F415511

General Info

Members Datasets Scaffolds Average Seq Length
343 231 686 130

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100253433|Ga0075363_1002534332
Length 146
Sequence MPNNNSKNEQSGRFAYDGLDRVIHEKARLGVLTSLIAHPKGVVFGDLKKMCALTDGNLSRHLQVLEEAKLIEIEKGYDHNRPQTICRITAQGRQRYLGYLKVLEQVVRDAARAAKTPSQDRHSPGRGVAGPGQAEDDLKFFYMETL

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
130 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 1.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.58
Nodule 0
Rhizoplane 2.33
Rhizosphere 87.46
Stem 0
Stem Tuber 0
Unclassified 9.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100253433 3300006048 Bacteria 1014
2 LJNas_1005231 3300000546 Unclassified 1420
3 JGI25406J46586_10128036 3300003203 Bacteria 745
4 JGI25404J52841_10024494 3300003659 Bacteria 1300
5 Ga0065715_10045344 3300005293 Bacteria 1370
6 Ga0070676_10049418 3300005328 Bacteria 2462
7 Ga0070676_10680085 3300005328 Unclassified 750
8 Ga0070690_100693367 3300005330 Bacteria 781
9 Ga0070677_10019102 3300005333 Bacteria 2478
10 Ga0070666_10460959 3300005335 Bacteria 919
11 Ga0068868_100602477 3300005338 Bacteria 973
12 Ga0070689_100107618 3300005340 Bacteria 2214
13 Ga0070689_100538926 3300005340 Bacteria 1004
14 Ga0070691_10008547 3300005341 Bacteria 4689
15 Ga0070691_10017357 3300005341 Bacteria 3311
16 Ga0070687_100454979 3300005343 Unclassified 852
17 Ga0070692_10088511 3300005345 Unclassified 1680
18 Ga0070668_101219814 3300005347 Bacteria 682
19 Ga0070668_101348806 3300005347 Unclassified 649
20 Ga0070675_100307024 3300005354 Bacteria 1399
21 Ga0070674_100231279 3300005356 Unclassified 1443
22 Ga0070673_100002817 3300005364 Bacteria 10694
23 Ga0070688_100807572 3300005365 Bacteria 734
24 Ga0070703_10228642 3300005406 Unclassified 744
25 Ga0070703_10257774 3300005406 Bacteria 710
26 Ga0070709_10306512 3300005434 Bacteria 1161
27 Ga0070714_100592561 3300005435 Bacteria 1064
28 Ga0070713_100338872 3300005436 Bacteria 1393
29 Ga0070705_100290647 3300005440 Unclassified 1167
30 Ga0070700_100076986 3300005441 Bacteria 2144
31 Ga0070700_100114990 3300005441 Unclassified 1795
32 Ga0070700_100260340 3300005441 Bacteria 1249
33 Ga0070700_101195961 3300005441 Bacteria 634
34 Ga0070663_100281398 3300005455 Bacteria 1326
35 Ga0070663_101898069 3300005455 Bacteria 535
36 Ga0070678_100042129 3300005456 Bacteria 3243
37 Ga0070662_100264545 3300005457 Bacteria 1386
38 Ga0068867_100036375 3300005459 Bacteria 3574
39 Ga0070685_10613502 3300005466 Bacteria 784
40 Ga0070706_100102487 3300005467 Bacteria 2661
41 Ga0070698_100060953 3300005471 Bacteria 3806
42 Ga0070697_101472564 3300005536 Unclassified 608
43 Ga0070672_100121971 3300005543 Bacteria 2134
44 Ga0070686_100098057 3300005544 Bacteria 1974
45 Ga0070695_100053872 3300005545 Bacteria 2587
46 Ga0070695_100251542 3300005545 Unclassified 1286
47 Ga0070696_100138400 3300005546 Unclassified 1777
48 Ga0070696_100319764 3300005546 Bacteria 1194
49 Ga0070693_100060275 3300005547 Bacteria 2202
50 Ga0070665_100399015 3300005548 Bacteria 1383
51 Ga0070704_100182542 3300005549 Bacteria 1679
52 Ga0068855_100765931 3300005563 Bacteria 1028
53 Ga0068855_102010479 3300005563 Bacteria 584
54 Ga0070664_101167993 3300005564 Bacteria 726
55 Ga0068856_100335368 3300005614 Bacteria 1530
56 Ga0070702_100078097 3300005615 Bacteria 1975
