F412333

General Info

Members Datasets Scaffolds Average Seq Length
335 203 670 254

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0980249|Ga0436360_0980249_2727_3512
Length 261
Sequence MRTETMKAVLLAGGLGTRFSEETDVKPKPMIEIGGMPIIWHIMKIYSYYGINDFVVCLGYKGYVIKEYFRNYFLHMSNVTFDMKTNSMEVHDAAAEPWRVTLVDTGEKTMIGGRIKRILPYLGEDREFCLTYGDGVGDVDVGAVVDLHRREGRLATVTATQPPGRFGAIRHLGHRVTGFQEKPVGDGGWINGGFFVLSPEVGRYIEGDATVWEQEPMQRLAAEGRLSVYFHQGFWQPMDTLRDKRHLENLWASGQAPWKVW

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
119 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
177 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
184 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
185 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
186 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
187 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
188 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
189 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
190 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
191 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
192 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
193 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
194 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
195 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
196 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
197 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
198 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
199 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
200 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
201 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
202 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
203 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.73
Metatranscriptomes 0
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 7.46
Rhizoplane 0.3
Rhizosphere 85.37
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0980249 3300039438 Bacteria 3764
2 Ga0065707_10084428 3300005295 Bacteria 7211
3 Ga0070658_10000596 3300005327 Bacteria 31295
4 Ga0070658_10010713 3300005327 Bacteria 7345
5 Ga0070676_10006578 3300005328 Bacteria 6214
6 Ga0070683_100018434 3300005329 Bacteria 6183
7 Ga0070683_100036089 3300005329 Bacteria 4522
8 Ga0070690_100067680 3300005330 Bacteria 2314
9 Ga0070690_100498697 3300005330 Bacteria 910
10 Ga0070670_100067805 3300005331 Bacteria 3061
11 Ga0070670_100069814 3300005331 Bacteria 3016
12 Ga0070670_100198584 3300005331 Bacteria 1743
13 Ga0070670_100343425 3300005331 Bacteria 1311
14 Ga0070677_10071676 3300005333 Bacteria 1459
15 Ga0070666_10036602 3300005335 Bacteria 3259
16 Ga0070680_100038229 3300005336 Bacteria 3881
17 Ga0070682_100133138 3300005337 Bacteria 1685
18 Ga0068868_100066594 3300005338 Bacteria 2864
19 Ga0068868_100257887 3300005338 Bacteria 1469
20 Ga0070660_100003070 3300005339 Bacteria 11480
21 Ga0070660_100129403 3300005339 Bacteria 2019
22 Ga0070660_100584344 3300005339 Bacteria 933
23 Ga0070689_100324636 3300005340 Bacteria 1286
24 Ga0070689_100338272 3300005340 Bacteria 1260
25 Ga0070691_10185788 3300005341 Bacteria 1084
26 Ga0070661_100102430 3300005344 Bacteria 2131
27 Ga0070668_100035103 3300005347 Bacteria 3822
28 Ga0070669_100000488 3300005353 Bacteria 30076
29 Ga0070669_100006723 3300005353 Bacteria 8280
30 Ga0070669_100029994 3300005353 Bacteria 3922
31 Ga0070669_100120140 3300005353 Bacteria 2004
32 Ga0070675_100000252 3300005354 Bacteria 34898
33 Ga0070675_100010180 3300005354 Bacteria 7335
34 Ga0070675_100031164 3300005354 Bacteria 4309
35 Ga0070674_100369163 3300005356 Bacteria 1164
36 Ga0070673_100023093 3300005364 Bacteria 4540
