |
| 178 | Ga0307516_10000020 | 3300031730 | Bacteria | 195931 |
| 179 | Ga0307413_10399606 | 3300031824 | Bacteria | 1076 |
| 180 | Ga0307407_11310902 | 3300031903 | Bacteria | 568 |
| 181 | Ga0307412_11402829 | 3300031911 | Bacteria | 632 |
| 182 | Ga0307412_12098167 | 3300031911 | Bacteria | 525 |
| 183 | Ga0307409_100643494 | 3300031995 | Bacteria | 1053 |
| 184 | Ga0307409_101253000 | 3300031995 | Bacteria | 766 |
| 185 | Ga0307414_10342226 | 3300032004 | Bacteria | 1281 |
| 186 | Ga0307411_10139130 | 3300032005 | Bacteria | 1788 |
| 187 | Ga0307411_10144816 | 3300032005 | Bacteria | 1757 |
| 188 | Ga0373936_0071426 | 3300035113 | Bacteria | 1431 |
| 189 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 190 | Ga0395899_0193431 | 3300037312 | Bacteria | 1422 |
| 191 | Ga0395899_0323395 | 3300037312 | Bacteria | 1038 |
| 192 | Ga0395900_0114155 | 3300037418 | Bacteria | 2772 |
| 193 | Ga0395900_0176571 | 3300037418 | Bacteria | 2172 |
| 194 | Ga0395900_0316364 | 3300037418 | Bacteria | 1543 |
| 195 | Ga0395900_0671682 | 3300037418 | Bacteria | 971 |
| 196 | Ga0395898_0070959 | 3300037466 | Bacteria | 3366 |
| 197 | Ga0395898_0394066 | 3300037466 | Bacteria | 1320 |
| 198 | Ga0395898_0487653 | 3300037466 | Bacteria | 1172 |
| 199 | Ga0395898_1670193 | 3300037466 | Bacteria | 560 |
| 200 | Ga0395905_0000022 | 3300037471 | Bacteria | 321527 |
| 201 | Ga0395905_0378517 | 3300037471 | Bacteria | 1309 |
| 202 | Ga0395905_0477935 | 3300037471 | Bacteria | 1145 |
| 203 | Ga0395905_0484083 | 3300037471 | Bacteria | 1137 |
| 204 | Ga0395905_1066385 | 3300037471 | Bacteria | 711 |
| 205 | Ga0395905_1746481 | 3300037471 | Bacteria | 528 |
| 206 | Ga0436364_0679205 | 3300037853 | Bacteria | 724 |
| 207 | Ga0436364_0822348 | 3300037853 | Bacteria | 1648 |
| 208 | Ga0395901_0118281 | 3300038443 | Bacteria | 2784 |
| 209 | Ga0395901_0390198 | 3300038443 | Bacteria | 1431 |
| 210 | Ga0395901_0747446 | 3300038443 | Bacteria | 971 |
| 211 | Ga0436365_1728448 | 3300039437 | Bacteria | 2360 |
| 212 | Ga0436365_1797099 | 3300039437 | Bacteria | 84930 |
| 213 | Ga0436363_0503229 | 3300039450 | Bacteria | 3189 |
| 214 | Ga0451841_0995997 | 3300041498 | Bacteria | 686 |
| 215 | Ga0451849_1453555 | 3300041505 | Bacteria | 581 |
| 216 | Ga0451853_0707576 | 3300041512 | Bacteria | 1472 |
| 217 | Ga0439441_016870 | 3300042001 | Bacteria | 1306 |
| 218 | Ga0450890_060102 | 3300042127 | Bacteria | 594 |
| 219 | Ga0439435_0021734 | 3300042436 | Bacteria | 1668 |
| 220 | Ga0439459_0041209 | 3300042438 | Bacteria | 982 |
| 221 | Ga0466969_0344902 | 3300044656 | Bacteria | 674 |
| 222 | Ga0466970_0306747 | 3300044765 | Bacteria | 896 |
| 223 | Ga0466960_0570101 | 3300044901 | Bacteria | 669 |
| 224 | Ga0466959_0075831 | 3300045049 | Bacteria | 2429 |
| 225 | Ga0466959_0079301 | 3300045049 | Bacteria | 2368 |
