F413002

General Info

Members Datasets Scaffolds Average Seq Length
337 244 336 97

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_102418384|Ga0068861_1024183841
Length 114
Sequence MKLKPLHDRIIVEAAAKEEKTASGIILPDSAQEKPLKGKVLATGPGKRLDNGKMAEMEVNVGDTVLYGKYSGTEVTVDGKDFIILRSEDVLAIVAETAAKAKSIGKVPAGAGRK

Samples

Sample ID Description Type Environment
1 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
2 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
113 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
155 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
204 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
205 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
222 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.57
Metatranscriptomes 15.13
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 0.89
Rhizosphere 97.03
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058858_1420551 3300004785 Bacteria 2103
2 Ga0058863_11632032 3300004799 Bacteria 1069
3 Ga0058861_12066965 3300004800 Bacteria 1676
4 Ga0058860_10111968 3300004801 Bacteria 4364
5 Ga0058862_12708775 3300004803 Bacteria 1104
6 Ga0065704_10119766 3300005289 Bacteria 1794
7 Ga0070683_100099899 3300005329 Bacteria 2731
8 Ga0070683_100164413 3300005329 Bacteria 2105
9 Ga0070690_100229682 3300005330 Bacteria 1304
10 Ga0070670_101191844 3300005331 Bacteria 696
11 Ga0070670_102185362 3300005331 Unclassified 510
12 Ga0070666_10002810 3300005335 Bacteria 10512
13 Ga0070660_100043602 3300005339 Bacteria 3429
14 Ga0070660_101121949 3300005339 Bacteria 666
15 Ga0070689_101100425 3300005340 Bacteria 710
16 Ga0070675_101673186 3300005354 Bacteria 587
17 Ga0070674_101408457 3300005356 Bacteria 624
18 Ga0070667_100058985 3300005367 Bacteria 3246
19 Ga0070709_10010949 3300005434 Bacteria 5038
20 Ga0070713_101735018 3300005436 Bacteria 606
21 Ga0070701_10665997 3300005438 Bacteria 696
22 Ga0070711_100513181 3300005439 Bacteria 990
23 Ga0070700_100473315 3300005441 Bacteria 958
24 Ga0068867_102264089 3300005459 Bacteria 516
25 Ga0070706_101909627 3300005467 Bacteria 539
26 Ga0070707_100173080 3300005468 Bacteria 2104
27 Ga0070698_100371596 3300005471 Bacteria 1362
28 Ga0070684_100014439 3300005535 Bacteria 6399
29 Ga0070697_101947875 3300005536 Bacteria 526
30 Ga0068853_101488280 3300005539 Bacteria 655
31 Ga0070686_100000004 3300005544 Bacteria 262514
32 Ga0070686_100061763 3300005544 Bacteria 2422
33 Ga0070704_100128788 3300005549 Bacteria 1958
34 Ga0070704_100587600 3300005549 Bacteria 977
35 Ga0068855_100167904 3300005563 Bacteria 2487
36 Ga0070664_100041807 3300005564 Bacteria 3869
37 Ga0068857_101357310 3300005577 Bacteria 691
38 Ga0068856_100238328 3300005614 Bacteria 1835
39 Ga0068859_100404429 3300005617 Bacteria 1461
40 Ga0068861_101690684 3300005719 Bacteria 626
41 Ga0068861_102418384 3300005719 Bacteria 528
42 Ga0068863_100366642 3300005841 Bacteria 1405
43 Ga0068863_101153294 3300005841 Bacteria 780
44 Ga0068858_100128367 3300005842 Bacteria 2376
45 Ga0068860_100507330 3300005843 Bacteria 1205
46 Ga0081538_10008347 3300005981 Bacteria 8816
47 Ga0081539_10159525 3300005985 Bacteria 1076
48 Ga0070716_100037717 3300006173 Bacteria 2672
49 Ga0075427_10109804 3300006194 Bacteria 519
50 Ga0075428_100029748 3300006844 Bacteria 6042
51 Ga0075428_100567644 3300006844 Bacteria 1213
52 Ga0075428_101060878 3300006844 Bacteria 857
53 Ga0075430_100052786 3300006846 Bacteria 3424
54 Ga0075430_100309814 3300006846 Bacteria 1306
55 Ga0075431_100103515 3300006847 Bacteria 2938
56 Ga0075431_100169058 3300006847 Bacteria 2247
57 Ga0075433_11032026 3300006852 Bacteria 716
58 Ga0075433_11222853 3300006852 Bacteria 652
59 Ga0075434_100437467 3300006871 Bacteria 1329
60 Ga0075429_101081426 3300006880 Bacteria 701
61 Ga0068865_100050260 3300006881 Bacteria 2879
62 Ga0097620_100404450 3300006931 Bacteria 1461
63 Ga0075435_101737592 3300007076 Bacteria 547
64 Ga0105240_10125791 3300009093 Bacteria 3080
65 Ga0111539_10001035 3300009094 Bacteria 36474
66 Ga0111539_10006475 3300009094 Bacteria 15085
67 Ga0111539_10922702 3300009094 Bacteria 1015
68 Ga0105245_11546568 3300009098 Bacteria 715
69 Ga0114129_10176154 3300009147 Bacteria 2913
70 Ga0114129_10383362 3300009147 Bacteria 1856
71 Ga0105241_10752200 3300009174 Bacteria 894
72 Ga0105242_10883957 3300009176 Bacteria 892
73 Ga0105242_12745256 3300009176 Bacteria 542
74 Ga0105237_10000049 3300009545 Bacteria 162066
75 Ga0105237_11627682 3300009545 Bacteria 653
76 Ga0105249_11565329 3300009553 Bacteria 732
77 Ga0105239_10024485 3300010375 Bacteria 6651
78 Ga0105246_12054104 3300011119 Bacteria 553
79 Ga0157370_10007786 3300013104 Bacteria 11614
80 Ga0157369_10014996 3300013105 Bacteria 8746
81 Ga0157374_10378714 3300013296 Bacteria 1409
82 Ga0163162_10343786 3300013306 Bacteria 1624
83 Ga0157372_10092722 3300013307 Bacteria 3436