37 Ga0070673_100123204 3300005364 Bacteria 2166
38 Ga0070673_100282062 3300005364 Bacteria 1457
39 Ga0070659_100008373 3300005366 Bacteria 7554
40 Ga0070659_100008464 3300005366 Bacteria 7518
41 Ga0070667_100002604 3300005367 Bacteria 15663
42 Ga0070667_100216932 3300005367 Bacteria 1702
43 Ga0070667_100287192 3300005367 Bacteria 1478
44 Ga0070667_100337407 3300005367 Bacteria 1362
45 Ga0070714_100051913 3300005435 Bacteria 3496
46 Ga0070714_100374689 3300005435 Bacteria 1341
47 Ga0070714_100483374 3300005435 Bacteria 1179
48 Ga0070700_100009336 3300005441 Bacteria 5377
49 Ga0070663_100016896 3300005455 Bacteria 4749
50 Ga0070663_100502733 3300005455 Bacteria 1007
51 Ga0070662_100010169 3300005457 Bacteria 6167
52 Ga0070662_100014218 3300005457 Bacteria 5312
53 Ga0070681_10149212 3300005458 Bacteria 2265
54 Ga0068867_100003514 3300005459 Bacteria 11020
55 Ga0070685_10255864 3300005466 Bacteria 1162
56 Ga0070679_100011713 3300005530 Bacteria 8360
57 Ga0070679_100073625 3300005530 Bacteria 3407
58 Ga0070684_100019423 3300005535 Bacteria 5621
59 Ga0068853_100269303 3300005539 Bacteria 1568
60 Ga0070672_100001069 3300005543 Bacteria 16676
61 Ga0070672_100008613 3300005543 Bacteria 6988
62 Ga0070672_100134124 3300005543 Bacteria 2038
63 Ga0070665_100105646 3300005548 Bacteria 2818
64 Ga0070665_100268890 3300005548 Bacteria 1706
65 Ga0068855_100001663 3300005563 Bacteria 27798
66 Ga0068855_100132362 3300005563 Bacteria 2847
67 Ga0070664_100014244 3300005564 Bacteria 6486
68 Ga0070664_100235242 3300005564 Bacteria 1643
69 Ga0070664_100346460 3300005564 Bacteria 1350
70 Ga0068857_100057302 3300005577 Bacteria 3458
71 Ga0068857_100090248 3300005577 Bacteria 2742
72 Ga0068854_100004322 3300005578 Bacteria 8956
73 Ga0068859_100117380 3300005617 Bacteria 2726
74 Ga0068859_100118308 3300005617 Bacteria 2715
75 Ga0068859_100347374 3300005617 Bacteria 1578
76 Ga0068864_100008286 3300005618 Bacteria 8572
77 Ga0068864_100121067 3300005618 Bacteria 2340
78 Ga0068864_100496772 3300005618 Bacteria 1173
79 Ga0068861_100447829 3300005719 Bacteria 1156
80 Ga0068851_10022626 3300005834 Bacteria 3065
81 Ga0068863_100000052 3300005841 Bacteria 125430
82 Ga0068863_100017086 3300005841 Bacteria 6959
83 Ga0068863_100044582 3300005841 Bacteria 4209
84 Ga0068863_100066477 3300005841 Bacteria 3410
85 Ga0068858_100018105 3300005842 Bacteria 6599
86 Ga0068858_100036742 3300005842 Bacteria 4542
87 Ga0068860_100000007 3300005843 Bacteria 429329
88 Ga0068860_100014905 3300005843 Bacteria 7601
89 Ga0068860_100074620 3300005843 Bacteria 3225
90 Ga0068862_100000044 3300005844 Bacteria 156665
91 Ga0068862_100002994 3300005844 Bacteria 14736
92 Ga0068862_100010903 3300005844 Bacteria 7505
93 Ga0075364_10082601 3300006051 Bacteria 2126
94 Ga0097621_100287057 3300006237 Bacteria 1450
95 Ga0097621_100304650 3300006237 Bacteria 1408
96 Ga0068871_100003329 3300006358 Bacteria 11033
97 Ga0068871_100130200 3300006358 Bacteria 2133
98 Ga0075428_100049574 3300006844 Bacteria 4607
99 Ga0075430_100060025 3300006846 Bacteria 3196
100 Ga0075430_100157776 3300006846 Bacteria 1888
101 Ga0075431_100024843 3300006847 Bacteria 6143
102 Ga0075431_100191244 3300006847 Bacteria 2097
103 Ga0075429_100115941 3300006880 Bacteria 2342
104 Ga0097620_100117378 3300006931 Bacteria 2726
105 Ga0097620_100118312 3300006931 Bacteria 2715
106 Ga0097620_100347391 3300006931 Bacteria 1578
107 Ga0099824_1033126 3300006942 Bacteria 1778
108 Ga0105240_10016756 3300009093 Bacteria 9911
109 Ga0105240_10491566 3300009093 Bacteria 1366
110 Ga0105240_10507723 3300009093 Bacteria 1340
111 Ga0111539_10339305 3300009094 Bacteria 1749
