F413186

General Info

Members Datasets Scaffolds Average Seq Length
337 216 674 182

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0001407|Ga0466969_0001407_8854_9477
Length 194
Sequence MPSAAAQDSKPSEPKLRPLLTSEQIAARNAELGRQIARDYADKELTVVGVLKGSFMFVADLVREIYNAQRALGLSGGTLSTEFLAVQSYGDATTTSGVVQITADLTNPVEGKHVLIVEDIVDTGLTMSYLLENMATRRPASVKLCSLLHKPARSQKQVPIDYLGFTIEDLFVVGYGLDYKQRYRNLPLIAVLDP

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
132 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
162 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
170 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
179 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
180 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
199 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
202 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
203 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
206 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
212 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
213 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.72
Nodule 0
Rhizoplane 1.19
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0001407 3300044656 Bacteria 12966
2 rootH1_10008514 3300003323 Bacteria 3140
3 Ga0070658_10343540 3300005327 Bacteria 1277
4 Ga0070658_10607853 3300005327 Bacteria 948
5 Ga0070683_100094375 3300005329 Bacteria 2812
6 Ga0070690_100003184 3300005330 Bacteria 8950
7 Ga0068869_100124084 3300005334 Bacteria 1978
8 Ga0070680_100154763 3300005336 Bacteria 1926
9 Ga0070680_100192279 3300005336 Bacteria 1720
10 Ga0070680_100996114 3300005336 Bacteria 724
11 Ga0070682_100170828 3300005337 Bacteria 1511
12 Ga0070660_100005702 3300005339 Bacteria 8630
13 Ga0070660_100821913 3300005339 Bacteria 782
14 Ga0070689_100045812 3300005340 Bacteria 3369
15 Ga0070689_100061002 3300005340 Bacteria 2933
16 Ga0070675_100620066 3300005354 Bacteria 982
17 Ga0070674_100074726 3300005356 Bacteria 2405
18 Ga0070688_100084360 3300005365 Bacteria 2063
19 Ga0070688_100648771 3300005365 Bacteria 813
20 Ga0070711_100717379 3300005439 Bacteria 843
21 Ga0070705_100061148 3300005440 Bacteria 2237
22 Ga0070705_100632858 3300005440 Unclassified 832
23 Ga0070694_100160166 3300005444 Bacteria 1651
24 Ga0070708_100001068 3300005445 Bacteria 20942
25 Ga0070663_100036059 3300005455 Bacteria 3435
26 Ga0070663_100309388 3300005455 Bacteria 1267
27 Ga0070678_100030668 3300005456 Bacteria 3699
28 Ga0070678_100420906 3300005456 Bacteria 1164
29 Ga0070678_100791319 3300005456 Bacteria 860
30 Ga0070681_10066989 3300005458 Bacteria 3559
31 Ga0070681_10552117 3300005458 Bacteria 1066
32 Ga0070681_10591708 3300005458 Bacteria 1024
33 Ga0070681_10630680 3300005458 Bacteria 986
34 Ga0070681_10735900 3300005458 Bacteria 902
35 Ga0070681_11297855 3300005458 Bacteria 651
36 Ga0068867_100025544 3300005459 Bacteria 4239
37 Ga0068867_100093038 3300005459 Bacteria 2290
38 Ga0070706_100007679 3300005467 Bacteria 10085
39 Ga0070706_100051525 3300005467 Bacteria 3799
40 Ga0070706_100193557 3300005467 Bacteria 1900
41 Ga0070698_100006735 3300005471 Bacteria 12458
42 Ga0070699_100043601 3300005518 Bacteria 3882
43 Ga0070699_100252099 3300005518 Bacteria 1577
44 Ga0070679_100030294 3300005530 Bacteria 5342
45 Ga0070679_100051623 3300005530 Bacteria 4096
46 Ga0070679_100133407 3300005530 Bacteria 2464