84 Ga0157375_10351430 3300013308 Bacteria 1640
85 Ga0163163_11907544 3300014325 Bacteria 654
86 Ga0157380_11671072 3300014326 Bacteria 694
87 Ga0157379_10182352 3300014968 Bacteria 1897
88 Ga0206356_11327636 3300020070 Bacteria 678
89 Ga0206349_1165721 3300020075 Bacteria 980
90 Ga0206351_10306384 3300020077 Bacteria 2077
91 Ga0206352_11170953 3300020078 Bacteria 775
92 Ga0206350_10663143 3300020080 Bacteria 551
93 Ga0154015_1027995 3300020610 Bacteria 2292
94 Ga0224712_10022784 3300022467 Bacteria 2164
95 Ga0207653_10458058 3300025885 Bacteria 501
96 Ga0207680_10004150 3300025903 Bacteria 6861
97 Ga0207699_10007727 3300025906 Bacteria 5264
98 Ga0207684_10955360 3300025910 Bacteria 719
99 Ga0207695_10000138 3300025913 Bacteria 217045
100 Ga0207695_10051572 3300025913 Bacteria 4318
101 Ga0207671_10000004 3300025914 Bacteria 1022356
102 Ga0207693_10403211 3300025915 Bacteria 1069
103 Ga0207663_10100203 3300025916 Bacteria 1944
104 Ga0207662_10078747 3300025918 Bacteria 2007
105 Ga0207657_10005738 3300025919 Bacteria 12950
106 Ga0207649_10256473 3300025920 Bacteria 1262
107 Ga0207646_10292574 3300025922 Bacteria 1472
108 Ga0207650_10794129 3300025925 Bacteria 802
109 Ga0207650_11749152 3300025925 Unclassified 526
110 Ga0207659_11385574 3300025926 Bacteria 603
111 Ga0207669_11571598 3300025937 Bacteria 561
112 Ga0207704_10033784 3300025938 Bacteria 2912
113 Ga0207679_11791995 3300025945 Bacteria 561
114 Ga0207667_10017773 3300025949 Bacteria 7998
115 Ga0207703_10247864 3300026035 Bacteria 1604
116 Ga0207639_10222858 3300026041 Bacteria 1630
117 Ga0207708_10091076 3300026075 Bacteria 2351
118 Ga0207702_10360911 3300026078 Bacteria 1392
119 Ga0207641_11428793 3300026088 Bacteria 693
120 Ga0207674_11728193 3300026116 Bacteria 593
121 Ga0207675_102164425 3300026118 Bacteria 572
122 Ga0207428_10027326 3300027907 Bacteria 4751
123 Ga0268264_10474534 3300028381 Bacteria 1216
124 Ga0265337_1001138 3300028556 Bacteria 13598
125 Ga0265326_10012318 3300028558 Bacteria 2516
126 Ga0265326_10026565 3300028558 Bacteria 1651
127 Ga0265319_1002262 3300028563 Bacteria 10656
128 Ga0265334_10004212 3300028573 Bacteria 6424
129 Ga0265318_10000909 3300028577 Bacteria 19288
130 Ga0265323_10102079 3300028653 Bacteria 948
131 Ga0265322_10218663 3300028654 Bacteria 546
132 Ga0265336_10052237 3300028666 Bacteria 1232
133 Ga0307515_10000004 3300028794 Bacteria 846506
134 Ga0265338_10000443 3300028800 Bacteria 73895
135 Ga0265338_10000728 3300028800 Bacteria 56126
136 Ga0265338_10001148 3300028800 Bacteria 43759
137 Ga0265338_10280031 3300028800 Unclassified 1219
138 Ga0310981_1077999 3300029285 Bacteria 542
139 Ga0265324_10000010 3300029957 Bacteria 252917
140 Ga0265324_10002723 3300029957 Bacteria 8797
141 Ga0265324_10021033 3300029957 Bacteria 2341
142 Ga0265320_10014410 3300031240 Bacteria 4502
143 Ga0265325_10026275 3300031241 Bacteria 3155
144 Ga0265340_10004477 3300031247 Bacteria 7802
145 Ga0265316_10001346 3300031344 Bacteria 26432
146 Ga0265316_10130477 3300031344 Bacteria 1893
147 Ga0265316_10228601 3300031344 Bacteria 1370
148 Ga0265316_10872727 3300031344 Bacteria 629
149 Ga0307408_100079227 3300031548 Bacteria 2451
150 Ga0265313_10001434 3300031595 Bacteria 22310
151 Ga0316575_10014941 3300031665 Bacteria 2922
152 Ga0316579_10044331 3300031691 Bacteria 2071
153 Ga0265314_10052328 3300031711 Bacteria 2839
154 Ga0265342_10007160 3300031712 Bacteria 8211
155 Ga0265342_10146175 3300031712 Bacteria 1316
156 Ga0316576_10195756 3300031727 Bacteria 1523
157 Ga0316578_10021650 3300031728 Bacteria 3571
158 Ga0307405_10478689 3300031731 Bacteria 993
159 Ga0307405_11669062 3300031731 Bacteria 564
160 Ga0316577_10004934 3300031733 Bacteria 6952
161 Ga0316577_10105898 3300031733 Bacteria 1578
162 Ga0307413_10000358 3300031824 Bacteria 14571
163 Ga0307413_11837376 3300031824 Bacteria 543
164 Ga0307410_10118508 3300031852 Bacteria 1926
165 Ga0307406_10029819 3300031901 Bacteria 3306
166 Ga0307407_10005295 3300031903 Bacteria 5580
167 Ga0307412_10258467 3300031911 Bacteria 1356
168 Ga0307409_100006401 3300031995 Bacteria 6916
169 Ga0307416_100037478 3300032002 Bacteria 3731
170 Ga0307414_10000124 3300032004 Bacteria 53995
171 Ga0307414_10040031 3300032004 Bacteria 3162
172 Ga0307411_10000403 3300032005 Bacteria 14825
173 Ga0307415_100593441 3300032126 Bacteria 984
174 Ga0307415_100683035 3300032126 Bacteria 924
175 Ga0316593_10015028 3300032168 Bacteria 2322
176 Ga0316593_10019975 3300032168 Bacteria 2077
177 Ga0316593_10071419 3300032168 Bacteria 1201
178 Ga0316588_1210925 3300033528 Bacteria 510
179 Ga0316587_1003302 3300033529 Bacteria 2248
180 Ga0316596_1012562 3300033541 Bacteria 2084
181 Ga0316596_1196828 3300033541 Bacteria 560
182 Ga0316574_0023101 3300035398 Bacteria 3710
183 Ga0316574_0061294 3300035398 Bacteria 2362
184 Ga0373947_0067298 3300035725 Bacteria 2188
185 Ga0316582_0008957 3300036647 Bacteria 5406