112 Ga0105247_10001669 3300009101 Bacteria 15666
113 Ga0105247_10051820 3300009101 Bacteria 2529
114 Ga0105241_10021458 3300009174 Bacteria 4773
115 Ga0105248_10004219 3300009177 Bacteria 15903
116 Ga0105248_10016734 3300009177 Bacteria 8074
117 Ga0105238_10034683 3300009551 Bacteria 5133
118 Ga0157373_10017878 3300013100 Bacteria 5162
119 Ga0157373_10248107 3300013100 Unclassified 1259
120 Ga0157371_10009242 3300013102 Bacteria 7776
121 Ga0157371_10064415 3300013102 Bacteria 2597
122 Ga0157370_10000485 3300013104 Bacteria 49509
123 Ga0157370_10018146 3300013104 Bacteria 7082
124 Ga0157370_10033666 3300013104 Bacteria 4995
125 Ga0157370_10181928 3300013104 Bacteria 1953
126 Ga0157369_10035030 3300013105 Bacteria 5505
127 Ga0157374_10018326 3300013296 Bacteria 6177
128 Ga0157374_10037855 3300013296 Bacteria 4431
129 Ga0157374_10825486 3300013296 Bacteria 943
130 Ga0157378_10104517 3300013297 Bacteria 2589
131 Ga0163162_10000666 3300013306 Bacteria 31835
132 Ga0163162_10066203 3300013306 Bacteria 3661
133 Ga0163162_10313174 3300013306 Bacteria 1702
134 Ga0157372_10048158 3300013307 Bacteria 4738
135 Ga0157372_10219157 3300013307 Bacteria 2206
136 Ga0157375_10001766 3300013308 Bacteria 18557
137 Ga0157375_10012839 3300013308 Bacteria 7439
138 Ga0157375_10028865 3300013308 Bacteria 5208
139 Ga0163163_10008066 3300014325 Bacteria 9331
140 Ga0163163_10161175 3300014325 Bacteria 2288
141 Ga0157380_10013362 3300014326 Bacteria 5984
142 Ga0157380_10041225 3300014326 Bacteria 3602
143 Ga0157379_10018977 3300014968 Bacteria 6071
144 Ga0157376_10085550 3300014969 Bacteria 2717
145 Ga0157376_10501640 3300014969 Bacteria 1193
146 Ga0163161_10007796 3300017792 Bacteria 7406
147 Ga0163161_10027038 3300017792 Bacteria 4068
148 Ga0163161_10221415 3300017792 Bacteria 1465
149 Ga0207697_10043255 3300025315 Bacteria 1852
150 Ga0207697_10082260 3300025315 Bacteria 1357
151 Ga0207710_10006097 3300025900 Bacteria 5164
152 Ga0207688_10004820 3300025901 Bacteria 7351
153 Ga0207680_10038293 3300025903 Bacteria 2775
154 Ga0207680_10101840 3300025903 Bacteria 1847
155 Ga0207645_10008754 3300025907 Bacteria 7044
156 Ga0207643_10001969 3300025908 Bacteria 11336
157 Ga0207705_10000344 3300025909 Bacteria 41940
158 Ga0207705_10012677 3300025909 Bacteria 6084
159 Ga0207707_10045901 3300025912 Bacteria 3805
160 Ga0207695_10048140 3300025913 Bacteria 4505
161 Ga0207695_10375617 3300025913 Bacteria 1307
162 Ga0207660_10017143 3300025917 Bacteria 4807
163 Ga0207657_10001327 3300025919 Bacteria 26265
164 Ga0207657_10462683 3300025919 Bacteria 995
165 Ga0207649_10046706 3300025920 Bacteria 2662
166 Ga0207652_10005664 3300025921 Bacteria 10134
167 Ga0207652_10038392 3300025921 Bacteria 4059
168 Ga0207681_10003185 3300025923 Bacteria 10298
169 Ga0207681_10118101 3300025923 Bacteria 1941
170 Ga0207681_10481264 3300025923 Bacteria 1014
171 Ga0207694_10028497 3300025924 Bacteria 4258
172 Ga0207650_10015113 3300025925 Bacteria 5371
173 Ga0207650_10032799 3300025925 Bacteria 3758
174 Ga0207650_10169156 3300025925 Bacteria 1736
175 Ga0207650_10181955 3300025925 Bacteria 1675
176 Ga0207659_10001238 3300025926 Bacteria 15297
177 Ga0207659_10005842 3300025926 Bacteria 7501
178 Ga0207664_10051031 3300025929 Bacteria 3265
179 Ga0207664_10428625 3300025929 Bacteria 1179
180 Ga0207644_10170770 3300025931 Bacteria 1697
181 Ga0207706_10016727 3300025933 Bacteria 6620
182 Ga0207706_10052563 3300025933 Bacteria 3597
183 Ga0207670_10338150 3300025936 Bacteria 1189
184 Ga0207704_10295964 3300025938 Bacteria 1237
185 Ga0207691_10008110 3300025940 Bacteria 10083
186 Ga0207691_10098248 3300025940 Bacteria 2616
187 Ga0207691_10314789 3300025940 Bacteria 1343