47 Ga0070684_100041076 3300005535 Bacteria 3986
48 Ga0070684_100178555 3300005535 Bacteria 1930
49 Ga0070684_100321661 3300005535 Bacteria 1421
50 Ga0070697_100087585 3300005536 Bacteria 2571
51 Ga0070697_100105724 3300005536 Bacteria 2342
52 Ga0070695_100438923 3300005545 Bacteria 998
53 Ga0070695_100568399 3300005545 Unclassified 886
54 Ga0070665_100071291 3300005548 Bacteria 3481
55 Ga0070665_100482140 3300005548 Bacteria 1251
56 Ga0068855_100276391 3300005563 Bacteria 1866
57 Ga0068857_100113760 3300005577 Bacteria 2433
58 Ga0068857_100331759 3300005577 Bacteria 1406
59 Ga0068856_100021601 3300005614 Bacteria 6256
60 Ga0068856_100076516 3300005614 Bacteria 3316
61 Ga0068859_100184535 3300005617 Bacteria 2169
62 Ga0068859_101255267 3300005617 Unclassified 816
63 Ga0068864_100158030 3300005618 Bacteria 2059
64 Ga0068864_100592893 3300005618 Bacteria 1075
65 Ga0068864_101038061 3300005618 Bacteria 814
66 Ga0068866_10158699 3300005718 Bacteria 1317
67 Ga0068861_100000430 3300005719 Bacteria 24408
68 Ga0068860_100258436 3300005843 Bacteria 1697
69 Ga0068860_101335748 3300005843 Bacteria 738
70 Ga0068862_100513034 3300005844 Bacteria 1140
71 Ga0081455_10053738 3300005937 Bacteria 3439
72 Ga0070717_10422602 3300006028 Bacteria 1199
73 Ga0070716_100961071 3300006173 Unclassified 673
74 Ga0068871_100402699 3300006358 Bacteria 1219
75 Ga0068871_100909478 3300006358 Bacteria 816
76 Ga0068871_101042012 3300006358 Unclassified 763
77 Ga0075430_100183516 3300006846 Bacteria 1740
78 Ga0075433_10128306 3300006852 Bacteria 2253
79 Ga0075429_100258693 3300006880 Bacteria 1524
80 Ga0075436_100286449 3300006914 Bacteria 1179
81 Ga0075436_100726851 3300006914 Unclassified 736
82 Ga0097620_100184528 3300006931 Bacteria 2169
83 Ga0097620_101255316 3300006931 Unclassified 816
84 Ga0075435_100385190 3300007076 Bacteria 1205
85 Ga0099794_10002307 3300007265 Bacteria 7006
86 Ga0099794_10005553 3300007265 Bacteria 5066
87 Ga0099794_10023567 3300007265 Bacteria 2817
88 Ga0099795_10146131 3300007788 Bacteria 965
89 Ga0099795_10247069 3300007788 Bacteria 768
90 Ga0111539_11389016 3300009094 Bacteria 815
91 Ga0105245_10000109 3300009098 Bacteria 79725
92 Ga0105245_10797829 3300009098 Bacteria 982
93 Ga0114129_11184991 3300009147 Bacteria 952
94 Ga0114129_12218070 3300009147 Bacteria 660
95 Ga0105243_10577236 3300009148 Bacteria 1079
96 Ga0105241_10188964 3300009174 Bacteria 1713
97 Ga0105242_10386375 3300009176 Bacteria 1302
98 Ga0105242_10493461 3300009176 Bacteria 1163
99 Ga0105242_10667527 3300009176 Bacteria 1013
100 Ga0105248_11515525 3300009177 Bacteria 759
101 Ga0105248_11522518 3300009177 Bacteria 757
102 Ga0105248_11746539 3300009177 Bacteria 705
103 Ga0105237_10523202 3300009545 Bacteria 1193
104 Ga0105238_10393007 3300009551 Bacteria 1379
105 Ga0105249_10080916 3300009553 Bacteria 3018
106 Ga0105249_10137494 3300009553 Bacteria 2340
107 Ga0105249_10503864 3300009553 Bacteria 1256
108 Ga0105239_10127480 3300010375 Bacteria 2829
109 Ga0105246_11013234 3300011119 Bacteria 753
110 Ga0157374_10305711 3300013296 Bacteria 1574
111 Ga0157374_10417544 3300013296 Bacteria 1340
112 Ga0157374_11080859 3300013296 Bacteria 822
113 Ga0157378_10841573 3300013297 Bacteria 945
114 Ga0157372_10236273 3300013307 Bacteria 2120
115 Ga0157372_11211525 3300013307 Bacteria 872
116 Ga0163163_10127850 3300014325 Bacteria 2579