57 Ga0070702_100589493 3300005615 Bacteria 831
58 Ga0068852_100127803 3300005616 Bacteria 2336
59 Ga0068864_100217326 3300005618 Bacteria 1762
60 Ga0068864_100261140 3300005618 Bacteria 1611
61 Ga0068864_100862087 3300005618 Unclassified 893
62 Ga0068866_10162287 3300005718 Bacteria 1304
63 Ga0068866_10228919 3300005718 Bacteria 1126
64 Ga0068866_10542823 3300005718 Bacteria 776
65 Ga0068866_10939215 3300005718 Bacteria 611
66 Ga0068861_100019879 3300005719 Bacteria 4801
67 Ga0068861_100416388 3300005719 Bacteria 1196
68 Ga0068861_101419993 3300005719 Bacteria 678
69 Ga0068863_100158909 3300005841 Bacteria 2165
70 Ga0068858_100366994 3300005842 Bacteria 1380
71 Ga0068858_100450369 3300005842 Bacteria 1240
72 Ga0068860_101601438 3300005843 Bacteria 673
73 Ga0068862_100266242 3300005844 Bacteria 1566
74 Ga0068862_101126769 3300005844 Bacteria 781
75 Ga0081540_1000257 3300005983 Bacteria 55989
76 Ga0081540_1000266 3300005983 Bacteria 54692
77 Ga0081540_1003585 3300005983 Bacteria 12196
78 Ga0081539_10160800 3300005985 Bacteria 1070
79 Ga0075365_10743475 3300006038 Bacteria 693
80 Ga0075368_10474971 3300006042 Bacteria 556
81 Ga0075363_100188458 3300006048 Bacteria 1176
82 Ga0075362_10035416 3300006177 Bacteria 2179
83 Ga0075367_10002887 3300006178 Bacteria 8000
84 Ga0075367_10399958 3300006178 Bacteria 869
85 Ga0075367_10876858 3300006178 Bacteria 572
86 Ga0075366_10004716 3300006195 Bacteria 7341
87 Ga0097621_101940919 3300006237 Bacteria 562
88 Ga0075428_100002996 3300006844 Bacteria 18423
89 Ga0075428_100025820 3300006844 Bacteria 6505
90 Ga0075428_100256683 3300006844 Bacteria 1883
91 Ga0075428_100622081 3300006844 Bacteria 1153
92 Ga0075428_100761467 3300006844 Bacteria 1030
93 Ga0075430_100000297 3300006846 Bacteria 35046
94 Ga0075430_100087679 3300006846 Bacteria 2604
95 Ga0075431_100001175 3300006847 Bacteria 23613
96 Ga0075431_100121845 3300006847 Bacteria 2691
97 Ga0075431_100132952 3300006847 Bacteria 2565
98 Ga0075431_100755262 3300006847 Bacteria 948
99 Ga0075433_10060438 3300006852 Bacteria 3318
100 Ga0075433_10254382 3300006852 Bacteria 1558
101 Ga0075433_10378151 3300006852 Bacteria 1250
102 Ga0075434_100209895 3300006871 Bacteria 1967
103 Ga0075434_100221931 3300006871 Bacteria 1910
104 Ga0075434_100308263 3300006871 Bacteria 1603
105 Ga0075434_100820176 3300006871 Bacteria 946
106 Ga0075434_100973231 3300006871 Bacteria 863
107 Ga0075429_100107337 3300006880 Bacteria 2440
108 Ga0075429_100593112 3300006880 Bacteria 971
109 Ga0075429_100870166 3300006880 Bacteria 789
110 Ga0068865_100271300 3300006881 Bacteria 1347
111 Ga0075436_100095412 3300006914 Bacteria 2069
112 Ga0097620_101850332 3300006931 Bacteria 667
113 Ga0075435_100058310 3300007076 Bacteria 3126
114 Ga0075435_100102021 3300007076 Bacteria 2378
115 Ga0075435_100117146 3300007076 Bacteria 2220
116 Ga0075435_100262706 3300007076 Bacteria 1471
117 Ga0099794_10040925 3300007265 Bacteria 2205
118 Ga0099795_10000082 3300007788 Bacteria 16634
119 Ga0099795_10132913 3300007788 Bacteria 1006
120 Ga0111539_10020004 3300009094 Bacteria 8246
121 Ga0111539_10054666 3300009094 Bacteria 4749
122 Ga0111539_10606946 3300009094 Bacteria 1274
123 Ga0111539_12997773 3300009094 Unclassified 546
124 Ga0105245_10057076 3300009098 Bacteria 3511
125 Ga0105245_12625608 3300009098 Bacteria 557
126 Ga0114129_10770933 3300009147 Bacteria 1229