| 226 | Ga0495617_061289 | 3300046452 | Bacteria | 1244 |
| 227 | Ga0495590_0004604 | 3300046457 | Bacteria | 5541 |
| 228 | Ga0495638_0002411 | 3300046460 | Bacteria | 15279 |
| 229 | Ga0495638_0006686 | 3300046460 | Bacteria | 8355 |
| 230 | Ga0495638_0017416 | 3300046460 | Bacteria | 4789 |
| 231 | Ga0495638_0234905 | 3300046460 | Bacteria | 1018 |
| 232 | Ga0495650_0120372 | 3300046471 | Bacteria | 967 |
| 233 | Ga0495664_0819080 | 3300046477 | Bacteria | 547 |
| 234 | Ga0495585_0559107 | 3300046492 | Bacteria | 540 |
| 235 | Ga0495594_0219018 | 3300046499 | Bacteria | 1085 |
| 236 | Ga0495607_0493102 | 3300046501 | Bacteria | 544 |
| 237 | Ga0495606_0187742 | 3300046507 | Bacteria | 1187 |
| 238 | Ga0495610_0003215 | 3300046512 | Bacteria | 12928 |
| 239 | Ga0495610_0008833 | 3300046512 | Bacteria | 6461 |
| 240 | Ga0495610_0054306 | 3300046512 | Bacteria | 1936 |
| 241 | Ga0495616_0002094 | 3300046513 | Bacteria | 13405 |
| 242 | Ga0495631_0000827 | 3300046518 | Bacteria | 19791 |
| 243 | Ga0495632_0001771 | 3300046519 | Bacteria | 17444 |
| 244 | Ga0495632_0048616 | 3300046519 | Bacteria | 2099 |
| 245 | Ga0495637_0034782 | 3300046520 | Bacteria | 2204 |
| 246 | Ga0495648_0244029 | 3300046524 | Bacteria | 871 |
| 247 | Ga0495654_0181832 | 3300046530 | Bacteria | 910 |
| 248 | Ga0495598_0071356 | 3300046537 | Bacteria | 1094 |
| 249 | Ga0495609_0325228 | 3300046538 | Bacteria | 623 |
| 250 | Ga0495668_0001352 | 3300046616 | Bacteria | 24072 |
| 251 | Ga0495668_0022043 | 3300046616 | Bacteria | 3644 |
| 252 | Ga0495625_0299735 | 3300046660 | Bacteria | 1029 |
| 253 | Ga0495613_0013443 | 3300046689 | Bacteria | 6080 |
| 254 | Ga0495670_0069287 | 3300046691 | Bacteria | 1783 |
| 255 | Ga0495670_0250356 | 3300046691 | Bacteria | 944 |
| 256 | Ga0495671_0463496 | 3300046692 | Bacteria | 605 |
| 257 | Ga0495672_0334128 | 3300047320 | Bacteria | 708 |
| 258 | Ga0495683_0250087 | 3300047323 | Bacteria | 778 |
| 259 | Ga0495686_0001958 | 3300047472 | Bacteria | 20461 |
| 260 | Ga0495686_0021994 | 3300047472 | Bacteria | 4223 |
| 261 | Ga0496100_0212702 | 3300048903 | Bacteria | 1415 |
| 262 | Ga0496102_0017132 | 3300048905 | Bacteria | 6344 |
| 263 | Ga0496102_0080447 | 3300048905 | Bacteria | 3002 |
| 264 | Ga0496103_0602569 | 3300048906 | Bacteria | 700 |
| 265 | Ga0496104_0551374 | 3300048907 | Bacteria | 1064 |
| 266 | Ga0496106_0147379 | 3300048909 | Bacteria | 1855 |
| 267 | Ga0496107_0264830 | 3300048910 | Bacteria | 1279 |
| 268 | Ga0496113_0152819 | 3300048916 | Bacteria | 1822 |
| 269 | Ga0496115_0715128 | 3300048918 | Bacteria | 786 |
| 270 | Ga0496117_0040521 | 3300048920 | Bacteria | 3424 |
| 271 | Ga0496118_0002461 | 3300048921 | Bacteria | 24906 |
| 272 | Ga0496119_0090934 | 3300048922 | Bacteria | 1734 |
| 273 | Ga0496121_0000053 | 3300048924 | Bacteria | 312611 |