186 Ga0316582_0093421 3300036647 Bacteria 1983
187 Ga0316584_0010536 3300036712 Bacteria 6465
188 Ga0316584_0032657 3300036712 Bacteria 3853
189 Ga0316584_0038459 3300036712 Bacteria 3559
190 Ga0395899_0015251 3300037312 Bacteria 5858
191 Ga0395900_0418465 3300037418 Bacteria 1301
192 Ga0395905_0000771 3300037471 Bacteria 42221
193 Ga0395905_0028945 3300037471 Bacteria 5221
194 Ga0395901_0063499 3300038443 Bacteria 3843
195 Ga0451794_35143 3300041446 Bacteria 582
196 Ga0451795_0579388 3300041456 Bacteria 659
197 Ga0451577_1583560 3300042876 Bacteria 578
198 Ga0451577_1984078 3300042876 Bacteria 509
199 Ga0466969_0199358 3300044656 Bacteria 913
200 Ga0453683_0223933 3300044673 Bacteria 1197
201 Ga0466965_0246582 3300044683 Bacteria 957
202 Ga0466961_0002958 3300044693 Bacteria 10555
203 Ga0466961_0251892 3300044693 Bacteria 1084
204 Ga0453684_0035693 3300044712 Bacteria 6868
205 Ga0453684_0140178 3300044712 Bacteria 2889
206 Ga0453684_0314422 3300044712 Bacteria 1776
207 Ga0453684_0627259 3300044712 Bacteria 1175
208 Ga0466970_0145546 3300044765 Bacteria 1307
209 Ga0466957_0759839 3300044842 Bacteria 687
210 Ga0466960_0295202 3300044901 Bacteria 912
211 Ga0495605_0128136 3300046474 Bacteria 1146
212 Ga0495594_0013436 3300046499 Bacteria 4277
213 Ga0495583_0078609 3300046506 Bacteria 1437
214 Ga0495630_0618691 3300046517 Unclassified 830
215 Ga0495665_0178413 3300046531 Bacteria 1104
216 Ga0495640_0462246 3300046533 Bacteria 774
217 Ga0495586_0022646 3300046535 Archaea 3352
218 Ga0495586_0080859 3300046535 Bacteria 1785
219 Ga0495588_0357180 3300046674 Bacteria 768
220 Ga0495624_0512048 3300046690 Bacteria 718
221 Ga0495670_0581897 3300046691 Bacteria 610
222 Ga0495581_0010267 3300047315 Bacteria 5415
223 Ga0495636_0051976 3300047318 Bacteria 1718
224 Ga0496112_0283902 3300048915 Bacteria 1602
225 Ga0501306_079394 3300049127 Bacteria 564
226 Ga0501311_012427 3300049527 Bacteria 1062
227 Ga0501311_065870 3300049527 Bacteria 593
228 Ga0501311_090213 3300049527 Bacteria 531
229 Ga0501317_088137 3300049533 Bacteria 545
230 Ga0501317_103399 3300049533 Bacteria 516
231 Ga0501323_090887 3300049539 Bacteria 509
232 Ga0501335_022190 3300049551 Bacteria 683
233 Ga0501031_0070306 3300049568 Bacteria 2280
234 Ga0501033_0690750 3300049570 Bacteria 695
235 Ga0501037_0115795 3300049573 Bacteria 1929
236 Ga0501037_0448061 3300049573 Bacteria 881
237 Ga0501037_0817101 3300049573 Bacteria 615
238 Ga0501038_0670183 3300049574 Bacteria 779
239 Ga0501039_0174203 3300049575 Bacteria 1692
240 Ga0501039_0803766 3300049575 Bacteria 734
241 Ga0501040_0028545 3300049576 Bacteria 3762
242 Ga0501040_0085607 3300049576 Bacteria 2188
243 Ga0501040_0131505 3300049576 Bacteria 1760
244 Ga0501040_0371478 3300049576 Bacteria 1026
245 Ga0501041_0152582 3300049577 Bacteria 1443
246 Ga0501041_0517996 3300049577 Bacteria 759
247 Ga0501042_0171013 3300049578 Bacteria 1568
248 Ga0501042_0896615 3300049578 Bacteria 646
249 Ga0501043_0363033 3300049579 Bacteria 1099
250 Ga0501046_0616558 3300049580 Bacteria 769
251 Ga0501046_1199953 3300049580 Bacteria 521
252 Ga0501047_0008117 3300049581 Bacteria 9907
253 Ga0501048_0080430 3300049582 Bacteria 2299
254 Ga0501068_0393780 3300049584 Bacteria 893
255 Ga0501069_0848633 3300049585 Bacteria 555
256 Ga0501071_0033451 3300049587 Bacteria 3653
257 Ga0501071_1432490 3300049587 Bacteria 533
258 Ga0501072_0239248 3300049588 Bacteria 1446
259 Ga0501072_1232644 3300049588 Bacteria 581
260 Ga0501073_0394060 3300049589 Unclassified 957
261 Ga0501073_0795864 3300049589 Bacteria 652
262 Ga0501074_0335280 3300049590 Bacteria 1073
263 Ga0501074_1271002 3300049590 Bacteria 516
264 Ga0501075_0006097 3300049591 Bacteria 8278
265 Ga0501075_0093199 3300049591 Bacteria 2286
266 Ga0501075_0297495 3300049591 Bacteria 1230
267 Ga0501076_0048855 3300049592 Bacteria 3344
268 Ga0501076_0088397 3300049592 Bacteria 2490
269 Ga0501239_002720 3300049672 Bacteria 1628
270 Ga0501261_049483 3300049690 Bacteria 685
271 Ga0501219_005948 3300049703 Bacteria 871
272 Ga0501079_0086979 3300049741 Bacteria 2419
273 Ga0501079_0597100 3300049741 Bacteria 869
274 Ga0501080_0113379 3300049742 Bacteria 2513
275 Ga0501080_0975804 3300049742 Bacteria 736
276 Ga0501080_1116468 3300049742 Bacteria 680
277 Ga0501080_1871476 3300049742 Bacteria 503
278 Ga0501081_0035572 3300049743 Bacteria 3390
279 Ga0501083_0962995 3300049744 Bacteria 555
280 Ga0501035_1038719 3300049822 Bacteria 643
281 Ga0501044_0000720 3300049823 Bacteria 39907
282 Ga0501045_0079606 3300049824 Bacteria 2416
283 Ga0501045_0154786 3300049824 Bacteria 1706
284 Ga0501045_0628135 3300049824 Bacteria 794
285 nmdc:mga05p37_1518212_c1 3300050507 Bacteria 666
286 nmdc:mga05p37_336319_c1 3300050507 Bacteria 1782
287 nmdc:mga05p37_603615_c1 3300050507 Bacteria 1238
288 nmdc:mga05p37_623784_c1 3300050507 Bacteria 1213