188 Ga0207711_10229189 3300025941 Bacteria 1701
189 Ga0207711_10559565 3300025941 Bacteria 1067
190 Ga0207661_10105160 3300025944 Bacteria 2378
191 Ga0207679_10088637 3300025945 Bacteria 2386
192 Ga0207679_10090647 3300025945 Bacteria 2364
193 Ga0207679_10584541 3300025945 Bacteria 1005
194 Ga0207667_10012152 3300025949 Bacteria 9944
195 Ga0207667_10028397 3300025949 Bacteria 6077
196 Ga0207667_10050347 3300025949 Bacteria 4396
197 Ga0207667_10234691 3300025949 Bacteria 1878
198 Ga0207651_10246895 3300025960 Bacteria 1458
199 Ga0207668_10030691 3300025972 Bacteria 3534
200 Ga0207668_10085091 3300025972 Bacteria 2306
201 Ga0207640_10122319 3300025981 Bacteria 1867
202 Ga0207640_10303711 3300025981 Bacteria 1263
203 Ga0207658_10037577 3300025986 Bacteria 3480
204 Ga0207658_10241224 3300025986 Bacteria 1531
205 Ga0207658_10278173 3300025986 Bacteria 1434
206 Ga0207677_10011986 3300026023 Bacteria 4966
207 Ga0207677_10082255 3300026023 Bacteria 2313
208 Ga0207677_10176599 3300026023 Bacteria 1676
209 Ga0207703_10008168 3300026035 Bacteria 8270
210 Ga0207703_10026112 3300026035 Bacteria 4596
211 Ga0207703_10160534 3300026035 Bacteria 1968
212 Ga0207678_10005701 3300026067 Bacteria 11118
213 Ga0207678_10541005 3300026067 Bacteria 1018
214 Ga0207708_10012904 3300026075 Bacteria 6230
215 Ga0207708_10015090 3300026075 Bacteria 5790
216 Ga0207641_10000042 3300026088 Bacteria 186384
217 Ga0207641_10028394 3300026088 Bacteria 4623
218 Ga0207641_10092017 3300026088 Bacteria 2655
219 Ga0207641_10873871 3300026088 Bacteria 892
220 Ga0207676_10016074 3300026095 Bacteria 5412
221 Ga0207676_10086435 3300026095 Bacteria 2562
222 Ga0207676_10106445 3300026095 Bacteria 2337
223 Ga0207676_10145931 3300026095 Bacteria 2032
224 Ga0207676_10881720 3300026095 Bacteria 877
225 Ga0207674_10014731 3300026116 Bacteria 8625
226 Ga0207674_10072579 3300026116 Bacteria 3458
227 Ga0207675_100057789 3300026118 Bacteria 3620
228 Ga0207683_10101350 3300026121 Bacteria 2571
229 Ga0209389_1037721 3300027296 Bacteria 3832
230 Ga0209589_1026897 3300027357 Bacteria 3832
231 Ga0209489_116083 3300027361 Bacteria 4187
232 Ga0268266_10066337 3300028379 Bacteria 3121
233 Ga0268265_10000045 3300028380 Bacteria 180378
234 Ga0268265_10010965 3300028380 Bacteria 6121
235 Ga0268265_10016748 3300028380 Bacteria 5044
236 Ga0268264_10000134 3300028381 Bacteria 179475
237 Ga0268264_10141783 3300028381 Bacteria 2144
238 Ga0307517_10000100 3300028786 Bacteria 125762
239 Ga0307515_10036862 3300028794 Bacteria 7891
240 Ga0265338_10004520 3300028800 Bacteria 18747
241 Ga0265338_10005105 3300028800 Bacteria 17317
242 Ga0265325_10004858 3300031241 Bacteria 8401
243 Ga0265339_10000109 3300031249 Bacteria 66969
244 Ga0265331_10010587 3300031250 Bacteria 5094
245 Ga0265327_10001372 3300031251 Bacteria 31317
246 Ga0265327_10005773 3300031251 Bacteria 10188
247 Ga0265327_10008967 3300031251 Bacteria 7329
248 Ga0265316_10005311 3300031344 Bacteria 12560
249 Ga0307513_10018925 3300031456 Bacteria 8211
250 Ga0265313_10000257 3300031595 Bacteria 57767
251 Ga0265314_10010534 3300031711 Bacteria 7698
252 Ga0307516_10001704 3300031730 Bacteria 30197
253 Ga0307406_10604887 3300031901 Bacteria 904
254 Ga0307414_10112891 3300032004 Bacteria 2073
255 Ga0373962_0122256 3300035242 Bacteria 831
256 Ga0373947_0072131 3300035725 Bacteria 2120
257 Ga0395899_0005956 3300037312 Bacteria 9472
258 Ga0395900_0005859 3300037418 Bacteria 12830
259 Ga0395900_0087057 3300037418 Bacteria 3211
260 Ga0395898_0026437 3300037466 Bacteria 5839
261 Ga0395898_0071617 3300037466 Bacteria 3349
262 Ga0395905_0035369 3300037471 Bacteria 4691
263 Ga0395901_0244043 3300038443 Bacteria 1872