127 Ga0114129_12634455 3300009147 Bacteria 600
128 Ga0105243_10096577 3300009148 Bacteria 2445
129 Ga0105243_10425018 3300009148 Bacteria 1240
130 Ga0105243_10491490 3300009148 Bacteria 1161
131 Ga0105241_10031061 3300009174 Bacteria 3996
132 Ga0105241_10880217 3300009174 Bacteria 830
133 Ga0105242_10059810 3300009176 Bacteria 3127
134 Ga0105248_10046910 3300009177 Bacteria 4845
135 Ga0105238_10291846 3300009551 Bacteria 1613
136 Ga0105238_11592827 3300009551 Bacteria 683
137 Ga0105249_10631577 3300009553 Bacteria 1127
138 Ga0099796_10002118 3300010159 Bacteria 4265
139 Ga0105239_10684262 3300010375 Bacteria 1172
140 Ga0157374_10530769 3300013296 Bacteria 1183
141 Ga0157378_11324297 3300013297 Unclassified 762
142 Ga0157378_11509219 3300013297 Bacteria 717
143 Ga0157380_10236383 3300014326 Bacteria 1644
144 Ga0157380_10521022 3300014326 Bacteria 1159
145 Ga0157379_10019818 3300014968 Bacteria 5943
146 Ga0163161_10160063 3300017792 Bacteria 1716
147 Ga0163161_11337944 3300017792 Bacteria 624
148 Ga0213874_10101880 3300021377 Bacteria 955
149 Ga0213876_10196252 3300021384 Bacteria 1073
150 Ga0209758_1000251 3300025297 Bacteria 108814
151 Ga0209758_1019772 3300025297 Bacteria 3227
152 Ga0207697_10501814 3300025315 Bacteria 536
153 Ga0207656_10135264 3300025321 Bacteria 1158
154 Ga0207699_10296852 3300025906 Bacteria 1127
155 Ga0207699_11465511 3300025906 Bacteria 505
156 Ga0207645_10005036 3300025907 Bacteria 9679
157 Ga0207684_10382748 3300025910 Bacteria 1210
158 Ga0207662_10030945 3300025918 Bacteria 3109
159 Ga0207662_10553711 3300025918 Bacteria 797
160 Ga0207681_10200185 3300025923 Bacteria 1533
161 Ga0207694_10780058 3300025924 Bacteria 807
162 Ga0207650_11640995 3300025925 Bacteria 545
163 Ga0207659_10070578 3300025926 Bacteria 2548
164 Ga0207687_10066499 3300025927 Bacteria 2562
165 Ga0207687_11612146 3300025927 Bacteria 557
166 Ga0207700_10152050 3300025928 Bacteria 1914
167 Ga0207664_10417481 3300025929 Bacteria 1195
168 Ga0207644_10065558 3300025931 Bacteria 2641
169 Ga0207644_10613165 3300025931 Bacteria 904
170 Ga0207706_10022207 3300025933 Bacteria 5695
171 Ga0207686_10226819 3300025934 Bacteria 1352
172 Ga0207709_10122699 3300025935 Bacteria 1757
173 Ga0207669_10252533 3300025937 Unclassified 1314
174 Ga0207669_10697640 3300025937 Bacteria 834
175 Ga0207665_10185745 3300025939 Bacteria 1508
176 Ga0207691_10015367 3300025940 Bacteria 7283
177 Ga0207691_10619040 3300025940 Bacteria 916
178 Ga0207711_10132477 3300025941 Bacteria 2236
179 Ga0207689_10052121 3300025942 Bacteria 3372
180 Ga0207689_10347506 3300025942 Bacteria 1233
181 Ga0207667_10535876 3300025949 Bacteria 1185
182 Ga0207651_10012146 3300025960 Bacteria 4858
183 Ga0207640_10045585 3300025981 Bacteria 2816
184 Ga0207658_10859998 3300025986 Bacteria 825
185 Ga0207639_10468297 3300026041 Bacteria 1147
186 Ga0207678_10607332 3300026067 Bacteria 959
187 Ga0207708_10012458 3300026075 Bacteria 6338
188 Ga0207708_10119663 3300026075 Bacteria 2052
189 Ga0207702_11042166 3300026078 Bacteria 812
190 Ga0207641_10256344 3300026088 Bacteria 1636
191 Ga0207648_10068795 3300026089 Bacteria 3085
192 Ga0207676_10245134 3300026095 Bacteria 1610
193 Ga0207676_10512760 3300026095 Bacteria 1140
194 Ga0207675_100024735 3300026118 Bacteria 5585
195 Ga0207675_100121406 3300026118 Unclassified 2472
