F411277

General Info

Members Datasets Scaffolds Average Seq Length
333 212 666 222

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100322459|Ga0070684_1003224592
Length 233
Sequence MRFFGQDRTALVEPSEALPGRSEELPVPARHEVLGTPLKGPFPAGVQSAIFGMGCFWGAERLFWEAPGVYTTAVGYAGGITPNPTYEEACSGRTGHAEVVLVAFDSAKTSYEEMLRLFWEGHDPTQGMRQGNDVGSQYRSLIMWSDEAQRAAAEASLKTYQAMLTAAGHGTITTELLQGAPERPFYYAEDYHQQYLAKNPGGYCPAHGTGIACPIGLNVSASTDAQRSVSSSQ

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
136 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
206 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
207 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
208 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
209 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
210 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
211 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
212 3002141150 Phyllobacterium sp. 628 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 2.4
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 4.5
Rhizosphere 90.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100322459 3300005535 Bacteria 1419
2 JGI24752J21851_1009501 3300001976 Bacteria 1269
3 JGI25407J50210_10006070 3300003373 Bacteria 2994
4 Ga0058863_10025369 3300004799 Bacteria 1026
5 Ga0070658_10136842 3300005327 Bacteria 2044
6 Ga0070676_10182673 3300005328 Bacteria 1365
7 Ga0068869_100031589 3300005334 Bacteria 3724
8 Ga0070666_10401142 3300005335 Bacteria 986
9 Ga0070680_100117330 3300005336 Bacteria 2219
10 Ga0070682_100005994 3300005337 Bacteria 6802
11 Ga0068868_100017061 3300005338 Bacteria 5403
12 Ga0070691_10000784 3300005341 Bacteria 12621
13 Ga0070687_100054700 3300005343 Bacteria 2081
14 Ga0070692_10005885 3300005345 Bacteria 5276
15 Ga0070675_100110446 3300005354 Bacteria 2325
16 Ga0070671_100006587 3300005355 Bacteria 9283
17 Ga0070671_100014925 3300005355 Bacteria 6275
18 Ga0070673_100288830 3300005364 Bacteria 1441
19 Ga0070659_100093097 3300005366 Bacteria 2418
20 Ga0070659_100101470 3300005366 Bacteria 2316
21 Ga0070667_100017246 3300005367 Bacteria 5982
22 Ga0070714_100311893 3300005435 Bacteria 1469
23 Ga0070711_100003728 3300005439 Bacteria 8932
24 Ga0070711_100172449 3300005439 Bacteria 1650
25 Ga0070705_100142621 3300005440 Bacteria 1578
26 Ga0070678_100001810 3300005456 Bacteria 11521
27 Ga0070662_100128759 3300005457 Bacteria 1949
28 Ga0070672_100058326 3300005543 Bacteria 3033
29 Ga0070665_100059978 3300005548 Bacteria 3814
30 Ga0068855_100092559 3300005563 Bacteria 3486
31 Ga0070664_100514781 3300005564 Bacteria 1104
32 Ga0068854_100042605 3300005578 Bacteria 3213
33 Ga0068856_100091257 3300005614 Bacteria 3030
34 Ga0068856_100116683 3300005614 Bacteria 2670
35 Ga0068859_100152707 3300005617 Bacteria 2385
36 Ga0068864_100068638 3300005618 Bacteria 3080
37 Ga0068851_10027786 3300005834 Bacteria 2790
38 Ga0068870_10003946 3300005840 Bacteria 6334
39 Ga0068863_100006835 3300005841 Bacteria 11183
40 Ga0068858_100028807 3300005842 Bacteria 5156
41 Ga0068860_100064545 3300005843 Bacteria 3478
42 Ga0068862_100421248 3300005844 Bacteria 1253