117 Ga0163163_11041831 3300014325 Bacteria 881
118 Ga0163163_11407701 3300014325 Bacteria 759
119 Ga0163163_11621586 3300014325 Bacteria 708
120 Ga0157380_10047822 3300014326 Bacteria 3366
121 Ga0157380_10122668 3300014326 Bacteria 2203
122 Ga0157380_10468014 3300014326 Bacteria 1215
123 Ga0157376_10189801 3300014969 Bacteria 1884
124 Ga0157376_10323378 3300014969 Bacteria 1467
125 Ga0157376_10883496 3300014969 Bacteria 911
126 Ga0163161_10569063 3300017792 Bacteria 931
127 Ga0213872_10122711 3300021361 Bacteria 1148
128 Ga0213876_10028613 3300021384 Bacteria 2938
129 Ga0207692_10464188 3300025898 Bacteria 799
130 Ga0207642_10090124 3300025899 Bacteria 1512
131 Ga0207705_10259041 3300025909 Bacteria 1328
132 Ga0207684_10037116 3300025910 Bacteria 4136
133 Ga0207654_10180914 3300025911 Bacteria 1375
134 Ga0207707_10644560 3300025912 Bacteria 893
135 Ga0207695_10498912 3300025913 Bacteria 1099
136 Ga0207660_10199228 3300025917 Bacteria 1563
137 Ga0207660_10324886 3300025917 Bacteria 1229
138 Ga0207657_10005738 3300025919 Bacteria 12950
139 Ga0207657_10517049 3300025919 Bacteria 935
140 Ga0207652_10058329 3300025921 Bacteria 3326
141 Ga0207652_10184593 3300025921 Bacteria 1875
142 Ga0207652_10254381 3300025921 Bacteria 1584
143 Ga0207652_10262406 3300025921 Bacteria 1558
144 Ga0207652_10402758 3300025921 Bacteria 1234
145 Ga0207652_10662595 3300025921 Bacteria 933
146 Ga0207694_10265070 3300025924 Bacteria 1408
147 Ga0207659_10344107 3300025926 Bacteria 1236
148 Ga0207687_10000200 3300025927 Bacteria 40532
149 Ga0207709_10515480 3300025935 Bacteria 935
150 Ga0207670_10027765 3300025936 Bacteria 3583
151 Ga0207670_10041737 3300025936 Bacteria 3018
152 Ga0207669_10362215 3300025937 Bacteria 1124
153 Ga0207665_10553214 3300025939 Bacteria 894
154 Ga0207689_10097809 3300025942 Bacteria 2411
155 Ga0207689_10667604 3300025942 Bacteria 876
156 Ga0207667_10671420 3300025949 Bacteria 1040
157 Ga0207712_10095618 3300025961 Bacteria 2197
158 Ga0207712_10301871 3300025961 Bacteria 1314
159 Ga0207639_11022977 3300026041 Bacteria 774
160 Ga0207702_10346868 3300026078 Bacteria 1419
161 Ga0207702_10977075 3300026078 Bacteria 840
162 Ga0207641_10016675 3300026088 Bacteria 6014
163 Ga0207648_10019681 3300026089 Bacteria 6091
164 Ga0207676_10141484 3300026095 Bacteria 2060
165 Ga0207676_11049403 3300026095 Bacteria 804
166 Ga0207676_11082193 3300026095 Bacteria 792
167 Ga0207674_10097564 3300026116 Bacteria 2923
168 Ga0207675_100001167 3300026118 Bacteria 26167
169 Ga0207683_10017461 3300026121 Bacteria 6115
170 Ga0207683_10477748 3300026121 Bacteria 1150
171 Ga0209588_1007491 3300027671 Bacteria 3213
172 Ga0268266_10000901 3300028379 Bacteria 38422
173 Ga0268265_10265247 3300028380 Bacteria 1529
174 Ga0268265_10428354 3300028380 Bacteria 1230
175 Ga0268265_11385235 3300028380 Bacteria 705
176 Ga0268264_10183540 3300028381 Bacteria 1902
177 Ga0268264_10473642 3300028381 Bacteria 1217
178 Ga0265337_1000561 3300028556 Bacteria 19556
179 Ga0265319_1083277 3300028563 Bacteria 1014
180 Ga0307515_10010206 3300028794 Bacteria 18037
181 Ga0265338_10029999 3300028800 Bacteria 5375
182 Ga0265338_10127943 3300028800 Bacteria 2012
183 Ga0265332_10014749 3300031238 Bacteria 3454
184 Ga0265332_10019983 3300031238 Unclassified 2958
185 Ga0265320_10000227 3300031240 Bacteria 45987
186 Ga0307509_10000069 3300031507 Bacteria 141246