| 274 | Ga0496124_0010685 | 3300048927 | Bacteria | 9261 |
| 275 | Ga0496125_0027084 | 3300048928 | Bacteria | 5205 |
| 276 | Ga0496126_0001854 | 3300048929 | Bacteria | 30807 |
| 277 | Ga0495678_001041 | 3300049459 | Bacteria | 23510 |
| 278 | Ga0501033_0001020 | 3300049570 | Bacteria | 25444 |
| 279 | Ga0501034_0919734 | 3300049571 | Bacteria | 762 |
| 280 | Ga0501034_1620365 | 3300049571 | Bacteria | 520 |
| 281 | Ga0501037_0758436 | 3300049573 | Bacteria | 643 |
| 282 | Ga0501043_0296837 | 3300049579 | Bacteria | 1236 |
| 283 | Ga0501047_0037496 | 3300049581 | Bacteria | 4687 |
| 284 | Ga0501047_0276943 | 3300049581 | Bacteria | 1523 |
| 285 | Ga0501047_0323437 | 3300049581 | Bacteria | 1382 |
| 286 | Ga0501047_0767950 | 3300049581 | Bacteria | 779 |
| 287 | Ga0501048_1210031 | 3300049582 | Bacteria | 543 |
| 288 | Ga0501069_1005844 | 3300049585 | Bacteria | 509 |
| 289 | Ga0501070_1053932 | 3300049586 | Bacteria | 629 |
| 290 | Ga0501071_0274240 | 3300049587 | Bacteria | 1276 |
| 291 | Ga0501252_079448 | 3300049682 | Bacteria | 541 |
| 292 | Ga0501257_001529 | 3300049686 | Bacteria | 4826 |
| 293 | Ga0501035_0000612 | 3300049822 | Bacteria | 39349 |
| 294 | Ga0501035_0027083 | 3300049822 | Bacteria | 5241 |
| 295 | Ga0501035_0378572 | 3300049822 | Bacteria | 1181 |
| 296 | Ga0501035_0712134 | 3300049822 | Bacteria | 809 |
| 297 | Ga0501044_0017867 | 3300049823 | Bacteria | 7608 |
| 298 | Ga0501044_0544716 | 3300049823 | Bacteria | 1058 |
| 299 | nmdc:mga03683_550436_c1 | 3300050489 | Bacteria | 562 |
| 300 | nmdc:mga03n38_728657_c1 | 3300050490 | Bacteria | 573 |
| 301 | nmdc:mga0k408_563276_c1 | 3300050493 | Bacteria | 673 |
| 302 | nmdc:mga0k408_570782_c1 | 3300050493 | Bacteria | 668 |
| 303 | nmdc:mga0k408_88202_c1 | 3300050493 | Bacteria | 1822 |
| 304 | nmdc:mga07m45_385564_c1 | 3300050496 | Bacteria | 814 |
| 305 | nmdc:mga0sz30_3025_c1 | 3300050516 | Bacteria | 6025 |
| 306 | Ga0500578_0000309 | 3300053086 | Bacteria | 59973 |
| 307 | Ga0500643_037409 | 3300053087 | Bacteria | 1445 |
| 308 | Ga0500641_0218043 | 3300053096 | Bacteria | 810 |
| 309 | Ga0500650_0129004 | 3300053098 | Bacteria | 1176 |
| 310 | Ga0500556_0032669 | 3300053104 | Bacteria | 1780 |
| 311 | Ga0500562_000770 | 3300053108 | Bacteria | 7798 |
| 312 | Ga0500594_0000456 | 3300053118 | Bacteria | 9009 |
| 313 | Ga0500594_0300521 | 3300053118 | Bacteria | 538 |
| 314 | Ga0500595_007363 | 3300053119 | Bacteria | 4572 |
| 315 | Ga0500595_033943 | 3300053119 | Bacteria | 1691 |
| 316 | Ga0500642_0165812 | 3300053130 | Bacteria | 1035 |
| 317 | Ga0500559_0000018 | 3300053136 | Bacteria | 140924 |
| 318 | Ga0500559_0048744 | 3300053136 | Bacteria | 1864 |
| 319 | Ga0500603_196675 | 3300053150 | Bacteria | 638 |
| 320 | Ga0500616_0137727 | 3300053153 | Bacteria | 1145 |