289 nmdc:mga09592_335701_c1 3300050508 Bacteria 1308
290 nmdc:mga09592_882466_c1 3300050508 Bacteria 753
291 nmdc:mga0qj67_257499_c1 3300050509 Bacteria 1416
292 nmdc:mga0qj67_457239_c1 3300050509 Bacteria 1028
293 nmdc:mga0qj67_966788_c1 3300050509 Bacteria 669
294 nmdc:mga06r32_291008_c1 3300050510 Bacteria 1620
295 nmdc:mga06r32_375442_c1 3300050510 Bacteria 1405
296 nmdc:mga06r32_705879_c1 3300050510 Bacteria 974
297 nmdc:mga08y16_85274_c1 3300050511 Bacteria 3292
298 nmdc:mga0rr50_1820490_c1 3300050513 Bacteria 512
299 nmdc:mga0rr50_455669_c1 3300050513 Bacteria 1084
300 nmdc:mga0a205_190368_c1 3300050515 Bacteria 1944
301 nmdc:mga0a205_567767_c1 3300050515 Bacteria 989
302 Ga0495601_0290520 3300053077 Bacteria 1066
303 Ga0500618_012219 3300053125 Bacteria 2252
304 Ga0500573_0109034 3300053140 Bacteria 1551
305 Ga0500616_0000023 3300053153 Bacteria 456171
306 Ga0500627_0142203 3300053158 Bacteria 1084
307 Ga0501084_0044343 3300054114 Bacteria 3723
308 Ga0501084_0088798 3300054114 Bacteria 2595
309 Ga0501084_0107079 3300054114 Bacteria 2349
310 Ga0590077_005335 3300059426 Bacteria 2635
311 Ga0587066_020254 3300059490 Bacteria 1091
312 Ga0587070_010128 3300059491 Bacteria 1381
313 Ga0587070_155216 3300059491 Bacteria 577
314 Ga0587077_010951 3300059493 Bacteria 1414
315 Ga0587077_179258 3300059493 Bacteria 573
316 Ga0587080_117723 3300059503 Bacteria 586
317 Ga0587082_032189 3300059504 Bacteria 920
318 Ga0587082_043282 3300059504 Bacteria 834
319 Ga0587086_041734 3300059507 Bacteria 712
320 Ga0587092_001709 3300059512 Bacteria 2204
321 Ga0587094_043513 3300059513 Bacteria 739
322 Ga0587101_054484 3300059623 Bacteria 698
323 Ga0587062_067873 3300059639 Bacteria 639
324 Ga0587068_013750 3300059641 Bacteria 1252
325 Ga0587072_010093 3300059643 Bacteria 1521
326 Ga0587076_027831 3300059645 Bacteria 982
327 Ga0587076_211618 3300059645 Bacteria 504
328 Ga0587078_016422 3300059646 Bacteria 901
329 Ga0587079_248706 3300059647 Bacteria 505
330 Ga0587111_0033816 3300060346 Bacteria 1058
331 Ga0587111_0048420 3300060346 Bacteria 930
332 Ga0587111_0164920 3300060346 Bacteria 605
333 Ga0501082_0107030 3300060353 Bacteria 2419
334 Ga0501082_1905935 3300060353 Bacteria 518
335 Ga0530510_0028469 3300061734 Bacteria 4007
336 Ga0530510_0255898 3300061734 Bacteria 1305

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300029285 Ga0310981_1077999 Ga0310981_10779991 81
2 3300013296 Ga0157374_10378714 Ga0157374_103787142 84
3 3300050507 nmdc:mga05p37_603615_c1 nmdc:mga05p37_603615_c1_669_926 85
4 3300005289 Ga0065704_10119766 Ga0065704_101197662 89
5 3300005549 Ga0070704_100587600 Ga0070704_1005876002 89
6 3300020080 Ga0206350_10663143 Ga0206350_106631431 89
7 3300028653 Ga0265323_10102079 Ga0265323_101020792 89
8 3300031344 Ga0265316_10001346 Ga0265316_100013465 89
9 3300031712 Ga0265342_10146175 Ga0265342_101461752 89
10 3300032004 Ga0307414_10000124 Ga0307414_1000012447 89
11 3300041446 Ga0451794_35143 Ga0451794_35143_163_459 89
12 3300041456 Ga0451795_0579388 Ga0451795_0579388_179_457 89
13 3300049127 Ga0501306_079394 Ga0501306_079394_238_516 89
14 3300049527 Ga0501311_065870 Ga0501311_065870_282_560 89
15 3300049527 Ga0501311_090213 Ga0501311_090213_13_291 89
16 3300049533 Ga0501317_103399 Ga0501317_103399_17_295 89
17 3300049539 Ga0501323_090887 Ga0501323_090887_12_290 89
18 3300049551 Ga0501335_022190 Ga0501335_022190_12_290 89
19 3300053158 Ga0500627_0142203 Ga0500627_0142203_221_496 89
20 3300059491 Ga0587070_010128 Ga0587070_010128_471_767 89
21 3300059641 Ga0587068_013750 Ga0587068_013750_553_849 89
22 3300059643 Ga0587072_010093 Ga0587072_010093_492_788 89
23 3300060346 Ga0587111_0033816 Ga0587111_0033816_740_1018 89
24 iso_pu_bacteria 2911138879 2911143016 89
25 3300053125 Ga0500618_012219 Ga0500618_012219_614_892 92
26 3300046517 Ga0495630_0618691 Ga0495630_0618691_157_441 93
27 3300046535 Ga0495586_0022646 Ga0495586_0022646_2967_3251 93
28 3300046535 Ga0495586_0080859 Ga0495586_0080859_31_315 93
29 3300005329 Ga0070683_100099899 Ga0070683_1000998993 94
30 3300005329 Ga0070683_100164413 Ga0070683_1001644132 94
31 3300005331 Ga0070670_102185362 Ga0070670_1021853621 94
32 3300005339 Ga0070660_101121949 Ga0070660_1011219492 94
33 3300005354 Ga0070675_101673186 Ga0070675_1016731862 94
34 3300005356 Ga0070674_101408457 Ga0070674_1014084572 94
35 3300005434 Ga0070709_10010949 Ga0070709_100109494 94
36 3300005439 Ga0070711_100513181 Ga0070711_1005131811 94
37 3300005535 Ga0070684_100014439 Ga0070684_1000144392 94
38 3300005536 Ga0070697_101947875 Ga0070697_1019478751 94
39 3300005549 Ga0070704_100128788 Ga0070704_1001287882 94
40 3300005563 Ga0068855_100167904 Ga0068855_1001679043 94
41 3300005564 Ga0070664_100041807 Ga0070664_1000418075 94
42 3300005614 Ga0068856_100238328 Ga0068856_1002383283 94
43 3300006173 Ga0070716_100037717 Ga0070716_1000377172 94