187 Ga0307509_10002164 3300031507 Bacteria 32269
188 Ga0307509_10056585 3300031507 Bacteria 4162
189 Ga0307509_10062458 3300031507 Bacteria 3928
190 Ga0307509_10075952 3300031507 Bacteria 3488
191 Ga0307509_10237834 3300031507 Bacteria 1617
192 Ga0316579_10027813 3300031691 Bacteria 2570
193 Ga0316579_10318943 3300031691 Bacteria 751
194 Ga0265314_10012590 3300031711 Bacteria 6890
195 Ga0316576_10027435 3300031727 Bacteria 4005
196 Ga0316578_10024747 3300031728 Bacteria 3370
197 Ga0316578_10134406 3300031728 Bacteria 1489
198 Ga0307516_10018338 3300031730 Bacteria 7273
199 Ga0307516_10546309 3300031730 Bacteria 812
200 Ga0307407_10165571 3300031903 Bacteria 1451
201 Ga0307409_100974626 3300031995 Bacteria 865
202 Ga0307415_100409485 3300032126 Bacteria 1160
203 Ga0373949_0002092 3300035090 Bacteria 5260
204 Ga0373936_0000012 3300035113 Bacteria 228915
205 Ga0373961_0000227 3300035241 Bacteria 26340
206 Ga0316574_0024147 3300035398 Bacteria 3636
207 Ga0316574_0105949 3300035398 Bacteria 1801
208 Ga0373931_0430290 3300035691 Bacteria 841
209 Ga0373933_0127233 3300035724 Unclassified 1599
210 Ga0373937_0957162 3300036401 Bacteria 805
211 Ga0316584_0338317 3300036712 Bacteria 1082
212 Ga0395900_0396799 3300037418 Bacteria 1344
213 Ga0395898_0683053 3300037466 Bacteria 969
214 Ga0395905_0238692 3300037471 Bacteria 1699
215 Ga0395905_0458958 3300037471 Bacteria 1172
216 Ga0395901_0181652 3300038443 Bacteria 2206
217 Ga0395901_0869540 3300038443 Bacteria 885
218 Ga0400490_59092 3300038726 Bacteria 10547
219 Ga0400491_23975 3300038727 Bacteria 3252
220 Ga0436365_0713203 3300039437 Bacteria 2050
221 Ga0436365_1636483 3300039437 Bacteria 1315
222 Ga0436360_1353915 3300039438 Bacteria 810
223 Ga0436361_0119544 3300039447 Bacteria 2352
224 Ga0436363_1248034 3300039450 Bacteria 873
225 Ga0451807_0461522 3300041486 Bacteria 1211
226 Ga0451853_0936232 3300041512 Bacteria 890
227 Ga0451577_0050895 3300042876 Bacteria 3698
228 Ga0466966_0066199 3300044684 Bacteria 2271
229 Ga0466963_0429511 3300044694 Bacteria 932
230 Ga0453684_0000116 3300044712 Bacteria 352304
231 Ga0466959_0055977 3300045049 Bacteria 2878
232 Ga0466959_0894286 3300045049 Bacteria 592
233 Ga0451576_0003146 3300045051 Bacteria 23121
234 Ga0466958_0278598 3300045836 Bacteria 1072
235 Ga0495629_0268237 3300046459 Bacteria 1173
236 Ga0495641_0117381 3300046461 Unclassified 1187
237 Ga0495651_0085192 3300046462 Bacteria 2380
238 Ga0495650_0034022 3300046471 Bacteria 2261
239 Ga0495662_0337392 3300046476 Unclassified 741
240 Ga0495628_0506375 3300046516 Bacteria 871
241 Ga0495652_0151585 3300046529 Bacteria 1811
242 Ga0495622_0112959 3300046557 Bacteria 1243
243 Ga0495623_0164581 3300046679 Bacteria 1301
244 Ga0495623_0259215 3300046679 Bacteria 975
245 Ga0495658_0714476 3300046683 Unclassified 642
246 Ga0495649_0353755 3300046694 Bacteria 742
247 Ga0495581_0108173 3300047315 Unclassified 1616
248 Ga0496104_0484431 3300048907 Bacteria 1148
249 Ga0496105_0362019 3300048908 Bacteria 1157
250 Ga0496112_0510752 3300048915 Bacteria 1137
251 Ga0501292_002163 3300049515 Bacteria 2505
252 Ga0501292_021041 3300049515 Bacteria 1054
253 Ga0501295_054120 3300049518 Bacteria 865
254 Ga0501033_0177185 3300049570 Bacteria 1529
255 Ga0501034_0175378 3300049571 Bacteria 2110
256 Ga0501036_0547036 3300049572 Bacteria 962