| 321 | Ga0500622_0001059 | 3300053156 | Bacteria | 22916 |
| 322 | Ga0500622_0003258 | 3300053156 | Bacteria | 11015 |
| 323 | Ga0500636_0094200 | 3300053177 | Bacteria | 1711 |
| 324 | Ga0500611_126872 | 3300053727 | Bacteria | 684 |
| 325 | Ga0500609_000806 | 3300053731 | Bacteria | 4709 |
| 326 | Ga0466962_0589339 | 3300061719 | Bacteria | 566 |
| 327 | 2585146486 | 2582581279 | Bacteria | 4980720 |
| 328 | 2585151921 | 2582581280 | Bacteria | 5994497 |
| 329 | 2585194594 | 2582581293 | Bacteria | 5907401 |
| 330 | 2587918447 | 2585428106 | Bacteria | 5179711 |
| 331 | 2643779518 | 2643221552 | Bacteria | 5708754 |
| 332 | 2643931087 | 2643221584 | Bacteria | 5511711 |
| 333 | 2644224991 | 2643221640 | Bacteria | 5258820 |
| 334 | 2644234075 | 2643221642 | Bacteria | 5357871 |
| 335 | 2739351891 | 2738543031 | Bacteria | 5769731 |
| 336 | 2739793554 | 2739367756 | Bacteria | 4553612 |
| 337 | 2819537401 | 2818991435 | Bacteria | 5433759 |
| 338 | 2819646537 | 2818991454 | Bacteria | 5563326 |
| 339 | 2849561863 | 2849560528 | Bacteria | 5393480 |
| 340 | 2849574073 | 2849573788 | Bacteria | 5421256 |
| 341 | 2851157751 | 2851153111 | Bacteria | 5542585 |
| 342 | 2857505356 | 2857504554 | Bacteria | 5369913 |
| 343 | 2884962382 | 2884960567 | Bacteria | 5437054 |
| 344 | 2898332600 | 2898329390 | Bacteria | 5168154 |
| 345 | 2917554352 | 2917554339 | Bacteria | 4987857 |
| 346 | Ga0105237_10344483 | |||
| 347 | JGI25153J46596_10025167 | |||
| 348 | rootH1_10061495 | |||
| 349 | rootH1_10200505 | |||
| 350 | Ga0055526_1039995 | |||
| 351 | Ga0055528_1077528 | |||
| 352 | Ga0055531_10007308 | |||
| 353 | Ga0065165_1001479 | |||
| 354 | Ga0070658_10628610 | |||
| 355 | Ga0070683_101289801 | |||
| 356 | Ga0070690_100955567 | |||
| 357 | Ga0070670_100000044 | |||
| 358 | Ga0070677_10251793 | |||
| 359 | Ga0070666_10051109 | |||
| 360 | Ga0070680_100249486 | |||
| 361 | Ga0070680_100881832 | |||
| 362 | Ga0070668_100009428 | |||
| 363 | Ga0070675_100597185 | |||
| 364 | Ga0070671_101017382 | |||
| 365 | Ga0070671_101982008 | |||
| 366 | Ga0070688_100932964 | |||
| 367 | Ga0070667_100000231 | |||
| 368 | Ga0070710_11490436 | |||
| 369 | Ga0070681_10359767 | |||
| 370 | Ga0068867_101316858 | |||
| 371 | Ga0070679_100398151 | |||
| 372 | Ga0070679_100966011 | |||
| 373 | Ga0070684_101843623 | |||
| 374 | Ga0068853_100609825 | |||
| 375 | Ga0068853_100999923 | |||
| 376 | Ga0070686_101478194 | |||
| 377 | Ga0070665_100023700 | |||
| 378 | Ga0070665_100785583 | |||
| 379 | Ga0068855_101115619 | |||
| 380 | Ga0068855_101602300 | |||
| 381 | Ga0068855_102328022 | |||
| 382 | Ga0068857_101314122 | |||
| 383 | Ga0068856_101141803 | |||
| 384 | Ga0068864_100000060 | |||
| 385 | Ga0068864_100000061 | |||
| 386 | Ga0068861_100297172 | |||
| 387 | Ga0068863_100000023 | |||