196 Ga0207675_100204791 3300026118 Bacteria 1896
197 Ga0207683_10196261 3300026121 Bacteria 1834
198 Ga0209813_10129508 3300027866 Bacteria 886
199 Ga0207428_10103058 3300027907 Bacteria 2203
200 Ga0207428_10119335 3300027907 Bacteria 2024
201 Ga0207428_10285060 3300027907 Bacteria 1225
202 Ga0265354_1011777 3300028016 Unclassified 831
203 Ga0265356_1002975 3300028017 Bacteria 2172
204 Ga0268266_10355160 3300028379 Bacteria 1378
205 Ga0268265_11172645 3300028380 Bacteria 765
206 Ga0268264_10217090 3300028381 Bacteria 1759
207 Ga0268264_11490196 3300028381 Bacteria 687
208 Ga0268264_11493937 3300028381 Bacteria 686
209 Ga0265338_10041606 3300028800 Bacteria 4296
210 Ga0316182_1245478 3300030745 Bacteria 662
211 Ga0265762_1061594 3300030760 Unclassified 772
212 Ga0265770_1000070 3300030878 Bacteria 11192
213 Ga0265765_1004517 3300030879 Bacteria 1435
214 Ga0265765_1005079 3300030879 Bacteria 1370
215 Ga0265760_10038396 3300031090 Unclassified 1424
216 Ga0265340_10189012 3300031247 Bacteria 929
217 Ga0307408_100927748 3300031548 Bacteria 798
218 Ga0307412_10383440 3300031911 Bacteria 1139
219 Ga0307416_101222410 3300032002 Bacteria 857
220 Ga0316214_1045183 3300033545 Unclassified 635
221 Ga0373948_0026404 3300034817 Bacteria 1144
222 Ga0373938_0198324 3300034957 Bacteria 555
223 Ga0373926_0244706 3300035083 Bacteria 695
224 Ga0373940_0048704 3300035088 Bacteria 1185
225 Ga0373949_0029374 3300035090 Bacteria 1302
226 Ga0373949_0034769 3300035090 Bacteria 1216
227 Ga0373951_0006211 3300035091 Bacteria 2737
228 Ga0373951_0140339 3300035091 Bacteria 671
229 Ga0373952_0008760 3300035092 Bacteria 1924
230 Ga0373932_0106026 3300035112 Bacteria 920
231 Ga0373936_0118398 3300035113 Bacteria 1129
232 Ga0373939_0135525 3300035114 Bacteria 883
233 Ga0373941_0009850 3300035115 Bacteria 2420
234 Ga0373953_0009582 3300035117 Bacteria 3339
235 Ga0373956_0053029 3300035119 Bacteria 1825
236 Ga0373957_0298641 3300035120 Bacteria 683
237 Ga0373960_0075112 3300035121 Unclassified 1053
238 Ga0373946_0042114 3300035171 Bacteria 1876
239 Ga0373955_0538547 3300035172 Bacteria 714
240 Ga0373942_0006424 3300035207 Bacteria 2715
241 Ga0373961_0071546 3300035241 Bacteria 1073
242 Ga0373962_0016263 3300035242 Bacteria 1917
243 Ga0373962_0067930 3300035242 Bacteria 1059
244 Ga0373931_0003951 3300035691 Bacteria 6710
245 Ga0373931_0004231 3300035691 Bacteria 6531
246 Ga0373931_0149802 3300035691 Bacteria 1359
247 Ga0373927_0023319 3300035695 Bacteria 4053
248 Ga0373947_0349228 3300035725 Bacteria 992
249 Ga0373937_0000776 3300036401 Bacteria 27538
250 Ga0373937_1077856 3300036401 Unclassified 752
251 Ga0373925_0395308 3300037068 Bacteria 1127
252 Ga0436364_0914433 3300037853 Bacteria 3255
253 Ga0436365_0863397 3300039437 Bacteria 1051
254 Ga0436365_1598269 3300039437 Unclassified 612
255 Ga0436361_1003809 3300039447 Bacteria 5109
256 Ga0436363_1466668 3300039450 Bacteria 1188
257 Ga0451802_0336688 3300041460 Bacteria 507
258 Ga0451577_0053385 3300042876 Bacteria 3608
259 Ga0453684_0585013 3300044712 Bacteria 1225
260 Ga0495603_0262396 3300046455 Bacteria 994
261 Ga0495590_0056255 3300046457 Bacteria 1375
262 Ga0495580_0280383 3300046472 Bacteria 1137
263 Ga0495584_0166392 3300046491 Bacteria 1121
264 Ga0495594_0053552 3300046499 Bacteria 2223
265 Ga0495618_0393248 3300046514 Bacteria 849
266 Ga0495652_0122067 3300046529 Bacteria 2076