257 Ga0501046_0212759 3300049580 Bacteria 1434
258 Ga0501047_0001601 3300049581 Bacteria 22065
259 Ga0501047_0034646 3300049581 Bacteria 4875
260 Ga0501047_0365389 3300049581 Bacteria 1278
261 Ga0501067_0000280 3300049583 Bacteria 27929
262 Ga0501067_0031838 3300049583 Bacteria 2926
263 Ga0501068_0000294 3300049584 Bacteria 24908
264 Ga0501068_0083895 3300049584 Bacteria 1959
265 Ga0501069_0001467 3300049585 Bacteria 11607
266 Ga0501069_0033288 3300049585 Bacteria 2839
267 Ga0501070_0123429 3300049586 Bacteria 2140
268 Ga0501070_0237401 3300049586 Bacteria 1492
269 Ga0501070_0463967 3300049586 Bacteria 1020
270 Ga0501071_0046222 3300049587 Bacteria 3127
271 Ga0501072_0000436 3300049588 Bacteria 29892
272 Ga0501073_0053743 3300049589 Bacteria 2819
273 Ga0501073_0344259 3300049589 Bacteria 1029
274 Ga0501074_0000996 3300049590 Bacteria 18428
275 Ga0501074_0134242 3300049590 Bacteria 1770
276 Ga0501074_0186567 3300049590 Bacteria 1479
277 Ga0501074_0317082 3300049590 Bacteria 1107
278 Ga0501076_0003139 3300049592 Bacteria 11519
279 Ga0501077_0005293 3300049593 Bacteria 7840
280 Ga0501077_0006873 3300049593 Bacteria 7003
281 Ga0501216_003771 3300049660 Bacteria 2227
282 Ga0501217_006118 3300049661 Bacteria 2544
283 Ga0501223_028612 3300049663 Bacteria 1085
284 Ga0501227_000151 3300049665 Bacteria 12976
285 Ga0501227_058036 3300049665 Bacteria 987
286 Ga0501233_003649 3300049668 Bacteria 2778
287 Ga0501236_049643 3300049670 Bacteria 717
288 Ga0501257_024682 3300049686 Bacteria 1428
289 Ga0501225_0001602 3300049705 Bacteria 7071
290 Ga0501079_0004663 3300049741 Bacteria 10155
291 Ga0501080_0007810 3300049742 Bacteria 9675
292 Ga0501080_0093447 3300049742 Bacteria 2793
293 Ga0501080_0095534 3300049742 Bacteria 2760
294 Ga0501080_0433587 3300049742 Bacteria 1179
295 Ga0501083_0007036 3300049744 Bacteria 7988
296 Ga0501083_0031145 3300049744 Bacteria 3660
297 Ga0501044_0033032 3300049823 Bacteria 5437
298 Ga0501044_0063700 3300049823 Bacteria 3765
299 Ga0501044_0343478 3300049823 Bacteria 1413
300 Ga0501212_029634 3300049851 Bacteria 878
301 nmdc:mga09592_15719_c1 3300050508 Bacteria 6184
302 nmdc:mga09592_615200_c1 3300050508 Bacteria 930
303 nmdc:mga0qj67_79967_c1 3300050509 Bacteria 2618
304 nmdc:mga06r32_509104_c1 3300050510 Bacteria 1180
305 nmdc:mga0rr50_387543_c1 3300050513 Bacteria 1179
306 nmdc:mga08x19_601768_c1 3300050514 Unclassified 779
307 Ga0500578_0075993 3300053086 Bacteria 2139
308 Ga0500578_0324684 3300053086 Bacteria 906
309 Ga0500644_0011345 3300053088 Bacteria 2434
310 Ga0500647_0088238 3300053091 Bacteria 1486
311 Ga0500583_0082414 3300053092 Bacteria 1556
312 Ga0500566_0019018 3300053094 Bacteria 4033
313 Ga0500566_0036341 3300053094 Bacteria 2858
314 Ga0500566_0096106 3300053094 Bacteria 1631
315 Ga0500640_000111 3300053095 Bacteria 14911
316 Ga0500554_000109 3300053102 Bacteria 16000
317 Ga0500554_028726 3300053102 Bacteria 1619
318 Ga0500555_004332 3300053103 Bacteria 4032
319 Ga0500595_000342 3300053119 Bacteria 30337
320 Ga0500597_002391 3300053120 Bacteria 5199
321 Ga0500614_001785 3300053123 Bacteria 4990
322 Ga0500614_051578 3300053123 Bacteria 1082
323 Ga0500642_0271113 3300053130 Bacteria 774
324 Ga0500658_0179822 3300053134 Bacteria 963
325 Ga0500658_0240079 3300053134 Bacteria 832
326 Ga0500559_0005898 3300053136 Bacteria 5580
327 Ga0500568_0023368 3300053139 Bacteria 2630