| 388 | Ga0068863_100000810 | |||
| 389 | Ga0068863_102547095 | |||
| 390 | Ga0068858_100000184 | |||
| 391 | Ga0068858_100016611 | |||
| 392 | Ga0068858_101066805 | |||
| 393 | Ga0068858_101513781 | |||
| 394 | Ga0068860_100000122 | |||
| 395 | Ga0068862_100008565 | |||
| 396 | Ga0070717_10410931 | |||
| 397 | Ga0075365_10779952 | |||
| 398 | Ga0075363_100500585 | |||
| 399 | Ga0075362_10151526 | |||
| 400 | Ga0075369_10014755 | |||
| 401 | Ga0075366_10012447 | |||
| 402 | Ga0075366_10369032 | |||
| 403 | Ga0075366_10578785 | |||
| 404 | Ga0097621_100608658 | |||
| 405 | Ga0097621_102028580 | |||
| 406 | Ga0075370_10075937 | |||
| 407 | Ga0075370_10155076 | |||
| 408 | Ga0068865_100697297 | |||
| 409 | Ga0079104_1011116 | |||
| 410 | Ga0105251_10154474 | |||
| 411 | Ga0105250_10013505 | |||
| 412 | Ga0105240_10000679 | |||
| 413 | Ga0105247_10240306 | |||
| 414 | Ga0105241_11552728 | |||
| 415 | Ga0105242_11864815 | |||
| 416 | Ga0105248_10000279 | |||
| 417 | Ga0105248_10011043 | |||
| 418 | Ga0105248_10043124 | |||
| 419 | Ga0105237_12348448 | |||
| 420 | Ga0105238_10412310 | |||
| 421 | Ga0105238_10521929 | |||
| 422 | Ga0105238_10797809 | |||
| 423 | Ga0105238_12933915 | |||
| 424 | Ga0105249_10000872 | |||
| 425 | Ga0105239_10117107 | |||
| 426 | Ga0105239_10158490 | |||
| 427 | Ga0105239_11396112 | |||
| 428 | Ga0105239_11938443 | |||
| 429 | Ga0157325_1006923 | |||
| 430 | Ga0157322_1045316 | |||
| 431 | Ga0157347_1036051 | |||
| 432 | Ga0157370_10395958 | |||
| 433 | Ga0157369_10642213 | |||
| 434 | Ga0157374_12165084 | |||
| 435 | Ga0157378_12895561 | |||
| 436 | Ga0157372_10918826 | |||
| 437 | Ga0157372_11277012 | |||
| 438 | Ga0157375_10829591 | |||
| 439 | Ga0157375_11835039 | |||
| 440 | Ga0157375_12790628 | |||
| 441 | Ga0163163_10516295 | |||
| 442 | Ga0157380_12243399 | |||
| 443 | Ga0157377_10960188 | |||
| 444 | Ga0157379_10035088 | |||
| 445 | Ga0157379_10126720 | |||
| 446 | Ga0157379_10405800 | |||
| 447 | Ga0157376_11813469 | |||
| 448 | Ga0157376_11968336 | |||
| 449 | Ga0163161_11446846 | |||
| 450 | Ga0213874_10004764 | |||
| 451 | Ga0213876_10000074 | |||
| 452 | Ga0213876_10434673 | |||
| 453 | Ga0213875_10088546 | |||
| 454 | Ga0213875_10125969 | |||
| 455 | Ga0209564_1006888 | |||
| 456 | Ga0209758_1002274 | |||
| 457 | Ga0209050_1057327 | |||
| 458 | Ga0209256_1002598 | |||
| 459 | Ga0209257_1000036 | |||
| 460 | Ga0207696_1151122 | |||
| 461 | Ga0207642_10735833 | |||
| 462 | Ga0207710_10046909 | |||
| 463 | Ga0207680_10014890 | |||
| 464 | Ga0207680_10323450 | |||
| 465 | Ga0207645_10294772 | |||
| 466 | Ga0207705_10440288 | |||
| 467 | Ga0207705_10468389 | |||
| 468 | Ga0207654_11102947 | |||
| 469 | Ga0207695_10002817 | |||
| 470 | Ga0207671_11048495 | |||
| 471 | Ga0207660_11231659 | |||
| 472 | Ga0207652_10848124 | |||