267 Ga0495652_0170460 3300046529 Bacteria 1681
268 Ga0495587_0268741 3300046536 Bacteria 957
269 Ga0495667_0055284 3300046559 Bacteria 2611
270 Ga0495634_0241943 3300046642 Bacteria 1107
271 Ga0495599_0505724 3300046678 Unclassified 711
272 Ga0495646_0387756 3300046680 Bacteria 728
273 Ga0495674_0317945 3300047319 Bacteria 1269
274 Ga0495680_0316492 3300047322 Bacteria 1093
275 Ga0495684_0849683 3300047471 Bacteria 592
276 Ga0495686_0021454 3300047472 Unclassified 4289
277 Ga0496103_0216749 3300048906 Bacteria 1231
278 Ga0496104_0825587 3300048907 Bacteria 833
279 Ga0496106_0556437 3300048909 Unclassified 920
280 Ga0496108_1467130 3300048911 Bacteria 569
281 Ga0496109_0484032 3300048912 Unclassified 1168
282 Ga0496110_1544294 3300048913 Bacteria 574
283 Ga0496111_0764699 3300048914 Unclassified 700
284 Ga0496126_0022296 3300048929 Bacteria 6166
285 Ga0496126_0331011 3300048929 Bacteria 1250
286 Ga0501036_0279268 3300049572 Unclassified 1398
287 Ga0501047_0426151 3300049581 Bacteria 1158
288 Ga0501071_0265465 3300049587 Bacteria 1297
289 Ga0501072_0093692 3300049588 Unclassified 2386
290 Ga0501072_1230059 3300049588 Bacteria 581
291 Ga0501076_0070014 3300049592 Bacteria 2804
292 Ga0501077_0172804 3300049593 Bacteria 1373
293 nmdc:mga03n38_255747_c1 3300050490 Bacteria 927
294 nmdc:mga03n38_78726_c1 3300050490 Bacteria 1543
295 nmdc:mga0k408_91328_c1 3300050493 Bacteria 1789
296 nmdc:mga06z11_371046_c1 3300050494 Bacteria 859
297 nmdc:mga06z11_4047_c1 3300050494 Bacteria 5729
298 nmdc:mga05p37_2101778_c1 3300050507 Bacteria 529
299 nmdc:mga09592_236415_c1 3300050508 Bacteria 1583
300 nmdc:mga09592_807632_c1 3300050508 Bacteria 793
301 nmdc:mga0qj67_268292_c1 3300050509 Bacteria 1384
302 nmdc:mga06r32_108635_c1 3300050510 Bacteria 2727
303 nmdc:mga06r32_128116_c1 3300050510 Bacteria 2508
304 nmdc:mga06r32_465013_c1 3300050510 Bacteria 1244
305 nmdc:mga06r32_877174_c1 3300050510 Bacteria 855
306 nmdc:mga08y16_473452_c1 3300050511 Bacteria 1275
307 nmdc:mga08y16_589583_c1 3300050511 Bacteria 1121
308 nmdc:mga08y16_77893_c1 3300050511 Bacteria 3456
309 nmdc:mga08y16_84753_c1 3300050511 Bacteria 3303
310 nmdc:mga0n895_184416_c1 3300050512 Bacteria 2118
311 nmdc:mga0n895_190675_c1 3300050512 Bacteria 2081
312 nmdc:mga0n895_245553_c1 3300050512 Bacteria 1817
313 nmdc:mga0n895_79794_c1 3300050512 Bacteria 3259
314 nmdc:mga0n895_871061_c1 3300050512 Bacteria 887
315 nmdc:mga0n895_931940_c1 3300050512 Bacteria 853
316 nmdc:mga0rr50_386909_c1 3300050513 Bacteria 1180
317 nmdc:mga0rr50_449644_c1 3300050513 Bacteria 1092
318 nmdc:mga0rr50_596413_c1 3300050513 Bacteria 942
319 nmdc:mga0rr50_80071_c1 3300050513 Bacteria 2518
320 nmdc:mga0rr50_84461_c1 3300050513 Bacteria 2458
321 nmdc:mga08x19_125831_c1 3300050514 Bacteria 1721
322 nmdc:mga08x19_1269561_c1 3300050514 Bacteria 522
323 nmdc:mga08x19_1275159_c1 3300050514 Bacteria 520
324 nmdc:mga0a205_23460_c1 3300050515 Bacteria 5853
325 nmdc:mga0a205_433455_c1 3300050515 Bacteria 1176
326 nmdc:mga0a205_542002_c1 3300050515 Bacteria 1019
327 Ga0495601_0089884 3300053077 Bacteria 1975
328 Ga0500643_005652 3300053087 Bacteria 5348
329 Ga0500651_0001886 3300053093 Bacteria 10798
330 Ga0500566_0061606 3300053094 Bacteria 2123
331 Ga0500595_000255 3300053119 Bacteria 35290
332 Ga0500595_154012 3300053119 Bacteria 642
333 Ga0500642_0202359 3300053130 Bacteria 924