44 3300006844 Ga0075428_100567644 Ga0075428_1005676442 94
45 3300006846 Ga0075430_100309814 Ga0075430_1003098142 94
46 3300006847 Ga0075431_100169058 Ga0075431_1001690582 94
47 3300006852 Ga0075433_11032026 Ga0075433_110320262 94
48 3300009093 Ga0105240_10125791 Ga0105240_101257912 94
49 3300009147 Ga0114129_10383362 Ga0114129_103833622 94
50 3300009174 Ga0105241_10752200 Ga0105241_107522002 94
51 3300009176 Ga0105242_12745256 Ga0105242_127452562 94
52 3300009545 Ga0105237_11627682 Ga0105237_116276821 94
53 3300013104 Ga0157370_10007786 Ga0157370_100077869 94
54 3300013105 Ga0157369_10014996 Ga0157369_100149965 94
55 3300013307 Ga0157372_10092722 Ga0157372_100927223 94
56 3300014325 Ga0163163_11907544 Ga0163163_119075442 94
57 3300020070 Ga0206356_11327636 Ga0206356_113276361 94
58 3300020075 Ga0206349_1165721 Ga0206349_11657211 94
59 3300020077 Ga0206351_10306384 Ga0206351_103063841 94
60 3300020078 Ga0206352_11170953 Ga0206352_111709532 94
61 3300020610 Ga0154015_1027995 Ga0154015_10279951 94
62 3300022467 Ga0224712_10022784 Ga0224712_100227841 94
63 3300025906 Ga0207699_10007727 Ga0207699_100077272 94
64 3300025913 Ga0207695_10051572 Ga0207695_100515723 94
65 3300025915 Ga0207693_10403211 Ga0207693_104032112 94
66 3300025916 Ga0207663_10100203 Ga0207663_101002032 94
67 3300025920 Ga0207649_10256473 Ga0207649_102564732 94
68 3300025925 Ga0207650_11749152 Ga0207650_117491521 94
69 3300025926 Ga0207659_11385574 Ga0207659_113855742 94
70 3300025937 Ga0207669_11571598 Ga0207669_115715982 94
71 3300025945 Ga0207679_11791995 Ga0207679_117919951 94
72 3300025949 Ga0207667_10017773 Ga0207667_100177734 94
73 3300026041 Ga0207639_10222858 Ga0207639_102228582 94
74 3300026078 Ga0207702_10360911 Ga0207702_103609112 94
75 3300028654 Ga0265322_10218663 Ga0265322_102186632 94
76 3300029957 Ga0265324_10000010 Ga0265324_10000010194 94
77 3300031344 Ga0265316_10130477 Ga0265316_101304772 94
78 3300031344 Ga0265316_10872727 Ga0265316_108727272 94
79 3300031548 Ga0307408_100079227 Ga0307408_1000792272 94
80 3300031665 Ga0316575_10014941 Ga0316575_100149412 94
81 3300031731 Ga0307405_10478689 Ga0307405_104786891 94
82 3300031824 Ga0307413_10000358 Ga0307413_100003584 94
83 3300031824 Ga0307413_11837376 Ga0307413_118373762 94
84 3300031852 Ga0307410_10118508 Ga0307410_101185081 94
85 3300031901 Ga0307406_10029819 Ga0307406_100298192 94
86 3300031903 Ga0307407_10005295 Ga0307407_100052953 94
87 3300031911 Ga0307412_10258467 Ga0307412_102584672 94
88 3300031995 Ga0307409_100006401 Ga0307409_1000064017 94
89 3300032002 Ga0307416_100037478 Ga0307416_1000374784 94
90 3300032004 Ga0307414_10040031 Ga0307414_100400312 94
91 3300032005 Ga0307411_10000403 Ga0307411_1000040312 94
92 3300032126 Ga0307415_100593441 Ga0307415_1005934412 94
93 3300032126 Ga0307415_100683035 Ga0307415_1006830352 94
94 3300032168 Ga0316593_10015028 Ga0316593_100150283 94
95 3300032168 Ga0316593_10019975 Ga0316593_100199752 94
96 3300033528 Ga0316588_1210925 Ga0316588_12109252 94
97 3300033529 Ga0316587_1003302 Ga0316587_10033021 94
98 3300033541 Ga0316596_1012562 Ga0316596_10125621 94
99 3300033541 Ga0316596_1196828 Ga0316596_11968282 94
100 3300035725 Ga0373947_0067298 Ga0373947_0067298_105_407 94
101 3300042876 Ga0451577_1583560 Ga0451577_1583560_174_458 94
102 3300042876 Ga0451577_1984078 Ga0451577_1984078_165_449 94
103 3300044693 Ga0466961_0251892 Ga0466961_0251892_13_297 94
104 3300044712 Ga0453684_0035693 Ga0453684_0035693_1623_1907 94
105 3300044712 Ga0453684_0314422 Ga0453684_0314422_1251_1535 94
106 3300044712 Ga0453684_0627259 Ga0453684_0627259_244_528 94
107 3300044765 Ga0466970_0145546 Ga0466970_0145546_26_310 94
108 3300044901 Ga0466960_0295202 Ga0466960_0295202_501_785 94
109 3300046474 Ga0495605_0128136 Ga0495605_0128136_840_1133 94
110 3300046499 Ga0495594_0013436 Ga0495594_0013436_458_760 94
111 3300046506 Ga0495583_0078609 Ga0495583_0078609_1009_1302 94
112 3300046531 Ga0495665_0178413 Ga0495665_0178413_667_969 94
113 3300046533 Ga0495640_0462246 Ga0495640_0462246_446_748 94
114 3300046674 Ga0495588_0357180 Ga0495588_0357180_279_581 94
115 3300046690 Ga0495624_0512048 Ga0495624_0512048_32_316 94
116 3300047315 Ga0495581_0010267 Ga0495581_0010267_3460_3762 94
117 3300048915 Ga0496112_0283902 Ga0496112_0283902_1161_1463 94
118 3300049533 Ga0501317_088137 Ga0501317_088137_206_514 94
119 3300049568 Ga0501031_0070306 Ga0501031_0070306_35_328 94
120 3300049570 Ga0501033_0690750 Ga0501033_0690750_47_337 94
121 3300049573 Ga0501037_0817101 Ga0501037_0817101_197_487 94
122 3300049576 Ga0501040_0028545 Ga0501040_0028545_1550_1843 94
123 3300049576 Ga0501040_0131505 Ga0501040_0131505_160_450 94
124 3300049577 Ga0501041_0517996 Ga0501041_0517996_45_338 94
125 3300049578 Ga0501042_0896615 Ga0501042_0896615_140_430 94
126 3300049580 Ga0501046_0616558 Ga0501046_0616558_287_577 94
127 3300049580 Ga0501046_1199953 Ga0501046_1199953_99_383 94