328 Ga0500622_0090292 3300053156 Bacteria 1521
329 Ga0500636_0112260 3300053177 Bacteria 1539
330 Ga0500637_0064167 3300053178 Bacteria 2107
331 Ga0500637_0269123 3300053178 Bacteria 943
332 Ga0500637_0285305 3300053178 Bacteria 907
333 Ga0501084_0000173 3300054114 Bacteria 50173
334 Ga0501082_0026739 3300060353 Bacteria 4973
335 Ga0501082_0057104 3300060353 Bacteria 3363
336 Ga0501082_0779848 3300060353 Bacteria 836
337 Ga0530510_0145120 3300061734 Bacteria 1751
338 Ga0466969_0001407
339 rootH1_10008514
340 Ga0070658_10343540
341 Ga0070658_10607853
342 Ga0070683_100094375
343 Ga0070690_100003184
344 Ga0068869_100124084
345 Ga0070680_100154763
346 Ga0070680_100192279
347 Ga0070680_100996114
348 Ga0070682_100170828
349 Ga0070660_100005702
350 Ga0070660_100821913
351 Ga0070689_100045812
352 Ga0070689_100061002
353 Ga0070675_100620066
354 Ga0070674_100074726
355 Ga0070688_100084360
356 Ga0070688_100648771
357 Ga0070711_100717379
358 Ga0070705_100061148
359 Ga0070705_100632858
360 Ga0070694_100160166
361 Ga0070708_100001068
362 Ga0070663_100036059
363 Ga0070663_100309388
364 Ga0070678_100030668
365 Ga0070678_100420906
366 Ga0070678_100791319
367 Ga0070681_10066989
368 Ga0070681_10552117
369 Ga0070681_10591708
370 Ga0070681_10630680
371 Ga0070681_10735900
372 Ga0070681_11297855
373 Ga0068867_100025544
374 Ga0068867_100093038
375 Ga0070706_100007679
376 Ga0070706_100051525
377 Ga0070706_100193557
378 Ga0070698_100006735
379 Ga0070699_100043601
380 Ga0070699_100252099
381 Ga0070679_100030294
382 Ga0070679_100051623
383 Ga0070679_100133407
384 Ga0070684_100041076
385 Ga0070684_100178555
386 Ga0070684_100321661
387 Ga0070697_100087585
388 Ga0070697_100105724
389 Ga0070695_100438923
390 Ga0070695_100568399
391 Ga0070665_100071291
392 Ga0070665_100482140
393 Ga0068855_100276391
394 Ga0068857_100113760
395 Ga0068857_100331759
396 Ga0068856_100021601
397 Ga0068856_100076516
398 Ga0068859_100184535
399 Ga0068859_101255267
400 Ga0068864_100158030
401 Ga0068864_100592893
402 Ga0068864_101038061
403 Ga0068866_10158699
404 Ga0068861_100000430
405 Ga0068860_100258436
406 Ga0068860_101335748
407 Ga0068862_100513034
408 Ga0081455_10053738
409 Ga0070717_10422602
410 Ga0070716_100961071
411 Ga0068871_100402699
412 Ga0068871_100909478
413 Ga0068871_101042012
414 Ga0075430_100183516
415 Ga0075433_10128306
416 Ga0075429_100258693
417 Ga0075436_100286449
418 Ga0075436_100726851
419 Ga0097620_100184528
420 Ga0097620_101255316
421 Ga0075435_100385190
422 Ga0099794_10002307
423 Ga0099794_10005553
424 Ga0099794_10023567
425 Ga0099795_10146131
426 Ga0099795_10247069
427 Ga0111539_11389016
428 Ga0105245_10000109
429 Ga0105245_10797829
430 Ga0114129_11184991
431 Ga0114129_12218070
432 Ga0105243_10577236
433 Ga0105241_10188964
434 Ga0105242_10386375
435 Ga0105242_10493461
436 Ga0105242_10667527
437 Ga0105248_11515525
438 Ga0105248_11522518
439 Ga0105248_11746539
440 Ga0105237_10523202
441 Ga0105238_10393007
442 Ga0105249_10080916
443 Ga0105249_10137494
444 Ga0105249_10503864
445 Ga0105239_10127480
446 Ga0105246_11013234
447 Ga0157374_10305711
448 Ga0157374_10417544
449 Ga0157374_11080859
450 Ga0157378_10841573
451 Ga0157372_10236273
452 Ga0157372_11211525
453 Ga0163163_10127850
454 Ga0163163_11041831
455 Ga0163163_11407701
456 Ga0163163_11621586
457 Ga0157380_10047822
458 Ga0157380_10122668
459 Ga0157380_10468014