| 473 | Ga0207681_10865425 | |||
| 474 | Ga0207694_10260184 | |||
| 475 | Ga0207694_10482607 | |||
| 476 | Ga0207694_11707139 | |||
| 477 | Ga0207650_10000065 | |||
| 478 | Ga0207659_10712066 | |||
| 479 | Ga0207686_11402178 | |||
| 480 | Ga0207670_10785181 | |||
| 481 | Ga0207711_10000732 | |||
| 482 | Ga0207711_10022802 | |||
| 483 | Ga0207711_10338508 | |||
| 484 | Ga0207689_10254434 | |||
| 485 | Ga0207689_10429657 | |||
| 486 | Ga0207661_10752959 | |||
| 487 | Ga0207667_10811337 | |||
| 488 | Ga0207667_11281351 | |||
| 489 | Ga0207667_12113225 | |||
| 490 | Ga0207712_10000478 | |||
| 491 | Ga0207668_10000340 | |||
| 492 | Ga0207640_10809771 | |||
| 493 | Ga0207658_10000168 | |||
| 494 | Ga0207703_10000273 | |||
| 495 | Ga0207703_10011280 | |||
| 496 | Ga0207703_10244740 | |||
| 497 | Ga0207639_11272170 | |||
| 498 | Ga0207678_10800048 | |||
| 499 | Ga0207702_10636259 | |||
| 500 | Ga0207641_10000067 | |||
| 501 | Ga0207641_10001551 | |||
| 502 | Ga0207641_11753489 | |||
| 503 | Ga0207648_10428999 | |||
| 504 | Ga0207676_10000127 | |||
| 505 | Ga0207676_10000501 | |||
| 506 | Ga0207675_100315124 | |||
| 507 | Ga0209281_1012517 | |||
| 508 | Ga0268266_10003074 | |||
| 509 | Ga0268266_10639615 | |||
| 510 | Ga0268265_10001199 | |||
| 511 | Ga0268265_12194679 | |||
| 512 | Ga0268264_10000172 | |||
| 513 | Ga0307517_10027467 | |||
| 514 | Ga0307517_10257858 | |||
| 515 | Ga0307515_10035485 | |||
| 516 | Ga0265338_10048201 | |||
| 517 | Ga0265330_10305262 | |||
| 518 | Ga0265327_10000454 | |||
| 519 | Ga0265316_10082871 | |||
| 520 | Ga0307513_10007633 | |||
| 521 | Ga0307508_10308175 | |||
| 522 | Ga0307516_10000020 | |||
| 523 | Ga0307413_10399606 | |||
| 524 | Ga0307407_11310902 | |||
| 525 | Ga0307412_11402829 | |||
| 526 | Ga0307412_12098167 | |||
| 527 | Ga0307409_100643494 | |||
| 528 | Ga0307409_101253000 | |||
| 529 | Ga0307414_10342226 | |||
| 530 | Ga0307411_10139130 | |||
| 531 | Ga0307411_10144816 | |||
| 532 | Ga0373936_0071426 | |||
| 533 | Ga0395899_0000003 | |||
| 534 | Ga0395899_0193431 | |||
| 535 | Ga0395899_0323395 | |||
| 536 | Ga0395900_0114155 | |||
| 537 | Ga0395900_0176571 | |||
| 538 | Ga0395900_0316364 | |||
| 539 | Ga0395900_0671682 | |||
| 540 | Ga0395898_0070959 | |||
| 541 | Ga0395898_0394066 | |||
| 542 | Ga0395898_0487653 | |||
| 543 | Ga0395898_1670193 | |||
| 544 | Ga0395905_0000022 | |||
| 545 | Ga0395905_0378517 | |||
| 546 | Ga0395905_0477935 | |||
| 547 | Ga0395905_0484083 | |||
| 548 | Ga0395905_1066385 | |||
| 549 | Ga0395905_1746481 | |||
| 550 | Ga0436364_0679205 | |||
| 551 | Ga0436364_0822348 | |||
| 552 | Ga0395901_0118281 | |||
| 553 | Ga0395901_0390198 | |||
| 554 | Ga0395901_0747446 | |||
| 555 | Ga0436365_1728448 | |||
| 556 | Ga0436365_1797099 | |||
| 557 | Ga0436363_0503229 | |||
| 558 | Ga0451841_0995997 | |||