334 Ga0500642_0369338 3300053130 Unclassified 633
335 Ga0500559_0477898 3300053136 Bacteria 574
336 Ga0500568_0250031 3300053139 Bacteria 646
337 Ga0590071_000104 3300059421 Bacteria 24141
338 Ga0590071_138195 3300059421 Bacteria 628
339 Ga0590071_180646 3300059421 Bacteria 553
340 Ga0590074_000304 3300059423 Bacteria 6755
341 Ga0590075_000096 3300059424 Bacteria 22788
342 Ga0590077_000326 3300059426 Bacteria 13503
343 Ga0501082_1814322 3300060353 Bacteria 532
344 Ga0075363_100253433
345 LJNas_1005231
346 JGI25406J46586_10128036
347 JGI25404J52841_10024494
348 Ga0065715_10045344
349 Ga0070676_10049418
350 Ga0070676_10680085
351 Ga0070690_100693367
352 Ga0070677_10019102
353 Ga0070666_10460959
354 Ga0068868_100602477
355 Ga0070689_100107618
356 Ga0070689_100538926
357 Ga0070691_10008547
358 Ga0070691_10017357
359 Ga0070687_100454979
360 Ga0070692_10088511
361 Ga0070668_101219814
362 Ga0070668_101348806
363 Ga0070675_100307024
364 Ga0070674_100231279
365 Ga0070673_100002817
366 Ga0070688_100807572
367 Ga0070703_10228642
368 Ga0070703_10257774
369 Ga0070709_10306512
370 Ga0070714_100592561
371 Ga0070713_100338872
372 Ga0070705_100290647
373 Ga0070700_100076986
374 Ga0070700_100114990
375 Ga0070700_100260340
376 Ga0070700_101195961
377 Ga0070663_100281398
378 Ga0070663_101898069
379 Ga0070678_100042129
380 Ga0070662_100264545
381 Ga0068867_100036375
382 Ga0070685_10613502
383 Ga0070706_100102487
384 Ga0070698_100060953
385 Ga0070697_101472564
386 Ga0070672_100121971
387 Ga0070686_100098057
388 Ga0070695_100053872
389 Ga0070695_100251542
390 Ga0070696_100138400
391 Ga0070696_100319764
392 Ga0070693_100060275
393 Ga0070665_100399015
394 Ga0070704_100182542
395 Ga0068855_100765931
396 Ga0068855_102010479
397 Ga0070664_101167993
398 Ga0068856_100335368
399 Ga0070702_100078097
400 Ga0070702_100589493
401 Ga0068852_100127803
402 Ga0068864_100217326
403 Ga0068864_100261140
404 Ga0068864_100862087
405 Ga0068866_10162287
406 Ga0068866_10228919
407 Ga0068866_10542823
408 Ga0068866_10939215
409 Ga0068861_100019879
410 Ga0068861_100416388
411 Ga0068861_101419993
412 Ga0068863_100158909
413 Ga0068858_100366994
414 Ga0068858_100450369
415 Ga0068860_101601438
416 Ga0068862_100266242
417 Ga0068862_101126769
418 Ga0081540_1000257
419 Ga0081540_1000266
420 Ga0081540_1003585
421 Ga0081539_10160800
422 Ga0075365_10743475
423 Ga0075368_10474971
424 Ga0075363_100188458
425 Ga0075362_10035416
426 Ga0075367_10002887
427 Ga0075367_10399958
428 Ga0075367_10876858
429 Ga0075366_10004716
430 Ga0097621_101940919
431 Ga0075428_100002996
432 Ga0075428_100025820
433 Ga0075428_100256683
434 Ga0075428_100622081
435 Ga0075428_100761467
436 Ga0075430_100000297
437 Ga0075430_100087679
438 Ga0075431_100001175
439 Ga0075431_100121845
440 Ga0075431_100132952
441 Ga0075431_100755262
442 Ga0075433_10060438
443 Ga0075433_10254382
444 Ga0075433_10378151
445 Ga0075434_100209895
446 Ga0075434_100221931
447 Ga0075434_100308263
448 Ga0075434_100820176
449 Ga0075434_100973231
450 Ga0075429_100107337
451 Ga0075429_100593112
452 Ga0075429_100870166
453 Ga0068865_100271300
454 Ga0075436_100095412
455 Ga0097620_101850332
456 Ga0075435_100058310
457 Ga0075435_100102021
458 Ga0075435_100117146
459 Ga0075435_100262706
460 Ga0099794_10040925
461 Ga0099795_10000082
462 Ga0099795_10132913
463 Ga0111539_10020004