128 3300049582 Ga0501048_0080430 Ga0501048_0080430_1850_2143 94
129 3300049584 Ga0501068_0393780 Ga0501068_0393780_138_428 94
130 3300049587 Ga0501071_0033451 Ga0501071_0033451_1565_1858 94
131 3300049588 Ga0501072_1232644 Ga0501072_1232644_160_453 94
132 3300049590 Ga0501074_0335280 Ga0501074_0335280_768_1061 94
133 3300049590 Ga0501074_1271002 Ga0501074_1271002_173_463 94
134 3300049591 Ga0501075_0006097 Ga0501075_0006097_7554_7844 94
135 3300049591 Ga0501075_0093199 Ga0501075_0093199_242_535 94
136 3300049592 Ga0501076_0048855 Ga0501076_0048855_542_832 94
137 3300049592 Ga0501076_0088397 Ga0501076_0088397_283_576 94
138 3300049672 Ga0501239_002720 Ga0501239_002720_404_706 94
139 3300049690 Ga0501261_049483 Ga0501261_049483_72_356 94
140 3300049703 Ga0501219_005948 Ga0501219_005948_496_798 94
141 3300049741 Ga0501079_0086979 Ga0501079_0086979_499_789 94
142 3300049742 Ga0501080_0975804 Ga0501080_0975804_314_607 94
143 3300049742 Ga0501080_1871476 Ga0501080_1871476_34_327 94
144 3300049743 Ga0501081_0035572 Ga0501081_0035572_2548_2838 94
145 3300049744 Ga0501083_0962995 Ga0501083_0962995_130_423 94
146 3300049822 Ga0501035_1038719 Ga0501035_1038719_15_305 94
147 3300049824 Ga0501045_0079606 Ga0501045_0079606_1844_2137 94
148 3300049824 Ga0501045_0628135 Ga0501045_0628135_447_737 94
149 3300050508 nmdc:mga09592_335701_c1 nmdc:mga09592_335701_c1_666_956 94
150 3300050509 nmdc:mga0qj67_966788_c1 nmdc:mga0qj67_966788_c1_30_320 94
151 3300050510 nmdc:mga06r32_375442_c1 nmdc:mga06r32_375442_c1_1050_1340 94
152 3300050513 nmdc:mga0rr50_455669_c1 nmdc:mga0rr50_455669_c1_531_833 94
153 3300050515 nmdc:mga0a205_190368_c1 nmdc:mga0a205_190368_c1_1373_1663 94
154 3300054114 Ga0501084_0044343 Ga0501084_0044343_2239_2532 94
155 3300054114 Ga0501084_0107079 Ga0501084_0107079_1786_2076 94
156 3300059426 Ga0590077_005335 Ga0590077_005335_1008_1310 94
157 3300059490 Ga0587066_020254 Ga0587066_020254_62_346 94
158 3300059491 Ga0587070_155216 Ga0587070_155216_75_359 94
159 3300059493 Ga0587077_179258 Ga0587077_179258_71_355 94
160 3300059503 Ga0587080_117723 Ga0587080_117723_253_537 94
161 3300059504 Ga0587082_043282 Ga0587082_043282_482_766 94
162 3300059507 Ga0587086_041734 Ga0587086_041734_360_644 94
163 3300059512 Ga0587092_001709 Ga0587092_001709_153_437 94
164 3300059513 Ga0587094_043513 Ga0587094_043513_64_348 94
165 3300059623 Ga0587101_054484 Ga0587101_054484_28_312 94
166 3300059645 Ga0587076_027831 Ga0587076_027831_630_914 94
167 3300059645 Ga0587076_211618 Ga0587076_211618_66_350 94
168 3300059646 Ga0587078_016422 Ga0587078_016422_30_314 94
169 3300059647 Ga0587079_248706 Ga0587079_248706_133_435 94
170 3300060346 Ga0587111_0048420 Ga0587111_0048420_76_360 94
171 3300060346 Ga0587111_0164920 Ga0587111_0164920_62_364 94
172 3300060353 Ga0501082_1905935 Ga0501082_1905935_156_449 94
173 3300061734 Ga0530510_0028469 Ga0530510_0028469_60_353 94
174 3300061734 Ga0530510_0255898 Ga0530510_0255898_662_952 94
175 3300004785 Ga0058858_1420551 Ga0058858_14205512 95
176 3300004799 Ga0058863_11632032 Ga0058863_116320321 95
177 3300004800 Ga0058861_12066965 Ga0058861_120669652 95
178 3300004801 Ga0058860_10111968 Ga0058860_101119684 95
179 3300004803 Ga0058862_12708775 Ga0058862_127087752 95
180 3300005330 Ga0070690_100229682 Ga0070690_1002296821 95
181 3300005331 Ga0070670_101191844 Ga0070670_1011918441 95
182 3300005335 Ga0070666_10002810 Ga0070666_1000281011 95
183 3300005339 Ga0070660_100043602 Ga0070660_1000436023 95
184 3300005340 Ga0070689_101100425 Ga0070689_1011004251 95
185 3300005367 Ga0070667_100058985 Ga0070667_1000589852 95
186 3300005436 Ga0070713_101735018 Ga0070713_1017350181 95
187 3300005438 Ga0070701_10665997 Ga0070701_106659972 95
188 3300005441 Ga0070700_100473315 Ga0070700_1004733151 95
189 3300005459 Ga0068867_102264089 Ga0068867_1022640891 95
190 3300005467 Ga0070706_101909627 Ga0070706_1019096271 95
191 3300005468 Ga0070707_100173080 Ga0070707_1001730802 95
192 3300005471 Ga0070698_100371596 Ga0070698_1003715961 95
193 3300005539 Ga0068853_101488280 Ga0068853_1014882801 95
194 3300005544 Ga0070686_100000004 Ga0070686_10000000442 95
195 3300005544 Ga0070686_100061763 Ga0070686_1000617633 95
196 3300005577 Ga0068857_101357310 Ga0068857_1013573102 95
197 3300005617 Ga0068859_100404429 Ga0068859_1004044292 95
198 3300005719 Ga0068861_101690684 Ga0068861_1016906842 95
199 3300005719 Ga0068861_102418384 Ga0068861_1024183841 95
200 3300005841 Ga0068863_100366642 Ga0068863_1003666422 95
201 3300005841 Ga0068863_101153294 Ga0068863_1011532942 95
202 3300005842 Ga0068858_100128367 Ga0068858_1001283672 95
203 3300005843 Ga0068860_100507330 Ga0068860_1005073302 95
204 3300005981 Ga0081538_10008347 Ga0081538_100083476 95
205 3300005985 Ga0081539_10159525 Ga0081539_101595251 95
206 3300006194 Ga0075427_10109804 Ga0075427_101098041 95