| 559 | Ga0451849_1453555 | |||
| 560 | Ga0451853_0707576 | |||
| 561 | Ga0439441_016870 | |||
| 562 | Ga0450890_060102 | |||
| 563 | Ga0439435_0021734 | |||
| 564 | Ga0439459_0041209 | |||
| 565 | Ga0466969_0344902 | |||
| 566 | Ga0466970_0306747 | |||
| 567 | Ga0466960_0570101 | |||
| 568 | Ga0466959_0075831 | |||
| 569 | Ga0466959_0079301 | |||
| 570 | Ga0495617_061289 | |||
| 571 | Ga0495590_0004604 | |||
| 572 | Ga0495638_0002411 | |||
| 573 | Ga0495638_0006686 | |||
| 574 | Ga0495638_0017416 | |||
| 575 | Ga0495638_0234905 | |||
| 576 | Ga0495650_0120372 | |||
| 577 | Ga0495664_0819080 | |||
| 578 | Ga0495585_0559107 | |||
| 579 | Ga0495594_0219018 | |||
| 580 | Ga0495607_0493102 | |||
| 581 | Ga0495606_0187742 | |||
| 582 | Ga0495610_0003215 | |||
| 583 | Ga0495610_0008833 | |||
| 584 | Ga0495610_0054306 | |||
| 585 | Ga0495616_0002094 | |||
| 586 | Ga0495631_0000827 | |||
| 587 | Ga0495632_0001771 | |||
| 588 | Ga0495632_0048616 | |||
| 589 | Ga0495637_0034782 | |||
| 590 | Ga0495648_0244029 | |||
| 591 | Ga0495654_0181832 | |||
| 592 | Ga0495598_0071356 | |||
| 593 | Ga0495609_0325228 | |||
| 594 | Ga0495668_0001352 | |||
| 595 | Ga0495668_0022043 | |||
| 596 | Ga0495625_0299735 | |||
| 597 | Ga0495613_0013443 | |||
| 598 | Ga0495670_0069287 | |||
| 599 | Ga0495670_0250356 | |||
| 600 | Ga0495671_0463496 | |||
| 601 | Ga0495672_0334128 | |||
| 602 | Ga0495683_0250087 | |||
| 603 | Ga0495686_0001958 | |||
| 604 | Ga0495686_0021994 | |||
| 605 | Ga0496100_0212702 | |||
| 606 | Ga0496102_0017132 | |||
| 607 | Ga0496102_0080447 | |||
| 608 | Ga0496103_0602569 | |||
| 609 | Ga0496104_0551374 | |||
| 610 | Ga0496106_0147379 | |||
| 611 | Ga0496107_0264830 | |||
| 612 | Ga0496113_0152819 | |||
| 613 | Ga0496115_0715128 | |||
| 614 | Ga0496117_0040521 | |||
| 615 | Ga0496118_0002461 | |||
| 616 | Ga0496119_0090934 | |||
| 617 | Ga0496121_0000053 | |||
| 618 | Ga0496124_0010685 | |||
| 619 | Ga0496125_0027084 | |||
| 620 | Ga0496126_0001854 | |||
| 621 | Ga0495678_001041 | |||
| 622 | Ga0501033_0001020 | |||
| 623 | Ga0501034_0919734 | |||
| 624 | Ga0501034_1620365 | |||
| 625 | Ga0501037_0758436 | |||
| 626 | Ga0501043_0296837 | |||
| 627 | Ga0501047_0037496 | |||
| 628 | Ga0501047_0276943 | |||
| 629 | Ga0501047_0323437 | |||
| 630 | Ga0501047_0767950 | |||
| 631 | Ga0501048_1210031 | |||
| 632 | Ga0501069_1005844 | |||
| 633 | Ga0501070_1053932 | |||
| 634 | Ga0501071_0274240 | |||
| 635 | Ga0501252_079448 | |||
| 636 | Ga0501257_001529 | |||
| 637 | Ga0501035_0000612 | |||
| 638 | Ga0501035_0027083 | |||
| 639 | Ga0501035_0378572 | |||
| 640 | Ga0501035_0712134 | |||
| 641 | Ga0501044_0017867 | |||
| 642 | Ga0501044_0544716 | |||
| 643 | nmdc:mga03683_550436_c1 | |||
| 644 | nmdc:mga03n38_728657_c1 | |||
| 645 | nmdc:mga0k408_563276_c1 | |||
| 646 | nmdc:mga0k408_570782_c1 | |||