460 Ga0157376_10189801
461 Ga0157376_10323378
462 Ga0157376_10883496
463 Ga0163161_10569063
464 Ga0213872_10122711
465 Ga0213876_10028613
466 Ga0207692_10464188
467 Ga0207642_10090124
468 Ga0207705_10259041
469 Ga0207684_10037116
470 Ga0207654_10180914
471 Ga0207707_10644560
472 Ga0207695_10498912
473 Ga0207660_10199228
474 Ga0207660_10324886
475 Ga0207657_10005738
476 Ga0207657_10517049
477 Ga0207652_10058329
478 Ga0207652_10184593
479 Ga0207652_10254381
480 Ga0207652_10262406
481 Ga0207652_10402758
482 Ga0207652_10662595
483 Ga0207694_10265070
484 Ga0207659_10344107
485 Ga0207687_10000200
486 Ga0207709_10515480
487 Ga0207670_10027765
488 Ga0207670_10041737
489 Ga0207669_10362215
490 Ga0207665_10553214
491 Ga0207689_10097809
492 Ga0207689_10667604
493 Ga0207667_10671420
494 Ga0207712_10095618
495 Ga0207712_10301871
496 Ga0207639_11022977
497 Ga0207702_10346868
498 Ga0207702_10977075
499 Ga0207641_10016675
500 Ga0207648_10019681
501 Ga0207676_10141484
502 Ga0207676_11049403
503 Ga0207676_11082193
504 Ga0207674_10097564
505 Ga0207675_100001167
506 Ga0207683_10017461
507 Ga0207683_10477748
508 Ga0209588_1007491
509 Ga0268266_10000901
510 Ga0268265_10265247
511 Ga0268265_10428354
512 Ga0268265_11385235
513 Ga0268264_10183540
514 Ga0268264_10473642
515 Ga0265337_1000561
516 Ga0265319_1083277
517 Ga0307515_10010206
518 Ga0265338_10029999
519 Ga0265338_10127943
520 Ga0265332_10014749
521 Ga0265332_10019983
522 Ga0265320_10000227
523 Ga0307509_10000069
524 Ga0307509_10002164
525 Ga0307509_10056585
526 Ga0307509_10062458
527 Ga0307509_10075952
528 Ga0307509_10237834
529 Ga0316579_10027813
530 Ga0316579_10318943
531 Ga0265314_10012590
532 Ga0316576_10027435
533 Ga0316578_10024747
534 Ga0316578_10134406
535 Ga0307516_10018338
536 Ga0307516_10546309
537 Ga0307407_10165571
538 Ga0307409_100974626
539 Ga0307415_100409485
540 Ga0373949_0002092
541 Ga0373936_0000012
542 Ga0373961_0000227
543 Ga0316574_0024147
544 Ga0316574_0105949
545 Ga0373931_0430290
546 Ga0373933_0127233
547 Ga0373937_0957162
548 Ga0316584_0338317
549 Ga0395900_0396799
550 Ga0395898_0683053
551 Ga0395905_0238692
552 Ga0395905_0458958
553 Ga0395901_0181652
554 Ga0395901_0869540
555 Ga0400490_59092
556 Ga0400491_23975
557 Ga0436365_0713203
558 Ga0436365_1636483
559 Ga0436360_1353915
560 Ga0436361_0119544
561 Ga0436363_1248034
562 Ga0451807_0461522
563 Ga0451853_0936232
564 Ga0451577_0050895
565 Ga0466966_0066199
566 Ga0466963_0429511
567 Ga0453684_0000116
568 Ga0466959_0055977
569 Ga0466959_0894286
570 Ga0451576_0003146
571 Ga0466958_0278598
572 Ga0495629_0268237
573 Ga0495641_0117381
574 Ga0495651_0085192
575 Ga0495650_0034022
576 Ga0495662_0337392
577 Ga0495628_0506375
578 Ga0495652_0151585
579 Ga0495622_0112959
580 Ga0495623_0164581
581 Ga0495623_0259215
582 Ga0495658_0714476
583 Ga0495649_0353755
584 Ga0495581_0108173
585 Ga0496104_0484431
586 Ga0496105_0362019
587 Ga0496112_0510752
588 Ga0501292_002163
589 Ga0501292_021041
590 Ga0501295_054120
591 Ga0501033_0177185
592 Ga0501034_0175378
593 Ga0501036_0547036
594 Ga0501046_0212759
595 Ga0501047_0001601
596 Ga0501047_0034646
597 Ga0501047_0365389
598 Ga0501067_0000280
599 Ga0501067_0031838
600 Ga0501068_0000294
601 Ga0501068_0083895
602 Ga0501069_0001467
603 Ga0501069_0033288
604 Ga0501070_0123429
605 Ga0501070_0237401
606 Ga0501070_0463967
607 Ga0501071_0046222