464 Ga0111539_10054666
465 Ga0111539_10606946
466 Ga0111539_12997773
467 Ga0105245_10057076
468 Ga0105245_12625608
469 Ga0114129_10770933
470 Ga0114129_12634455
471 Ga0105243_10096577
472 Ga0105243_10425018
473 Ga0105243_10491490
474 Ga0105241_10031061
475 Ga0105241_10880217
476 Ga0105242_10059810
477 Ga0105248_10046910
478 Ga0105238_10291846
479 Ga0105238_11592827
480 Ga0105249_10631577
481 Ga0099796_10002118
482 Ga0105239_10684262
483 Ga0157374_10530769
484 Ga0157378_11324297
485 Ga0157378_11509219
486 Ga0157380_10236383
487 Ga0157380_10521022
488 Ga0157379_10019818
489 Ga0163161_10160063
490 Ga0163161_11337944
491 Ga0213874_10101880
492 Ga0213876_10196252
493 Ga0209758_1000251
494 Ga0209758_1019772
495 Ga0207697_10501814
496 Ga0207656_10135264
497 Ga0207699_10296852
498 Ga0207699_11465511
499 Ga0207645_10005036
500 Ga0207684_10382748
501 Ga0207662_10030945
502 Ga0207662_10553711
503 Ga0207681_10200185
504 Ga0207694_10780058
505 Ga0207650_11640995
506 Ga0207659_10070578
507 Ga0207687_10066499
508 Ga0207687_11612146
509 Ga0207700_10152050
510 Ga0207664_10417481
511 Ga0207644_10065558
512 Ga0207644_10613165
513 Ga0207706_10022207
514 Ga0207686_10226819
515 Ga0207709_10122699
516 Ga0207669_10252533
517 Ga0207669_10697640
518 Ga0207665_10185745
519 Ga0207691_10015367
520 Ga0207691_10619040
521 Ga0207711_10132477
522 Ga0207689_10052121
523 Ga0207689_10347506
524 Ga0207667_10535876
525 Ga0207651_10012146
526 Ga0207640_10045585
527 Ga0207658_10859998
528 Ga0207639_10468297
529 Ga0207678_10607332
530 Ga0207708_10012458
531 Ga0207708_10119663
532 Ga0207702_11042166
533 Ga0207641_10256344
534 Ga0207648_10068795
535 Ga0207676_10245134
536 Ga0207676_10512760
537 Ga0207675_100024735
538 Ga0207675_100121406
539 Ga0207675_100204791
540 Ga0207683_10196261
541 Ga0209813_10129508
542 Ga0207428_10103058
543 Ga0207428_10119335
544 Ga0207428_10285060
545 Ga0265354_1011777
546 Ga0265356_1002975
547 Ga0268266_10355160
548 Ga0268265_11172645
549 Ga0268264_10217090
550 Ga0268264_11490196
551 Ga0268264_11493937
552 Ga0265338_10041606
553 Ga0316182_1245478
554 Ga0265762_1061594
555 Ga0265770_1000070
556 Ga0265765_1004517
557 Ga0265765_1005079
558 Ga0265760_10038396
559 Ga0265340_10189012
560 Ga0307408_100927748
561 Ga0307412_10383440
562 Ga0307416_101222410
563 Ga0316214_1045183
564 Ga0373948_0026404
565 Ga0373938_0198324
566 Ga0373926_0244706
567 Ga0373940_0048704
568 Ga0373949_0029374
569 Ga0373949_0034769
570 Ga0373951_0006211
571 Ga0373951_0140339
572 Ga0373952_0008760
573 Ga0373932_0106026
574 Ga0373936_0118398
575 Ga0373939_0135525
576 Ga0373941_0009850
577 Ga0373953_0009582
578 Ga0373956_0053029
579 Ga0373957_0298641
580 Ga0373960_0075112
581 Ga0373946_0042114
582 Ga0373955_0538547
583 Ga0373942_0006424
584 Ga0373961_0071546
585 Ga0373962_0016263
586 Ga0373962_0067930
587 Ga0373931_0003951
588 Ga0373931_0004231
589 Ga0373931_0149802
590 Ga0373927_0023319
591 Ga0373947_0349228
592 Ga0373937_0000776
593 Ga0373937_1077856
594 Ga0373925_0395308
595 Ga0436364_0914433
596 Ga0436365_0863397
597 Ga0436365_1598269
598 Ga0436361_1003809
599 Ga0436363_1466668
600 Ga0451802_0336688
601 Ga0451577_0053385
602 Ga0453684_0585013
603 Ga0495603_0262396
604 Ga0495590_0056255
605 Ga0495580_0280383
606 Ga0495584_0166392
607 Ga0495594_0053552
608 Ga0495618_0393248
609 Ga0495652_0122067
610 Ga0495652_0170460
611 Ga0495587_0268741