264 Ga0395901_0957745 3300038443 Bacteria 834
265 Ga0400483_069536 3300039062 Bacteria 1922
266 Ga0436360_0427199 3300039438 Bacteria 2167
267 Ga0436360_0825406 3300039438 Bacteria 1120
268 Ga0436360_1358646 3300039438 Bacteria 1178
269 Ga0436361_0829212 3300039447 Bacteria 4507
270 Ga0436361_1024539 3300039447 Bacteria 1609
271 Ga0436361_1138435 3300039447 Bacteria 1538
272 Ga0451577_0070502 3300042876 Bacteria 3117
273 Ga0466972_0114230 3300044658 Bacteria 1275
274 Ga0453684_0227636 3300044712 Bacteria 2155
275 Ga0451576_0081037 3300045051 Archaea 3376
276 Ga0495650_0001897 3300046471 Bacteria 18549
277 Ga0495582_0065771 3300046473 Bacteria 2003
278 Ga0495606_0000553 3300046507 Bacteria 59889
279 Ga0495658_0001724 3300046683 Bacteria 11335
280 Ga0495671_0162791 3300046692 Bacteria 1085
281 Ga0495581_0097380 3300047315 Bacteria 1708
282 Ga0495604_0332075 3300047317 Bacteria 1014
283 Ga0495604_0548340 3300047317 Bacteria 746
284 Ga0496106_0221000 3300048909 Bacteria 1511
285 Ga0496116_0064111 3300048919 Bacteria 2363
286 Ga0496118_0025367 3300048921 Bacteria 5087
287 Ga0496121_0000992 3300048924 Bacteria 50765
288 Ga0496121_0101191 3300048924 Bacteria 2223
289 Ga0496122_0049324 3300048925 Bacteria 3226
290 Ga0496125_0000341 3300048928 Bacteria 89076
291 Ga0496126_0030227 3300048929 Bacteria 5134
292 Ga0496126_0046304 3300048929 Bacteria 3991
293 Ga0496126_0205446 3300048929 Bacteria 1661
294 Ga0501034_0213522 3300049571 Bacteria 1884
295 Ga0501039_0615112 3300049575 Bacteria 851
296 Ga0501041_0220146 3300049577 Bacteria 1191
297 Ga0501071_0566638 3300049587 Bacteria 873
298 Ga0501035_0000923 3300049822 Bacteria 31113
299 Ga0501044_0029347 3300049823 Bacteria 5800
300 Ga0501045_0286078 3300049824 Bacteria 1227
301 nmdc:mga09592_208153_c1 3300050508 Bacteria 1694
302 nmdc:mga06r32_10375_c1 3300050510 Bacteria 8404
303 nmdc:mga06r32_711968_c1 3300050510 Bacteria 969
304 nmdc:mga08y16_57501_c1 3300050511 Bacteria 4064
305 nmdc:mga0a205_650807_c1 3300050515 Bacteria 905
306 Ga0500566_0068273 3300053094 Bacteria 1999
307 Ga0500595_001318 3300053119 Bacteria 13452
308 Ga0500595_002291 3300053119 Bacteria 9607
309 Ga0500652_001105 3300053131 Bacteria 8693
310 Ga0500559_0052086 3300053136 Bacteria 1809
311 Ga0500568_0006551 3300053139 Bacteria 5829
312 Ga0500616_0000031 3300053153 Bacteria 415013
313 Ga0500638_078718 3300053162 Bacteria 1567
314 Ga0501084_0366748 3300054114 Bacteria 1217
315 2507506959 2507262055 Bacteria 8048963
316 2508697727 2508501042 Bacteria 8719808
317 2514013531 2513237161 Bacteria 8871253
318 2874592800 2874590934 Bacteria 8299676
319 2874652396 2874645413 Bacteria 8214782
320 2876773012 2876771140 Bacteria 8287509
321 2876820339 2876818435 Bacteria 8274608
322 2879076470 2879074833 Bacteria 8279565
323 2935674623 2935665750 Bacteria 9571747
324 2935914552 2935908558 Bacteria 8568796
325 2935932068 2935926038 Bacteria 8601059
326 2935940665 2935934488 Bacteria 8602579
327 2935948748 2935942939 Bacteria 8599779
328 2935957145 2935951376 Bacteria 8602333
329 2935973883 2935967501 Bacteria 8603075
330 2935983250 2935975950 Bacteria 8347125
331 2936063189 2936055302 Bacteria 8785755
332 8019626162 8019619141 Bacteria 9218857
333 8019671312 8019668869 Bacteria 8791617
334 8019684876 8019678201 Bacteria 8863603
335 8055305089 8055301274 Bacteria 8587385
336 Ga0436360_0980249
337 Ga0065707_10084428
338 Ga0070658_10000596
339 Ga0070658_10010713
340 Ga0070676_10006578
341 Ga0070683_100018434
342 Ga0070683_100036089
343 Ga0070690_100067680
344 Ga0070690_100498697
345 Ga0070670_100067805
346 Ga0070670_100069814
347 Ga0070670_100198584
348 Ga0070670_100343425