608 Ga0501072_0000436
609 Ga0501073_0053743
610 Ga0501073_0344259
611 Ga0501074_0000996
612 Ga0501074_0134242
613 Ga0501074_0186567
614 Ga0501074_0317082
615 Ga0501076_0003139
616 Ga0501077_0005293
617 Ga0501077_0006873
618 Ga0501216_003771
619 Ga0501217_006118
620 Ga0501223_028612
621 Ga0501227_000151
622 Ga0501227_058036
623 Ga0501233_003649
624 Ga0501236_049643
625 Ga0501257_024682
626 Ga0501225_0001602
627 Ga0501079_0004663
628 Ga0501080_0007810
629 Ga0501080_0093447
630 Ga0501080_0095534
631 Ga0501080_0433587
632 Ga0501083_0007036
633 Ga0501083_0031145
634 Ga0501044_0033032
635 Ga0501044_0063700
636 Ga0501044_0343478
637 Ga0501212_029634
638 nmdc:mga09592_15719_c1
639 nmdc:mga09592_615200_c1
640 nmdc:mga0qj67_79967_c1
641 nmdc:mga06r32_509104_c1
642 nmdc:mga0rr50_387543_c1
643 nmdc:mga08x19_601768_c1
644 Ga0500578_0075993
645 Ga0500578_0324684
646 Ga0500644_0011345
647 Ga0500647_0088238
648 Ga0500583_0082414
649 Ga0500566_0019018
650 Ga0500566_0036341
651 Ga0500566_0096106
652 Ga0500640_000111
653 Ga0500554_000109
654 Ga0500554_028726
655 Ga0500555_004332
656 Ga0500595_000342
657 Ga0500597_002391
658 Ga0500614_001785
659 Ga0500614_051578
660 Ga0500642_0271113
661 Ga0500658_0179822
662 Ga0500658_0240079
663 Ga0500559_0005898
664 Ga0500568_0023368
665 Ga0500622_0090292
666 Ga0500636_0112260
667 Ga0500637_0064167
668 Ga0500637_0269123
669 Ga0500637_0285305
670 Ga0501084_0000173
671 Ga0501082_0026739
672 Ga0501082_0057104
673 Ga0501082_0779848
674 Ga0530510_0145120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

17

180

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d9r-assembly1.cif.gz_B the substrate-bound crystal structure of hprt (hypoxanthine phosphoribosyltransferase) 0.9711 4 171
3ohp-assembly1.cif.gz_B crystal structure of hgprt from vibrio cholerae 0.9699 2 171
3o7m-assembly1.cif.gz_D 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor' 0.9667 1 170
4rht-assembly2.cif.gz_B crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease 0.9653 5 171
3ohp-assembly1.cif.gz_D crystal structure of hgprt from vibrio cholerae 0.9634 2 171
ID Description Score Start End Superfamily
4rhtD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9525 5 171 3.40.50.2020
4qriB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9473 2 172 3.40.50.2020
af_I1LDB6_1_185_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9383 4 171 3.40.50.2020
3acdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9363 2 168 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9331 4 170 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A509D2I0-F1-model_v4 deleted 0.9918 86 170
AF-A0A6G3XE87-F1-model_v4 Hypoxanthine phosphoribosyltransferase 0.9914 86 171 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006178
GO:0032263
GO:0032264
GO:0046100
AF-A0A536FWN0-F1-model_v4 Hypoxanthine phosphoribosyltransferase 0.9882 88 170 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006178
GO:0032263
GO:0032264
GO:0046100
AF-X1PR53-F1-model_v4 Phosphoribosyltransferase domain-containing protein 0.9854 79 171 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006178
GO:0032263
GO:0032264
GO:0046100
AF-A0A7V4FYL1-F1-model_v4 Hypoxanthine phosphoribosyltransferase (EC 2.4.2.8) 0.9839 1 171 GO:0000166
GO:0000287
GO:0004422
GO:0005829
GO:0006166
GO:0006178
GO:0032263
GO:0032264
GO:0046100
GO:0052657

Map