| 647 | nmdc:mga0k408_88202_c1 | |||
| 648 | nmdc:mga07m45_385564_c1 | |||
| 649 | nmdc:mga0sz30_3025_c1 | |||
| 650 | Ga0500578_0000309 | |||
| 651 | Ga0500643_037409 | |||
| 652 | Ga0500641_0218043 | |||
| 653 | Ga0500650_0129004 | |||
| 654 | Ga0500556_0032669 | |||
| 655 | Ga0500562_000770 | |||
| 656 | Ga0500594_0000456 | |||
| 657 | Ga0500594_0300521 | |||
| 658 | Ga0500595_007363 | |||
| 659 | Ga0500595_033943 | |||
| 660 | Ga0500642_0165812 | |||
| 661 | Ga0500559_0000018 | |||
| 662 | Ga0500559_0048744 | |||
| 663 | Ga0500603_196675 | |||
| 664 | Ga0500616_0137727 | |||
| 665 | Ga0500622_0001059 | |||
| 666 | Ga0500622_0003258 | |||
| 667 | Ga0500636_0094200 | |||
| 668 | Ga0500611_126872 | |||
| 669 | Ga0500609_000806 | |||
| 670 | Ga0466962_0589339 | |||
| 671 | 2585146486 | |||
| 672 | 2585151921 | |||
| 673 | 2585194594 | |||
| 674 | 2587918447 | |||
| 675 | 2643779518 | |||
| 676 | 2643931087 | |||
| 677 | 2644224991 | |||
| 678 | 2644234075 | |||
| 679 | 2739351891 | |||
| 680 | 2739793554 | |||
| 681 | 2819537401 | |||
| 682 | 2819646537 | |||
| 683 | 2849561863 | |||
| 684 | 2849574073 | |||
| 685 | 2851157751 | |||
| 686 | 2857505356 | |||
| 687 | 2884962382 | |||
| 688 | 2898332600 | |||
| 689 | 2917554352 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tr1-assembly1.cif.gz_A | crystal structure of gsh-bound cgrx2/c15s | 0.9715 | 1 | 82 |
| 4tr0-assembly2.cif.gz_B | crystal structure of gssg-bound cgrx2 | 0.9713 | 1 | 83 |
| 4mjb-assembly1.cif.gz_A | synechocystis sp. pcc 6803 glutaredoxin a-a79s | 0.9675 | 2 | 84 |
| 4mja-assembly1.cif.gz_A | synechocystis sp. pcc 6803 glutaredoxin a-a75i | 0.9667 | 2 | 84 |
| 4mjc-assembly1.cif.gz_A | synechocystis sp. pcc 6803 glutaredoxin a - p84r | 0.9659 | 2 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4tr0B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9707 | 1 | 83 | 3.40.30.10 |
| af_A0A1D6GDU0_1_74_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9519 | 14 | 82 | 3.40.30.10 |
| 4tr0B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9373 | 1 | 83 | 3.40.30.10 |
| af_A0A368UIM3_131_233_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9334 | 2 | 83 | 3.40.30.10 |
| af_A4HRD2_90_192_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.929 | 4 | 83 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C4WJ81-F1-model_v4 | Glutaredoxin | 1 | 1 | 82 |
GO:0005737
GO:0009055 GO:0015038 GO:0045454 |
| AF-A0A0V2F9N0-F1-model_v4 | deleted | 0.9986 | 1 | 84 |
|
| AF-M5JWE0-F1-model_v4 | Glutaredoxin | 0.9959 | 1 | 84 |
GO:0005737
GO:0009055 GO:0015038 GO:0045454 |
| AF-A0A2W4X7L1-F1-model_v4 | Glutaredoxin | 0.9946 | 1 | 84 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A3D2W0R6-F1-model_v4 | Glutaredoxin | 0.9923 | 1 | 83 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |