F413117

General Info

Members Datasets Scaffolds Average Seq Length
337 172 674 110

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_11432967|Ga0207708_114329672
Length 129
Sequence MNAYRDQYATLFNDGQGVVLIAISADPDTALASWARDSEFPFLFASDSGTAVAKKYGALADNPGMTNRNLFVVGPDGNITYRATPFQEVDPKAYKDLAAGIQEAARRNGAFLLSYRPFGTRTRGPPLLS

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
100 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
103 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
144 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
145 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
146 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
154 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
155 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
156 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 1.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.82
Rhizosphere 92.58
Stem 0
Stem Tuber 0
Unclassified 38.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_11432967 3300026075 Unclassified 606
2 rootL2_10063689 3300003322 Bacteria 1548
3 Ga0058859_11719734 3300004798 Bacteria 741
4 Ga0058861_12078290 3300004800 Unclassified 540
5 Ga0058862_12185188 3300004803 Unclassified 636
6 Ga0065707_10202072 3300005295 Unclassified 1291
7 Ga0070676_10632902 3300005328 Bacteria 775
8 Ga0070683_100329463 3300005329 Bacteria 1454
9 Ga0070690_100557127 3300005330 Unclassified 865
10 Ga0070680_100006888 3300005336 Bacteria 8668
11 Ga0070680_100134544 3300005336 Bacteria 2070
12 Ga0070689_100953643 3300005340 Bacteria 761
13 Ga0070689_101843703 3300005340 Unclassified 552
14 Ga0070691_10053825 3300005341 Bacteria 1926
15 Ga0070691_10640776 3300005341 Unclassified 632
16 Ga0070692_10116627 3300005345 Bacteria 1484
17 Ga0070668_101169563 3300005347 Unclassified 696
18 Ga0070701_10002708 3300005438 Bacteria 6871
19 Ga0070705_100008994 3300005440 Bacteria 4957
20 Ga0070700_100601164 3300005441 Unclassified 862
21 Ga0070694_100001473 3300005444 Bacteria 13795
22 Ga0070694_100086781 3300005444 Bacteria 2187
23 Ga0070694_100109462 3300005444 Bacteria 1966
24 Ga0070694_100290421 3300005444 Unclassified 1250
25 Ga0070708_100244189 3300005445 Unclassified 1686
26 Ga0070708_100548235 3300005445 Bacteria 1091
27 Ga0070708_102201833 3300005445 Bacteria 509
28 Ga0070681_10326967 3300005458 Unclassified 1443
29 Ga0070681_10809642 3300005458 Unclassified 854
30 Ga0068867_100063086 3300005459 Bacteria 2754
31 Ga0070706_100009005 3300005467 Bacteria 9291
32 Ga0070706_100398646 3300005467 Bacteria 1281
33 Ga0070706_101847192 3300005467 Bacteria 549
34 Ga0070707_100458919 3300005468 Bacteria 1235
35 Ga0070698_100135022 3300005471 Bacteria 2421
36 Ga0070698_100619704 3300005471 Unclassified 1023
37 Ga0070699_100059399 3300005518 Bacteria 3312
38 Ga0070699_100321763 3300005518 Unclassified 1390
39 Ga0070699_100376381 3300005518 Bacteria 1281
40 Ga0070679_100074712 3300005530 Bacteria 3380
41 Ga0070697_100724558 3300005536 Bacteria 878
42 Ga0068853_100925816 3300005539 Bacteria 838
43 Ga0070686_100246292 3300005544 Bacteria 1303
44 Ga0070695_100030898 3300005545 Bacteria 3337
45 Ga0070695_100031355 3300005545 Bacteria 3315
46 Ga0070695_100682735 3300005545 Unclassified 814
47 Ga0070696_100002939 3300005546 Bacteria 11317
48 Ga0070696_100083363 3300005546 Bacteria 2268
49 Ga0070696_100099701 3300005546 Unclassified 2079
50 Ga0070696_100243027 3300005546 Unclassified 1359
51 Ga0070704_100002413 3300005549 Bacteria 10494
52 Ga0070704_100048906 3300005549 Unclassified 2962
53 Ga0070704_100187334 3300005549 Unclassified 1660
54 Ga0070704_100482697 3300005549 Unclassified 1073
55 Ga0070664_100322959 3300005564 Bacteria 1399
56 Ga0070664_100516800 3300005564 Unclassified 1102
57 Ga0070664_100764155 3300005564 Unclassified 902
58 Ga0068854_100779645 3300005578 Bacteria 832
59 Ga0070702_100109701 3300005615 Bacteria 1709
60 Ga0070702_100670663 3300005615 Bacteria 787
61 Ga0068859_100347433 3300005617 Bacteria 1578
62 Ga0068859_100869935 3300005617 Unclassified 987
63 Ga0068858_100933889 3300005842 Unclassified 849
64 Ga0068862_102029651 3300005844 Bacteria 586
65 Ga0081455_10314443 3300005937 Bacteria 1118
66 Ga0081455_11003905 3300005937 Bacteria 516
67 Ga0075428_100008994 3300006844 Bacteria 11081
68 Ga0075428_100018295 3300006844 Bacteria 7746
69 Ga0075428_100064481 3300006844 Bacteria 4012
70 Ga0075428_100459984 3300006844 Bacteria 1363
71 Ga0075428_100886341 3300006844 Bacteria 947
72 Ga0075428_102028033 3300006844 Bacteria 596
73 Ga0075430_100302454 3300006846 Unclassified 1323
74 Ga0075431_100013091 3300006847 Bacteria 8379
75 Ga0075431_100071518 3300006847 Unclassified 3579
76 Ga0075431_100246969 3300006847 Unclassified 1814
77 Ga0075431_100425931 3300006847 Bacteria 1326
78 Ga0075431_100649157 3300006847 Bacteria 1036
79 Ga0075431_100774749 3300006847 Bacteria 934
80 Ga0075433_10035459 3300006852 Bacteria 4290
81 Ga0075433_10222468 3300006852 Bacteria 1677
82 Ga0075433_10397020 3300006852 Bacteria 1217
83 Ga0075433_10755183 3300006852 Bacteria 851
84 Ga0075433_11118907 3300006852 Bacteria 685
85 Ga0075434_100001798 3300006871 Bacteria 18527
86 Ga0075434_100199705 3300006871 Unclassified 2019
87 Ga0075434_101868922 3300006871 Unclassified 607
88 Ga0075434_102527797 3300006871 Unclassified 514
89 Ga0075429_100665878 3300006880 Unclassified 912
90 Ga0075436_100026702 3300006914 Bacteria 3976
91 Ga0075436_100028069 3300006914 Bacteria 3874
92 Ga0075436_100214220 3300006914 Bacteria 1366
93 Ga0075436_100668347 3300006914 Bacteria 768
94 Ga0075436_100696296 3300006914 Unclassified 752
95 Ga0097620_100347395 3300006931 Bacteria 1578
96 Ga0097620_100869917 3300006931 Unclassified 987
97 Ga0075435_100006128 3300007076 Bacteria 8474
98 Ga0075435_100039696 3300007076 Unclassified 3757
99 Ga0075435_100042157 3300007076 Bacteria 3650
100 Ga0075435_100099577 3300007076 Bacteria 2407
101 Ga0075435_100309733 3300007076 Unclassified 1351
102 Ga0075435_100643702 3300007076 Bacteria 920
103 Ga0075435_101897305 3300007076 Bacteria 523
104 Ga0099794_10000032 3300007265 Bacteria 57885
105 Ga0105251_10526111 3300009011 Bacteria 555
106 Ga0105240_12471904 3300009093 Bacteria 537
107 Ga0111539_10422034 3300009094 Bacteria 1553
108 Ga0111539_10564765 3300009094 Bacteria 1325
109 Ga0111539_11347348 3300009094 Unclassified 828
110 Ga0105245_10768055 3300009098 Unclassified 1000
111 Ga0114129_10000471 3300009147 Bacteria 48410
112 Ga0114129_10019978 3300009147 Bacteria 9535
113 Ga0114129_10580044 3300009147 Bacteria 1455
114 Ga0114129_10678813 3300009147 Bacteria 1326
115 Ga0114129_10680510 3300009147 Unclassified 1324
116 Ga0105242_10458947 3300009176 Unclassified 1203
117 Ga0105242_11514163 3300009176 Unclassified 702
118 Ga0105239_10259563 3300010375 Bacteria 1952
119 Ga0105246_10403961 3300011119 Unclassified 1135
120 Ga0157378_12173202 3300013297 Unclassified 606
121 Ga0157375_11111653 3300013308 Unclassified 925
122 Ga0157380_11808327 3300014326 Bacteria 670
123 Ga0182008_10670250 3300014497 Bacteria 589
124 Ga0206356_11140944 3300020070 Unclassified 565
125 Ga0207653_10000392 3300025885 Bacteria 19794
126 Ga0207684_10184659 3300025910 Bacteria 1798
127 Ga0207707_10838389 3300025912 Unclassified 764
128 Ga0207663_10550335 3300025916 Unclassified 902
129 Ga0207660_10246798 3300025917 Bacteria 1408
130 Ga0207662_10083249 3300025918 Bacteria 1955
131 Ga0207646_11853811 3300025922 Unclassified 515
132 Ga0207706_11037959 3300025933 Bacteria 687
133 Ga0207679_11461364 3300025945 Unclassified 627
134 Ga0207640_10580506 3300025981 Bacteria 946
135 Ga0207639_11351400 3300026041 Bacteria 669
136 Ga0207678_10054215 3300026067 Bacteria 3453
137 Ga0207708_10205939 3300026075 Bacteria 1571
138 Ga0207708_11079741 3300026075 Bacteria 699
139 Ga0207648_10086173 3300026089 Bacteria 2740
140 Ga0207674_10643419 3300026116 Unclassified 1024
141 Ga0207675_100027331 3300026118 Bacteria 5314
142 Ga0209588_1000093 3300027671 Bacteria 28346
143 Ga0209588_1000243 3300027671 Bacteria 14530
144 Ga0209974_10015292 3300027876 Bacteria 2549
145 Ga0209974_10075099 3300027876 Bacteria 1157
146 Ga0209974_10196053 3300027876 Unclassified 745
147 Ga0207428_10309954 3300027907 Unclassified 1167
148 Ga0207428_10439949 3300027907 Unclassified 951
149 Ga0307408_100016045 3300031548 Unclassified 4994
150 Ga0307408_101203523 3300031548 Unclassified 707
151 Ga0307405_10052338 3300031731 Bacteria 2538
152 Ga0307405_10261976 3300031731 Bacteria 1292
153 Ga0307405_10353068 3300031731 Bacteria 1135
154 Ga0307405_11236651 3300031731 Bacteria 647
155 Ga0307413_10017504 3300031824 Bacteria 3734
156 Ga0307413_10076509 3300031824 Bacteria 2127
157 Ga0307410_10000199 3300031852 Bacteria 22521
158 Ga0307406_10072004 3300031901 Bacteria 2267
159 Ga0307406_10110593 3300031901 Bacteria 1891
160 Ga0307406_10166662 3300031901 Bacteria 1590
161 Ga0307406_11531704 3300031901 Unclassified 587
162 Ga0307407_10038860 3300031903 Bacteria 2641
163 Ga0307407_11004854 3300031903 Bacteria 645
164 Ga0307407_11453878 3300031903 Unclassified 541
165 Ga0307412_10660784 3300031911 Bacteria 893
166 Ga0307412_10794718 3300031911 Unclassified 821
167 Ga0307412_12155739 3300031911 Unclassified 518
168 Ga0307409_100001157 3300031995 Bacteria 12567
169 Ga0307409_100617608 3300031995 Bacteria 1073
170 Ga0307409_101848019 3300031995 Unclassified 633
171 Ga0307409_102368101 3300031995 Unclassified 560
172 Ga0307409_102632349 3300031995 Unclassified 531
173 Ga0307416_100150331 3300032002 Bacteria 2134
174 Ga0307416_100202061 3300032002 Bacteria 1886
175 Ga0307416_103560147 3300032002 Bacteria 521
176 Ga0307414_10313837 3300032004 Unclassified 1332
177 Ga0307414_12059599 3300032004 Unclassified 533
178 Ga0307411_10316538 3300032005 Unclassified 1258
179 Ga0307411_10868056 3300032005 Unclassified 799
180 Ga0307415_100011451 3300032126 Bacteria 5077
181 Ga0307415_100150314 3300032126 Bacteria 1791
182 Ga0307415_101193083 3300032126 Unclassified 717
183 Ga0307415_101575482 3300032126 Bacteria 630
184 Ga0395900_0956395 3300037418 Bacteria 778
185 Ga0395900_1012407 3300037418 Unclassified 750
186 Ga0395898_1141550 3300037466 Unclassified 712
187 Ga0395905_0144647 3300037471 Bacteria 2237
188 Ga0395905_0419079 3300037471 Unclassified 1235
189 Ga0395905_0677023 3300037471 Unclassified 934
190 Ga0395901_0704121 3300038443 Unclassified 1007
191 Ga0395901_2047430 3300038443 Bacteria 518
192 Ga0242419_017233 3300038698 Unclassified 589
193 Ga0439446_0071409 3300042156 Bacteria 1063
194 Ga0439459_0092200 3300042438 Bacteria 730
195 Ga0439460_0273109 3300042461 Bacteria 587
196 Ga0451577_0084041 3300042876 Unclassified 2840
197 Ga0451577_0307050 3300042876 Bacteria 1438
198 Ga0451577_1603479 3300042876 Unclassified 574
199 Ga0439440_0295409 3300042993 Unclassified 504
200 Ga0453683_0008980 3300044673 Bacteria 6680
201 Ga0453683_0039696 3300044673 Unclassified 2958
202 Ga0453683_0097594 3300044673 Unclassified 1844
203 Ga0453684_0523317 3300044712 Unclassified 1310
204 Ga0451576_0005915 3300045051 Bacteria 15157
205 Ga0451576_0215774 3300045051 Unclassified 2003
206 Ga0451576_0733267 3300045051 Bacteria 1038
207 Ga0495642_0184311 3300046528 Unclassified 909
208 Ga0495609_0144547 3300046538 Bacteria 1014
209 Ga0495669_0086816 3300046684 Bacteria 1441
210 Ga0495636_0074429 3300047318 Bacteria 1455
211 Ga0495636_0375773 3300047318 Unclassified 674
212 Ga0496100_0440153 3300048903 Unclassified 998
213 Ga0496101_0109492 3300048904 Bacteria 2078
214 Ga0496101_0146779 3300048904 Bacteria 1802
215 Ga0496101_1116752 3300048904 Unclassified 619
216 Ga0496102_0050502 3300048905 Bacteria 3787
217 Ga0496102_0055443 3300048905 Bacteria 3614
218 Ga0496103_0095096 3300048906 Bacteria 1883
219 Ga0496104_0180826 3300048907 Bacteria 2019
220 Ga0496106_0197828 3300048909 Bacteria 1599
221 Ga0496106_0356992 3300048909 Bacteria 1174
222 Ga0496106_0987121 3300048909 Unclassified 663
223 Ga0496108_0016612 3300048911 Bacteria 6009
224 Ga0496109_0132571 3300048912 Bacteria 2326
225 Ga0496109_0155643 3300048912 Bacteria 2141
226 Ga0496110_0000762 3300048913 Bacteria 22292
227 Ga0496110_0708884 3300048913 Unclassified 908
228 Ga0496111_0087195 3300048914 Bacteria 2284
229 Ga0496112_0041062 3300048915 Bacteria 4525
230 Ga0496112_1214306 3300048915 Unclassified 671
231 Ga0496113_0050048 3300048916 Bacteria 3113
232 Ga0496114_0443788 3300048917 Bacteria 1149
233 Ga0496114_0589094 3300048917 Bacteria 981
234 Ga0496115_0527904 3300048918 Unclassified 946
235 Ga0501033_0090622 3300049570 Bacteria 2237
236 Ga0501036_0008440 3300049572 Bacteria 8440
237 Ga0501038_0541868 3300049574 Unclassified 886
238 Ga0501039_0041412 3300049575 Bacteria 3558
239 Ga0501040_0160236 3300049576 Bacteria 1590
240 Ga0501040_0226030 3300049576 Unclassified 1332
241 Ga0501041_0155619 3300049577 Bacteria 1428
242 Ga0501042_0051262 3300049578 Bacteria 2944
243 Ga0501042_0059172 3300049578 Bacteria 2736
244 Ga0501042_0190529 3300049578 Bacteria 1479
245 Ga0501043_0769778 3300049579 Unclassified 698
246 Ga0501046_0032621 3300049580 Bacteria 4216
247 Ga0501046_0084451 3300049580 Bacteria 2449
248 Ga0501046_0319395 3300049580 Bacteria 1132
249 Ga0501048_0201873 3300049582 Bacteria 1409
250 Ga0501067_0006298 3300049583 Bacteria 6581
251 Ga0501067_0041798 3300049583 Bacteria 2546
252 Ga0501069_0030301 3300049585 Bacteria 2971
253 Ga0501069_0175716 3300049585 Bacteria 1237
254 Ga0501070_0977276 3300049586 Unclassified 657
255 Ga0501070_1202984 3300049586 Unclassified 581
256 Ga0501071_0705502 3300049587 Unclassified 777
257 Ga0501071_1137733 3300049587 Bacteria 603
258 Ga0501072_0016113 3300049588 Bacteria 5732
259 Ga0501074_0307931 3300049590 Unclassified 1125
260 Ga0501074_0394404 3300049590 Bacteria 982
261 Ga0501075_0383932 3300049591 Bacteria 1071
262 Ga0501075_0680216 3300049591 Unclassified 784
263 Ga0501076_0008274 3300049592 Bacteria 7620
264 Ga0501076_0034801 3300049592 Bacteria 3940
265 Ga0501077_0005061 3300049593 Bacteria 7998
266 Ga0501077_0192849 3300049593 Bacteria 1294
267 Ga0501077_1057006 3300049593 Bacteria 522
268 Ga0501209_024181 3300049656 Bacteria 1477
269 Ga0501209_305601 3300049656 Unclassified 501
270 Ga0501227_137249 3300049665 Unclassified 669
271 Ga0501233_120381 3300049668 Unclassified 709
272 Ga0501233_216643 3300049668 Unclassified 564
273 Ga0501247_006092 3300049677 Unclassified 1359
274 Ga0501247_027648 3300049677 Unclassified 762
275 Ga0501249_165956 3300049679 Unclassified 563
276 Ga0501259_172912 3300049688 Bacteria 544
277 Ga0501079_0061871 3300049741 Bacteria 2887
278 Ga0501079_0125267 3300049741 Unclassified 1999
279 Ga0501080_0587050 3300049742 Bacteria 990
280 Ga0501080_0649520 3300049742 Bacteria 934
281 Ga0501081_0006680 3300049743 Bacteria 7499
282 Ga0501081_0118418 3300049743 Bacteria 1884
283 Ga0501081_0328509 3300049743 Bacteria 1125
284 Ga0501083_0203004 3300049744 Bacteria 1293
285 Ga0501268_118133 3300049765 Bacteria 585
286 Ga0501271_065199 3300049768 Unclassified 518
287 Ga0501272_013529 3300049769 Unclassified 936
288 Ga0501273_012597 3300049770 Unclassified 1068
289 Ga0501035_0691764 3300049822 Unclassified 823
290 Ga0501045_0151832 3300049824 Bacteria 1723
291 Ga0501045_0376485 3300049824 Bacteria 1057
292 Ga0501045_0573754 3300049824 Unclassified 836
293 nmdc:mga05p37_30424_c1 3300050507 Bacteria 6588
294 nmdc:mga05p37_364975_c1 3300050507 Bacteria 1696
295 nmdc:mga05p37_584516_c1 3300050507 Unclassified 1264
296 nmdc:mga05p37_726728_c1 3300050507 Bacteria 1099
297 nmdc:mga0qj67_1375789_c1 3300050509 Unclassified 545
298 nmdc:mga0qj67_69798_c1 3300050509 Unclassified 2802
299 nmdc:mga0qj67_877163_c1 3300050509 Unclassified 708
300 nmdc:mga06r32_1753606_c1 3300050510 Unclassified 557
301 nmdc:mga06r32_1980472_c1 3300050510 Unclassified 516
302 nmdc:mga06r32_21958_c1 3300050510 Bacteria 5893
303 nmdc:mga06r32_343611_c1 3300050510 Unclassified 1477
304 nmdc:mga06r32_965801_c1 3300050510 Unclassified 806
305 nmdc:mga08y16_1030519_c1 3300050511 Unclassified 801
306 nmdc:mga08y16_1245698_c1 3300050511 Unclassified 713
307 nmdc:mga08y16_654317_c1 3300050511 Unclassified 1055
308 nmdc:mga0n895_22972_c1 3300050512 Bacteria 5854
309 nmdc:mga0n895_389077_c1 3300050512 Unclassified 1411
310 nmdc:mga0n895_7635_c1 3300050512 Bacteria 9297
311 nmdc:mga0n895_8645_c1 3300050512 Bacteria 8837
312 nmdc:mga0rr50_14117_c1 3300050513 Bacteria 5228
313 nmdc:mga0rr50_290893_c1 3300050513 Unclassified 1365
314 nmdc:mga0rr50_475747_c1 3300050513 Bacteria 1061
315 nmdc:mga0rr50_4852_c1 3300050513 Bacteria 7953
316 nmdc:mga0rr50_706181_c1 3300050513 Unclassified 861
317 nmdc:mga0rr50_77699_c2 3300050513 Bacteria 1481
318 nmdc:mga0rr50_970016_c1 3300050513 Bacteria 724
319 nmdc:mga08x19_148876_c1 3300050514 Bacteria 1584
320 nmdc:mga08x19_492341_c1 3300050514 Bacteria 865
321 nmdc:mga08x19_547458_c1 3300050514 Bacteria 819
322 nmdc:mga08x19_778763_c1 3300050514 Unclassified 679
323 nmdc:mga08x19_8199_c1 3300050514 Bacteria 6209
324 nmdc:mga0a205_114717_c1 3300050515 Bacteria 2593
325 nmdc:mga0a205_1556180_c1 3300050515 Bacteria 509
326 nmdc:mga0a205_203250_c1 3300050515 Unclassified 1871
327 nmdc:mga0a205_46886_c1 3300050515 Unclassified 4168
328 nmdc:mga0a205_765617_c1 3300050515 Bacteria 814
329 Ga0501084_0104562 3300054114 Bacteria 2378
330 Ga0501084_1671343 3300054114 Unclassified 532
331 Ga0590071_006077 3300059421 Bacteria 2885
332 Ga0590071_082490 3300059421 Bacteria 800
333 Ga0590074_002876 3300059423 Bacteria 2837
334 Ga0590077_017539 3300059426 Bacteria 1507
335 Ga0501082_0014058 3300060353 Bacteria 6885
336 Ga0501082_0607112 3300060353 Unclassified 957
337 Ga0530510_0844444 3300061734 Unclassified 699
338 Ga0207708_11432967
339 rootL2_10063689
340 Ga0058859_11719734
341 Ga0058861_12078290
342 Ga0058862_12185188
343 Ga0065707_10202072
344 Ga0070676_10632902
345 Ga0070683_100329463
346 Ga0070690_100557127
347 Ga0070680_100006888
348 Ga0070680_100134544
349 Ga0070689_100953643
350 Ga0070689_101843703
351 Ga0070691_10053825
352 Ga0070691_10640776
353 Ga0070692_10116627
354 Ga0070668_101169563
355 Ga0070701_10002708
356 Ga0070705_100008994
357 Ga0070700_100601164
358 Ga0070694_100001473
359 Ga0070694_100086781
360 Ga0070694_100109462
361 Ga0070694_100290421
362 Ga0070708_100244189
363 Ga0070708_100548235
364 Ga0070708_102201833
365 Ga0070681_10326967
366 Ga0070681_10809642
367 Ga0068867_100063086
368 Ga0070706_100009005
369 Ga0070706_100398646
370 Ga0070706_101847192
371 Ga0070707_100458919
372 Ga0070698_100135022
373 Ga0070698_100619704
374 Ga0070699_100059399
375 Ga0070699_100321763
376 Ga0070699_100376381
377 Ga0070679_100074712
378 Ga0070697_100724558
379 Ga0068853_100925816
380 Ga0070686_100246292
381 Ga0070695_100030898
382 Ga0070695_100031355
383 Ga0070695_100682735
384 Ga0070696_100002939
385 Ga0070696_100083363
386 Ga0070696_100099701
387 Ga0070696_100243027
388 Ga0070704_100002413
389 Ga0070704_100048906
390 Ga0070704_100187334
391 Ga0070704_100482697
392 Ga0070664_100322959
393 Ga0070664_100516800
394 Ga0070664_100764155
395 Ga0068854_100779645
396 Ga0070702_100109701
397 Ga0070702_100670663
398 Ga0068859_100347433
399 Ga0068859_100869935
400 Ga0068858_100933889
401 Ga0068862_102029651
402 Ga0081455_10314443
403 Ga0081455_11003905
404 Ga0075428_100008994
405 Ga0075428_100018295
406 Ga0075428_100064481
407 Ga0075428_100459984
408 Ga0075428_100886341
409 Ga0075428_102028033
410 Ga0075430_100302454
411 Ga0075431_100013091
412 Ga0075431_100071518
413 Ga0075431_100246969
414 Ga0075431_100425931
415 Ga0075431_100649157
416 Ga0075431_100774749
417 Ga0075433_10035459
418 Ga0075433_10222468
419 Ga0075433_10397020
420 Ga0075433_10755183
421 Ga0075433_11118907
422 Ga0075434_100001798
423 Ga0075434_100199705
424 Ga0075434_101868922
425 Ga0075434_102527797
426 Ga0075429_100665878
427 Ga0075436_100026702
428 Ga0075436_100028069
429 Ga0075436_100214220
430 Ga0075436_100668347
431 Ga0075436_100696296
432 Ga0097620_100347395
433 Ga0097620_100869917
434 Ga0075435_100006128
435 Ga0075435_100039696
436 Ga0075435_100042157
437 Ga0075435_100099577
438 Ga0075435_100309733
439 Ga0075435_100643702
440 Ga0075435_101897305
441 Ga0099794_10000032
442 Ga0105251_10526111
443 Ga0105240_12471904
444 Ga0111539_10422034
445 Ga0111539_10564765
446 Ga0111539_11347348
447 Ga0105245_10768055
448 Ga0114129_10000471
449 Ga0114129_10019978
450 Ga0114129_10580044
451 Ga0114129_10678813
452 Ga0114129_10680510
453 Ga0105242_10458947
454 Ga0105242_11514163
455 Ga0105239_10259563
456 Ga0105246_10403961
457 Ga0157378_12173202
458 Ga0157375_11111653
459 Ga0157380_11808327
460 Ga0182008_10670250
461 Ga0206356_11140944
462 Ga0207653_10000392
463 Ga0207684_10184659
464 Ga0207707_10838389
465 Ga0207663_10550335
466 Ga0207660_10246798
467 Ga0207662_10083249
468 Ga0207646_11853811
469 Ga0207706_11037959
470 Ga0207679_11461364
471 Ga0207640_10580506
472 Ga0207639_11351400
473 Ga0207678_10054215
474 Ga0207708_10205939
475 Ga0207708_11079741
476 Ga0207648_10086173
477 Ga0207674_10643419
478 Ga0207675_100027331
479 Ga0209588_1000093
480 Ga0209588_1000243
481 Ga0209974_10015292
482 Ga0209974_10075099
483 Ga0209974_10196053
484 Ga0207428_10309954
485 Ga0207428_10439949
486 Ga0307408_100016045
487 Ga0307408_101203523
488 Ga0307405_10052338
489 Ga0307405_10261976
490 Ga0307405_10353068
491 Ga0307405_11236651
492 Ga0307413_10017504
493 Ga0307413_10076509
494 Ga0307410_10000199
495 Ga0307406_10072004
496 Ga0307406_10110593
497 Ga0307406_10166662
498 Ga0307406_11531704
499 Ga0307407_10038860
500 Ga0307407_11004854
501 Ga0307407_11453878
502 Ga0307412_10660784
503 Ga0307412_10794718
504 Ga0307412_12155739
505 Ga0307409_100001157
506 Ga0307409_100617608
507 Ga0307409_101848019
508 Ga0307409_102368101
509 Ga0307409_102632349
510 Ga0307416_100150331
511 Ga0307416_100202061
512 Ga0307416_103560147
513 Ga0307414_10313837
514 Ga0307414_12059599
515 Ga0307411_10316538
516 Ga0307411_10868056
517 Ga0307415_100011451
518 Ga0307415_100150314
519 Ga0307415_101193083
520 Ga0307415_101575482
521 Ga0395900_0956395
522 Ga0395900_1012407
523 Ga0395898_1141550
524 Ga0395905_0144647
525 Ga0395905_0419079
526 Ga0395905_0677023
527 Ga0395901_0704121
528 Ga0395901_2047430
529 Ga0242419_017233
530 Ga0439446_0071409
531 Ga0439459_0092200
532 Ga0439460_0273109
533 Ga0451577_0084041
534 Ga0451577_0307050
535 Ga0451577_1603479
536 Ga0439440_0295409
537 Ga0453683_0008980
538 Ga0453683_0039696
539 Ga0453683_0097594
540 Ga0453684_0523317
541 Ga0451576_0005915
542 Ga0451576_0215774
543 Ga0451576_0733267
544 Ga0495642_0184311
545 Ga0495609_0144547
546 Ga0495669_0086816
547 Ga0495636_0074429
548 Ga0495636_0375773
549 Ga0496100_0440153
550 Ga0496101_0109492
551 Ga0496101_0146779
552 Ga0496101_1116752
553 Ga0496102_0050502
554 Ga0496102_0055443
555 Ga0496103_0095096
556 Ga0496104_0180826
557 Ga0496106_0197828
558 Ga0496106_0356992
559 Ga0496106_0987121
560 Ga0496108_0016612
561 Ga0496109_0132571
562 Ga0496109_0155643
563 Ga0496110_0000762
564 Ga0496110_0708884
565 Ga0496111_0087195
566 Ga0496112_0041062
567 Ga0496112_1214306
568 Ga0496113_0050048
569 Ga0496114_0443788
570 Ga0496114_0589094
571 Ga0496115_0527904
572 Ga0501033_0090622
573 Ga0501036_0008440
574 Ga0501038_0541868
575 Ga0501039_0041412
576 Ga0501040_0160236
577 Ga0501040_0226030
578 Ga0501041_0155619
579 Ga0501042_0051262
580 Ga0501042_0059172
581 Ga0501042_0190529
582 Ga0501043_0769778
583 Ga0501046_0032621
584 Ga0501046_0084451
585 Ga0501046_0319395
586 Ga0501048_0201873
587 Ga0501067_0006298
588 Ga0501067_0041798
589 Ga0501069_0030301
590 Ga0501069_0175716
591 Ga0501070_0977276
592 Ga0501070_1202984
593 Ga0501071_0705502
594 Ga0501071_1137733
595 Ga0501072_0016113
596 Ga0501074_0307931
597 Ga0501074_0394404
598 Ga0501075_0383932
599 Ga0501075_0680216
600 Ga0501076_0008274
601 Ga0501076_0034801
602 Ga0501077_0005061
603 Ga0501077_0192849
604 Ga0501077_1057006
605 Ga0501209_024181
606 Ga0501209_305601
607 Ga0501227_137249
608 Ga0501233_120381
609 Ga0501233_216643
610 Ga0501247_006092
611 Ga0501247_027648
612 Ga0501249_165956
613 Ga0501259_172912
614 Ga0501079_0061871
615 Ga0501079_0125267
616 Ga0501080_0587050
617 Ga0501080_0649520
618 Ga0501081_0006680
619 Ga0501081_0118418
620 Ga0501081_0328509
621 Ga0501083_0203004
622 Ga0501268_118133
623 Ga0501271_065199
624 Ga0501272_013529
625 Ga0501273_012597
626 Ga0501035_0691764
627 Ga0501045_0151832
628 Ga0501045_0376485
629 Ga0501045_0573754
630 nmdc:mga05p37_30424_c1
631 nmdc:mga05p37_364975_c1
632 nmdc:mga05p37_584516_c1
633 nmdc:mga05p37_726728_c1
634 nmdc:mga0qj67_1375789_c1
635 nmdc:mga0qj67_69798_c1
636 nmdc:mga0qj67_877163_c1
637 nmdc:mga06r32_1753606_c1
638 nmdc:mga06r32_1980472_c1
639 nmdc:mga06r32_21958_c1
640 nmdc:mga06r32_343611_c1
641 nmdc:mga06r32_965801_c1
642 nmdc:mga08y16_1030519_c1
643 nmdc:mga08y16_1245698_c1
644 nmdc:mga08y16_654317_c1
645 nmdc:mga0n895_22972_c1
646 nmdc:mga0n895_389077_c1
647 nmdc:mga0n895_7635_c1
648 nmdc:mga0n895_8645_c1
649 nmdc:mga0rr50_14117_c1
650 nmdc:mga0rr50_290893_c1
651 nmdc:mga0rr50_475747_c1
652 nmdc:mga0rr50_4852_c1
653 nmdc:mga0rr50_706181_c1
654 nmdc:mga0rr50_77699_c2
655 nmdc:mga0rr50_970016_c1
656 nmdc:mga08x19_148876_c1
657 nmdc:mga08x19_492341_c1
658 nmdc:mga08x19_547458_c1
659 nmdc:mga08x19_778763_c1
660 nmdc:mga08x19_8199_c1
661 nmdc:mga0a205_114717_c1
662 nmdc:mga0a205_1556180_c1
663 nmdc:mga0a205_203250_c1
664 nmdc:mga0a205_46886_c1
665 nmdc:mga0a205_765617_c1
666 Ga0501084_0104562
667 Ga0501084_1671343
668 Ga0590071_006077
669 Ga0590071_082490
670 Ga0590074_002876
671 Ga0590077_017539
672 Ga0501082_0014058
673 Ga0501082_0607112
674 Ga0530510_0844444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

82

0.9

PF08534

Redoxin

Redoxin

1

97

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n1y-assembly1.cif.gz_C structure of l509v cao1 - growth condition 1 0.7776 68 82
4bxq-assembly1.cif.gz_A structure of the e1021v mutant of the tcp10 domain of danio rerio cpap 0.7412 69 84
1eer-assembly1.cif.gz_B crystal structure of human erythropoietin complexed to its receptor at 1.9 angstroms 0.7408 68 83
6moi-assembly1.cif.gz_B dimeric darpin c_angle_r5 complex with epor 0.7325 68 83
6tjg-assembly1.cif.gz_A crystal structure of the computationally designed cake8 protein 0.721 69 84
ID Description Score Start End Superfamily
af_A0A0R4IBA6_29_133_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8417 68 83 2.60.40.10
af_P91359_466_1014_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8412 68 83 3.40.630.10
af_F1RBA9_5_126_2.60.40.2840 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8142 68 83 2.60.40.2840
af_Q925F2_39_156_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8096 68 83 2.60.40.10
af_Q8CCH2_40_340_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7979 69 82 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A524HNP3-F1-model_v4 Redoxin domain-containing protein 0.6892 1 108 GO:0016209
GO:0016491
AF-A0A2W4S4T3-F1-model_v4 Peroxiredoxin 0.6868 1 104 GO:0016209
GO:0016491
AF-A0A524HNP3-F1-model_v4 Redoxin domain-containing protein 0.684 1 108 GO:0016209
GO:0016491
AF-A0A7V9UKH9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.6829 16 104 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A7W0JGM9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.6814 16 104 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map