207 3300006844 Ga0075428_100029748 Ga0075428_1000297485 95
208 3300006844 Ga0075428_101060878 Ga0075428_1010608782 95
209 3300006846 Ga0075430_100052786 Ga0075430_1000527862 95
210 3300006847 Ga0075431_100103515 Ga0075431_1001035151 95
211 3300006852 Ga0075433_11222853 Ga0075433_112228531 95
212 3300006871 Ga0075434_100437467 Ga0075434_1004374672 95
213 3300006880 Ga0075429_101081426 Ga0075429_1010814262 95
214 3300006881 Ga0068865_100050260 Ga0068865_1000502602 95
215 3300006931 Ga0097620_100404450 Ga0097620_1004044502 95
216 3300007076 Ga0075435_101737592 Ga0075435_1017375921 95
217 3300009094 Ga0111539_10001035 Ga0111539_1000103511 95
218 3300009094 Ga0111539_10006475 Ga0111539_1000647511 95
219 3300009094 Ga0111539_10922702 Ga0111539_109227022 95
220 3300009098 Ga0105245_11546568 Ga0105245_115465681 95
221 3300009147 Ga0114129_10176154 Ga0114129_101761543 95
222 3300009176 Ga0105242_10883957 Ga0105242_108839571 95
223 3300009545 Ga0105237_10000049 Ga0105237_1000004986 95
224 3300009553 Ga0105249_11565329 Ga0105249_115653291 95
225 3300010375 Ga0105239_10024485 Ga0105239_100244856 95
226 3300011119 Ga0105246_12054104 Ga0105246_120541041 95
227 3300013306 Ga0163162_10343786 Ga0163162_103437863 95
228 3300013308 Ga0157375_10351430 Ga0157375_103514302 95
229 3300014326 Ga0157380_11671072 Ga0157380_116710721 95
230 3300014968 Ga0157379_10182352 Ga0157379_101823522 95
231 3300025885 Ga0207653_10458058 Ga0207653_104580581 95
232 3300025903 Ga0207680_10004150 Ga0207680_100041502 95
233 3300025910 Ga0207684_10955360 Ga0207684_109553602 95
234 3300025913 Ga0207695_10000138 Ga0207695_1000013825 95
235 3300025914 Ga0207671_10000004 Ga0207671_10000004187 95
236 3300025918 Ga0207662_10078747 Ga0207662_100787472 95
237 3300025919 Ga0207657_10005738 Ga0207657_100057387 95
238 3300025922 Ga0207646_10292574 Ga0207646_102925742 95
239 3300025925 Ga0207650_10794129 Ga0207650_107941291 95
240 3300025938 Ga0207704_10033784 Ga0207704_100337842 95
241 3300026035 Ga0207703_10247864 Ga0207703_102478641 95
242 3300026075 Ga0207708_10091076 Ga0207708_100910761 95
243 3300026088 Ga0207641_11428793 Ga0207641_114287932 95
244 3300026116 Ga0207674_11728193 Ga0207674_117281931 95
245 3300026118 Ga0207675_102164425 Ga0207675_1021644251 95
246 3300027907 Ga0207428_10027326 Ga0207428_100273265 95
247 3300028381 Ga0268264_10474534 Ga0268264_104745341 95
248 3300028556 Ga0265337_1001138 Ga0265337_100113812 95
249 3300028558 Ga0265326_10012318 Ga0265326_100123182 95
250 3300028558 Ga0265326_10026565 Ga0265326_100265652 95
251 3300028563 Ga0265319_1002262 Ga0265319_10022627 95
252 3300028573 Ga0265334_10004212 Ga0265334_100042124 95
253 3300028577 Ga0265318_10000909 Ga0265318_1000090915 95
254 3300028666 Ga0265336_10052237 Ga0265336_100522372 95
255 3300028794 Ga0307515_10000004 Ga0307515_10000004463 95
256 3300028800 Ga0265338_10000443 Ga0265338_100004433 95
257 3300028800 Ga0265338_10000728 Ga0265338_1000072858 95
258 3300028800 Ga0265338_10001148 Ga0265338_100011485 95
259 3300028800 Ga0265338_10280031 Ga0265338_102800312 95
260 3300029957 Ga0265324_10002723 Ga0265324_100027235 95
261 3300029957 Ga0265324_10021033 Ga0265324_100210332 95
262 3300031240 Ga0265320_10014410 Ga0265320_100144105 95
263 3300031241 Ga0265325_10026275 Ga0265325_100262753 95
264 3300031247 Ga0265340_10004477 Ga0265340_100044775 95
265 3300031344 Ga0265316_10228601 Ga0265316_102286012 95
266 3300031595 Ga0265313_10001434 Ga0265313_100014345 95
267 3300031691 Ga0316579_10044331 Ga0316579_100443312 95
268 3300031711 Ga0265314_10052328 Ga0265314_100523282 95
269 3300031712 Ga0265342_10007160 Ga0265342_100071603 95
270 3300031727 Ga0316576_10195756 Ga0316576_101957562 95
271 3300031728 Ga0316578_10021650 Ga0316578_100216503 95
272 3300031731 Ga0307405_11669062 Ga0307405_116690622 95
273 3300031733 Ga0316577_10004934 Ga0316577_100049346 95
274 3300031733 Ga0316577_10105898 Ga0316577_101058982 95
275 3300032168 Ga0316593_10071419 Ga0316593_100714191 95
276 3300035398 Ga0316574_0023101 Ga0316574_0023101_2095_2397 95
277 3300035398 Ga0316574_0061294 Ga0316574_0061294_392_679 95
278 3300036647 Ga0316582_0008957 Ga0316582_0008957_3162_3449 95
279 3300036647 Ga0316582_0093421 Ga0316582_0093421_1413_1715 95
280 3300036712 Ga0316584_0010536 Ga0316584_0010536_1499_1786 95
281 3300036712 Ga0316584_0032657 Ga0316584_0032657_2747_3049 95
282 3300036712 Ga0316584_0038459 Ga0316584_0038459_779_1075 95
283 3300037312 Ga0395899_0015251 Ga0395899_0015251_1650_1955 95
284 3300037418 Ga0395900_0418465 Ga0395900_0418465_445_750 95
285 3300037471 Ga0395905_0000771 Ga0395905_0000771_35023_35313 95
286 3300037471 Ga0395905_0028945 Ga0395905_0028945_3808_4113 95
287 3300038443 Ga0395901_0063499 Ga0395901_0063499_973_1278 95
288 3300044656 Ga0466969_0199358 Ga0466969_0199358_361_666 95
289 3300044673 Ga0453683_0223933 Ga0453683_0223933_497_784 95