349 Ga0070677_10071676
350 Ga0070666_10036602
351 Ga0070680_100038229
352 Ga0070682_100133138
353 Ga0068868_100066594
354 Ga0068868_100257887
355 Ga0070660_100003070
356 Ga0070660_100129403
357 Ga0070660_100584344
358 Ga0070689_100324636
359 Ga0070689_100338272
360 Ga0070691_10185788
361 Ga0070661_100102430
362 Ga0070668_100035103
363 Ga0070669_100000488
364 Ga0070669_100006723
365 Ga0070669_100029994
366 Ga0070669_100120140
367 Ga0070675_100000252
368 Ga0070675_100010180
369 Ga0070675_100031164
370 Ga0070674_100369163
371 Ga0070673_100023093
372 Ga0070673_100123204
373 Ga0070673_100282062
374 Ga0070659_100008373
375 Ga0070659_100008464
376 Ga0070667_100002604
377 Ga0070667_100216932
378 Ga0070667_100287192
379 Ga0070667_100337407
380 Ga0070714_100051913
381 Ga0070714_100374689
382 Ga0070714_100483374
383 Ga0070700_100009336
384 Ga0070663_100016896
385 Ga0070663_100502733
386 Ga0070662_100010169
387 Ga0070662_100014218
388 Ga0070681_10149212
389 Ga0068867_100003514
390 Ga0070685_10255864
391 Ga0070679_100011713
392 Ga0070679_100073625
393 Ga0070684_100019423
394 Ga0068853_100269303
395 Ga0070672_100001069
396 Ga0070672_100008613
397 Ga0070672_100134124
398 Ga0070665_100105646
399 Ga0070665_100268890
400 Ga0068855_100001663
401 Ga0068855_100132362
402 Ga0070664_100014244
403 Ga0070664_100235242
404 Ga0070664_100346460
405 Ga0068857_100057302
406 Ga0068857_100090248
407 Ga0068854_100004322
408 Ga0068859_100117380
409 Ga0068859_100118308
410 Ga0068859_100347374
411 Ga0068864_100008286
412 Ga0068864_100121067
413 Ga0068864_100496772
414 Ga0068861_100447829
415 Ga0068851_10022626
416 Ga0068863_100000052
417 Ga0068863_100017086
418 Ga0068863_100044582
419 Ga0068863_100066477
420 Ga0068858_100018105
421 Ga0068858_100036742
422 Ga0068860_100000007
423 Ga0068860_100014905
424 Ga0068860_100074620
425 Ga0068862_100000044
426 Ga0068862_100002994
427 Ga0068862_100010903
428 Ga0075364_10082601
429 Ga0097621_100287057
430 Ga0097621_100304650
431 Ga0068871_100003329
432 Ga0068871_100130200
433 Ga0075428_100049574
434 Ga0075430_100060025
435 Ga0075430_100157776
436 Ga0075431_100024843
437 Ga0075431_100191244
438 Ga0075429_100115941
439 Ga0097620_100117378
440 Ga0097620_100118312
441 Ga0097620_100347391
442 Ga0099824_1033126
443 Ga0105240_10016756
444 Ga0105240_10491566
445 Ga0105240_10507723
446 Ga0111539_10339305
447 Ga0105247_10001669
448 Ga0105247_10051820
449 Ga0105241_10021458
450 Ga0105248_10004219
451 Ga0105248_10016734
452 Ga0105238_10034683
453 Ga0157373_10017878
454 Ga0157373_10248107
455 Ga0157371_10009242
456 Ga0157371_10064415
457 Ga0157370_10000485
458 Ga0157370_10018146
459 Ga0157370_10033666
460 Ga0157370_10181928
461 Ga0157369_10035030
462 Ga0157374_10018326
463 Ga0157374_10037855
464 Ga0157374_10825486
465 Ga0157378_10104517
466 Ga0163162_10000666
467 Ga0163162_10066203
468 Ga0163162_10313174
469 Ga0157372_10048158
470 Ga0157372_10219157
471 Ga0157375_10001766
472 Ga0157375_10012839
473 Ga0157375_10028865
474 Ga0163163_10008066
475 Ga0163163_10161175
476 Ga0157380_10013362
477 Ga0157380_10041225
478 Ga0157379_10018977
479 Ga0157376_10085550
480 Ga0157376_10501640
481 Ga0163161_10007796
482 Ga0163161_10027038
483 Ga0163161_10221415
484 Ga0207697_10043255
485 Ga0207697_10082260
486 Ga0207710_10006097
487 Ga0207688_10004820
488 Ga0207680_10038293
489 Ga0207680_10101840
490 Ga0207645_10008754
491 Ga0207643_10001969
492 Ga0207705_10000344
493 Ga0207705_10012677
494 Ga0207707_10045901
495 Ga0207695_10048140
496 Ga0207695_10375617
497 Ga0207660_10017143
498 Ga0207657_10001327
499 Ga0207657_10462683
500 Ga0207649_10046706
501 Ga0207652_10005664
502 Ga0207652_10038392
503 Ga0207681_10003185