612 Ga0495667_0055284
613 Ga0495634_0241943
614 Ga0495599_0505724
615 Ga0495646_0387756
616 Ga0495674_0317945
617 Ga0495680_0316492
618 Ga0495684_0849683
619 Ga0495686_0021454
620 Ga0496103_0216749
621 Ga0496104_0825587
622 Ga0496106_0556437
623 Ga0496108_1467130
624 Ga0496109_0484032
625 Ga0496110_1544294
626 Ga0496111_0764699
627 Ga0496126_0022296
628 Ga0496126_0331011
629 Ga0501036_0279268
630 Ga0501047_0426151
631 Ga0501071_0265465
632 Ga0501072_0093692
633 Ga0501072_1230059
634 Ga0501076_0070014
635 Ga0501077_0172804
636 nmdc:mga03n38_255747_c1
637 nmdc:mga03n38_78726_c1
638 nmdc:mga0k408_91328_c1
639 nmdc:mga06z11_371046_c1
640 nmdc:mga06z11_4047_c1
641 nmdc:mga05p37_2101778_c1
642 nmdc:mga09592_236415_c1
643 nmdc:mga09592_807632_c1
644 nmdc:mga0qj67_268292_c1
645 nmdc:mga06r32_108635_c1
646 nmdc:mga06r32_128116_c1
647 nmdc:mga06r32_465013_c1
648 nmdc:mga06r32_877174_c1
649 nmdc:mga08y16_473452_c1
650 nmdc:mga08y16_589583_c1
651 nmdc:mga08y16_77893_c1
652 nmdc:mga08y16_84753_c1
653 nmdc:mga0n895_184416_c1
654 nmdc:mga0n895_190675_c1
655 nmdc:mga0n895_245553_c1
656 nmdc:mga0n895_79794_c1
657 nmdc:mga0n895_871061_c1
658 nmdc:mga0n895_931940_c1
659 nmdc:mga0rr50_386909_c1
660 nmdc:mga0rr50_449644_c1
661 nmdc:mga0rr50_596413_c1
662 nmdc:mga0rr50_80071_c1
663 nmdc:mga0rr50_84461_c1
664 nmdc:mga08x19_125831_c1
665 nmdc:mga08x19_1269561_c1
666 nmdc:mga08x19_1275159_c1
667 nmdc:mga0a205_23460_c1
668 nmdc:mga0a205_433455_c1
669 nmdc:mga0a205_542002_c1
670 Ga0495601_0089884
671 Ga0500643_005652
672 Ga0500651_0001886
673 Ga0500566_0061606
674 Ga0500595_000255
675 Ga0500595_154012
676 Ga0500642_0202359
677 Ga0500642_0369338
678 Ga0500559_0477898
679 Ga0500568_0250031
680 Ga0590071_000104
681 Ga0590071_138195
682 Ga0590071_180646
683 Ga0590074_000304
684 Ga0590075_000096
685 Ga0590077_000326
686 Ga0501082_1814322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

27

107

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rs8-assembly1.cif.gz_B apo structure of novel pnob8 plasmid centromere binding protein 0.9434 27 107
5k5q-assembly1.cif.gz_D structure of aspa-dna complex: novel centromere bindng protein-centromere complex 0.9332 27 107
5k5r-assembly2.cif.gz_F aspa-32mer dna,crystal form 2 0.9199 27 107
5k1y-assembly1.cif.gz_B p2(1) structure of pnob8 aspa-dna complex 0.9141 27 107
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9118 25 69
ID Description Score Start End Superfamily
af_Q86JM3_2_62_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9563 25 87 1.10.10.10
af_P71977_12_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9422 22 88 1.10.10.10
af_Q9H171_1_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.939 21 88 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9371 26 88 1.10.10.10
af_Q86JM3_2_62_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9268 25 87 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2U0RZ48-F1-model_v4 ArnR1-like winged helix-turn-helix domain-containing protein 0.9653 25 105
AF-A0A7J2U7J9-F1-model_v4 Recombinase domain-containing protein 0.9426 17 104 GO:0000150
GO:0003677
AF-A0A1V5WMK1-F1-model_v4 Helix-turn-helix domain protein 0.9251 27 113
AF-A0A1Y4T4N6-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9246 27 107
AF-A0A497EF08-F1-model_v4 Winged helix DNA-binding domain-containing protein 0.9236 27 107

Map