290 3300044683 Ga0466965_0246582 Ga0466965_0246582_207_512 95
291 3300044693 Ga0466961_0002958 Ga0466961_0002958_4047_4352 95
292 3300044712 Ga0453684_0140178 Ga0453684_0140178_1865_2152 95
293 3300044842 Ga0466957_0759839 Ga0466957_0759839_10_297 95
294 3300046691 Ga0495670_0581897 Ga0495670_0581897_284_574 95
295 3300047318 Ga0495636_0051976 Ga0495636_0051976_283_573 95
296 3300049527 Ga0501311_012427 Ga0501311_012427_125_412 95
297 3300049573 Ga0501037_0115795 Ga0501037_0115795_371_658 95
298 3300049573 Ga0501037_0448061 Ga0501037_0448061_200_487 95
299 3300049574 Ga0501038_0670183 Ga0501038_0670183_375_662 95
300 3300049575 Ga0501039_0174203 Ga0501039_0174203_1366_1653 95
301 3300049575 Ga0501039_0803766 Ga0501039_0803766_284_640 95
302 3300049576 Ga0501040_0085607 Ga0501040_0085607_752_1039 95
303 3300049576 Ga0501040_0371478 Ga0501040_0371478_710_997 95
304 3300049577 Ga0501041_0152582 Ga0501041_0152582_1004_1291 95
305 3300049578 Ga0501042_0171013 Ga0501042_0171013_553_840 95
306 3300049579 Ga0501043_0363033 Ga0501043_0363033_182_469 95
307 3300049581 Ga0501047_0008117 Ga0501047_0008117_4112_4399 95
308 3300049585 Ga0501069_0848633 Ga0501069_0848633_69_425 95
309 3300049587 Ga0501071_1432490 Ga0501071_1432490_158_514 95
310 3300049588 Ga0501072_0239248 Ga0501072_0239248_922_1209 95
311 3300049589 Ga0501073_0394060 Ga0501073_0394060_97_414 95
312 3300049589 Ga0501073_0795864 Ga0501073_0795864_286_642 95
313 3300049591 Ga0501075_0297495 Ga0501075_0297495_712_1020 95
314 3300049741 Ga0501079_0597100 Ga0501079_0597100_510_797 95
315 3300049742 Ga0501080_0113379 Ga0501080_0113379_970_1257 95
316 3300049742 Ga0501080_1116468 Ga0501080_1116468_195_482 95
317 3300049823 Ga0501044_0000720 Ga0501044_0000720_3222_3509 95
318 3300049824 Ga0501045_0154786 Ga0501045_0154786_1313_1600 95
319 3300050507 nmdc:mga05p37_1518212_c1 nmdc:mga05p37_1518212_c1_356_643 95
320 3300050507 nmdc:mga05p37_336319_c1 nmdc:mga05p37_336319_c1_1023_1310 95
321 3300050507 nmdc:mga05p37_623784_c1 nmdc:mga05p37_623784_c1_71_358 95
322 3300050508 nmdc:mga09592_882466_c1 nmdc:mga09592_882466_c1_295_582 95
323 3300050509 nmdc:mga0qj67_257499_c1 nmdc:mga0qj67_257499_c1_357_644 95
324 3300050509 nmdc:mga0qj67_457239_c1 nmdc:mga0qj67_457239_c1_506_793 95
325 3300050510 nmdc:mga06r32_291008_c1 nmdc:mga06r32_291008_c1_458_745 95
326 3300050510 nmdc:mga06r32_705879_c1 nmdc:mga06r32_705879_c1_228_515 95
327 3300050511 nmdc:mga08y16_85274_c1 nmdc:mga08y16_85274_c1_1526_1813 95
328 3300050513 nmdc:mga0rr50_1820490_c1 nmdc:mga0rr50_1820490_c1_37_324 95
329 3300050515 nmdc:mga0a205_567767_c1 nmdc:mga0a205_567767_c1_229_516 95
330 3300053077 Ga0495601_0290520 Ga0495601_0290520_606_899 95
331 3300053140 Ga0500573_0109034 Ga0500573_0109034_587_877 95
332 3300053153 Ga0500616_0000023 Ga0500616_0000023_317298_317591 95
333 3300054114 Ga0501084_0088798 Ga0501084_0088798_534_821 95
334 3300059493 Ga0587077_010951 Ga0587077_010951_113_403 95
335 3300059504 Ga0587082_032189 Ga0587082_032189_581_871 95
336 3300059639 Ga0587062_067873 Ga0587062_067873_232_543 95
337 3300060353 Ga0501082_0107030 Ga0501082_0107030_433_720 95

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00166

Cpn10

Chaperonin 10 Kd subunit

2

94

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9514 2 95
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.9461 2 95
1wnr-assembly1.cif.gz_E crystal structure of the cpn10 from thermus thermophilus hb8 0.9391 2 95
1wnr-assembly1.cif.gz_G crystal structure of the cpn10 from thermus thermophilus hb8 0.9357 2 95
1wnr-assembly1.cif.gz_C crystal structure of the cpn10 from thermus thermophilus hb8 0.9245 2 95
ID Description Score Start End Superfamily
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9612 2 95 2.30.33.40
1wnrD00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9487 2 95 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9158 2 95 2.30.33.40
3nx6A00 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.9041 2 95 2.30.33.40
af_Q8I5Q3_1_103_2.30.33.40 Mainly Beta;Roll;10 Kd Chaperonin, Protein Cpn10; Chain O;GroES chaperonin 0.814 3 95 2.30.33.40
ID Description Score Start End GO Terms
AF-Q9KJ24-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9546 2 95 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-F3MU37-F1-model_v4 deleted 0.9545 2 95
AF-A0A2E5NXF0-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.949 3 95 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-Q9KJ24-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9449 2 95 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087
AF-O32846-F1-model_v4 Co-chaperonin GroES (10 kDa chaperonin) (Chaperonin-10) (Cpn10) 0.9433 2 94 GO:0005524
GO:0005737
GO:0044183
GO:0046872
GO:0051082
GO:0051085
GO:0051087

Feature Viewer

pLDDT pTM Quality
88.26 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map