504 Ga0207681_10118101
505 Ga0207681_10481264
506 Ga0207694_10028497
507 Ga0207650_10015113
508 Ga0207650_10032799
509 Ga0207650_10169156
510 Ga0207650_10181955
511 Ga0207659_10001238
512 Ga0207659_10005842
513 Ga0207664_10051031
514 Ga0207664_10428625
515 Ga0207644_10170770
516 Ga0207706_10016727
517 Ga0207706_10052563
518 Ga0207670_10338150
519 Ga0207704_10295964
520 Ga0207691_10008110
521 Ga0207691_10098248
522 Ga0207691_10314789
523 Ga0207711_10229189
524 Ga0207711_10559565
525 Ga0207661_10105160
526 Ga0207679_10088637
527 Ga0207679_10090647
528 Ga0207679_10584541
529 Ga0207667_10012152
530 Ga0207667_10028397
531 Ga0207667_10050347
532 Ga0207667_10234691
533 Ga0207651_10246895
534 Ga0207668_10030691
535 Ga0207668_10085091
536 Ga0207640_10122319
537 Ga0207640_10303711
538 Ga0207658_10037577
539 Ga0207658_10241224
540 Ga0207658_10278173
541 Ga0207677_10011986
542 Ga0207677_10082255
543 Ga0207677_10176599
544 Ga0207703_10008168
545 Ga0207703_10026112
546 Ga0207703_10160534
547 Ga0207678_10005701
548 Ga0207678_10541005
549 Ga0207708_10012904
550 Ga0207708_10015090
551 Ga0207641_10000042
552 Ga0207641_10028394
553 Ga0207641_10092017
554 Ga0207641_10873871
555 Ga0207676_10016074
556 Ga0207676_10086435
557 Ga0207676_10106445
558 Ga0207676_10145931
559 Ga0207676_10881720
560 Ga0207674_10014731
561 Ga0207674_10072579
562 Ga0207675_100057789
563 Ga0207683_10101350
564 Ga0209389_1037721
565 Ga0209589_1026897
566 Ga0209489_116083
567 Ga0268266_10066337
568 Ga0268265_10000045
569 Ga0268265_10010965
570 Ga0268265_10016748
571 Ga0268264_10000134
572 Ga0268264_10141783
573 Ga0307517_10000100
574 Ga0307515_10036862
575 Ga0265338_10004520
576 Ga0265338_10005105
577 Ga0265325_10004858
578 Ga0265339_10000109
579 Ga0265331_10010587
580 Ga0265327_10001372
581 Ga0265327_10005773
582 Ga0265327_10008967
583 Ga0265316_10005311
584 Ga0307513_10018925
585 Ga0265313_10000257
586 Ga0265314_10010534
587 Ga0307516_10001704
588 Ga0307406_10604887
589 Ga0307414_10112891
590 Ga0373962_0122256
591 Ga0373947_0072131
592 Ga0395899_0005956
593 Ga0395900_0005859
594 Ga0395900_0087057
595 Ga0395898_0026437
596 Ga0395898_0071617
597 Ga0395905_0035369
598 Ga0395901_0244043
599 Ga0395901_0957745
600 Ga0400483_069536
601 Ga0436360_0427199
602 Ga0436360_0825406
603 Ga0436360_1358646
604 Ga0436361_0829212
605 Ga0436361_1024539
606 Ga0436361_1138435
607 Ga0451577_0070502
608 Ga0466972_0114230
609 Ga0453684_0227636
610 Ga0451576_0081037
611 Ga0495650_0001897
612 Ga0495582_0065771
613 Ga0495606_0000553
614 Ga0495658_0001724
615 Ga0495671_0162791
616 Ga0495581_0097380
617 Ga0495604_0332075
618 Ga0495604_0548340
619 Ga0496106_0221000
620 Ga0496116_0064111
621 Ga0496118_0025367
622 Ga0496121_0000992
623 Ga0496121_0101191
624 Ga0496122_0049324
625 Ga0496125_0000341
626 Ga0496126_0030227
627 Ga0496126_0046304
628 Ga0496126_0205446
629 Ga0501034_0213522
630 Ga0501039_0615112
631 Ga0501041_0220146
632 Ga0501071_0566638
633 Ga0501035_0000923
634 Ga0501044_0029347
635 Ga0501045_0286078
636 nmdc:mga09592_208153_c1
637 nmdc:mga06r32_10375_c1
638 nmdc:mga06r32_711968_c1
639 nmdc:mga08y16_57501_c1
640 nmdc:mga0a205_650807_c1
641 Ga0500566_0068273
642 Ga0500595_001318
643 Ga0500595_002291
644 Ga0500652_001105
645 Ga0500559_0052086
646 Ga0500568_0006551
647 Ga0500616_0000031
648 Ga0500638_078718
649 Ga0501084_0366748
650 2507506959
651 2508697727
652 2514013531
653 2874592800
654 2874652396
655 2876773012
656 2876820339
657 2879076470
658 2935674623
659 2935914552
660 2935932068
661 2935940665
662 2935948748
663 2935957145
664 2935973883
665 2935983250
666 2936063189
667 8019626162
668 8019671312
669 8019684876
670 8055305089

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

8

134

0.9

PF00483

NTP_transferase

Nucleotidyl transferase

7

236

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.9025 2 239
1wvc-assembly1.cif.gz_A alpha-d-glucose-1-phosphate cytidylyltransferase complexed with ctp 0.8952 2 239
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.872 2 239
1tzf-assembly1.cif.gz_A x-ray crystal structure of alpha-d-glucose-1-phosphate cytidylyltransferase from salmonella typhi 0.8649 2 239
4y7t-assembly1.cif.gz_A structural analysis of muru 0.8301 1 232
ID Description Score Start End Superfamily
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.872 2 239 3.90.550.10
1tzfA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8649 2 239 3.90.550.10
af_A0A144A0U7_10_199_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8262 3 128 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8213 1 230 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.815 2 232 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A3D4BA33-F1-model_v4 Nucleotidyltransferase 0.9356 1 127 GO:0005525
GO:0009058
GO:0016740
AF-A0A800LWG3-F1-model_v4 Nucleotidyltransferase family protein 0.9341 1 127 GO:0005525
GO:0009058
GO:0016740
AF-A0A090AK42-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9333 1 239 GO:0009243
GO:0016020
GO:0047343
AF-A0A090AK42-F1-model_v4 Glucose-1-phosphate cytidylyltransferase 0.9295 1 239 GO:0009243
GO:0016020
GO:0047343
AF-A0A0K0WL66-F1-model_v4 deleted 0.9293 2 239

Map