43 Ga0075364_10001557 3300006051 Bacteria 12541
44 Ga0068871_100054332 3300006358 Bacteria 3249
45 Ga0075428_100801949 3300006844 Bacteria 1001
46 Ga0075430_100189444 3300006846 Bacteria 1710
47 Ga0075433_10034457 3300006852 Bacteria 4348
48 Ga0075434_100048231 3300006871 Bacteria 4226
49 Ga0075434_100977042 3300006871 Bacteria 861
50 Ga0075429_100886637 3300006880 Bacteria 781
51 Ga0097620_100152705 3300006931 Bacteria 2385
52 Ga0075435_100001805 3300007076 Bacteria 13929
53 Ga0105251_10098115 3300009011 Bacteria 1341
54 Ga0111539_10424569 3300009094 Bacteria 1548
55 Ga0111539_10824735 3300009094 Bacteria 1079
56 Ga0105247_10016014 3300009101 Bacteria 4492
57 Ga0114129_10053052 3300009147 Bacteria 5687
58 Ga0114129_10084302 3300009147 Bacteria 4413
59 Ga0114129_10283447 3300009147 Bacteria 2213
60 Ga0105243_11119295 3300009148 Bacteria 797
61 Ga0105241_10001558 3300009174 Bacteria 17557
62 Ga0105242_10843077 3300009176 Bacteria 911
63 Ga0105248_11080327 3300009177 Bacteria 907
64 Ga0105237_10097049 3300009545 Bacteria 2937
65 Ga0105238_10121100 3300009551 Bacteria 2596
66 Ga0105239_10144820 3300010375 Bacteria 2649
67 Ga0157373_10071451 3300013100 Bacteria 2451
68 Ga0157371_10009610 3300013102 Bacteria 7602
69 Ga0157374_10039136 3300013296 Bacteria 4363
70 Ga0157378_10964707 3300013297 Bacteria 886
71 Ga0157375_10456841 3300013308 Bacteria 1443
72 Ga0157375_11449180 3300013308 Bacteria 810
73 Ga0163163_10581980 3300014325 Bacteria 1182
74 Ga0157380_10074890 3300014326 Bacteria 2750
75 Ga0157380_11634751 3300014326 Bacteria 700
76 Ga0157377_10002387 3300014745 Bacteria 8281
77 Ga0157379_10619656 3300014968 Bacteria 1011
78 Ga0163161_10500754 3300017792 Bacteria 989
79 Ga0197907_10476114 3300020069 Bacteria 1743
80 Ga0206356_10287356 3300020070 Bacteria 1478
81 Ga0206356_10290718 3300020070 Bacteria 2031
82 Ga0206349_1811945 3300020075 Bacteria 2173
83 Ga0206353_11133714 3300020082 Bacteria 1295
84 Ga0224712_10005583 3300022467 Bacteria 3519
85 Ga0224712_10010126 3300022467 Bacteria 2870
86 Ga0207710_10034617 3300025900 Bacteria 2221
87 Ga0207688_10018663 3300025901 Bacteria 3772
88 Ga0207647_10102698 3300025904 Bacteria 1695
89 Ga0207645_10093188 3300025907 Bacteria 1938
90 Ga0207643_10000509 3300025908 Bacteria 24852
91 Ga0207705_10026085 3300025909 Bacteria 4170
92 Ga0207654_10020065 3300025911 Bacteria 3537
93 Ga0207707_10080835 3300025912 Bacteria 2838
94 Ga0207707_10155439 3300025912 Bacteria 2000
95 Ga0207663_10005299 3300025916 Bacteria 6491
96 Ga0207657_10218694 3300025919 Bacteria 1527
97 Ga0207649_10120745 3300025920 Bacteria 1766
98 Ga0207652_10003277 3300025921 Bacteria 13414
99 Ga0207652_10020183 3300025921 Bacteria 5486
100 Ga0207694_10095149 3300025924 Bacteria 2354
101 Ga0207650_10036944 3300025925 Bacteria 3556
102 Ga0207659_10027957 3300025926 Bacteria 3826
103 Ga0207644_10044035 3300025931 Bacteria 3169
104 Ga0207644_10122534 3300025931 Bacteria 1981
105 Ga0207690_10039880 3300025932 Bacteria 3066
106 Ga0207690_10068880 3300025932 Bacteria 2433
107 Ga0207706_10077576 3300025933 Bacteria 2922
108 Ga0207669_10089442 3300025937 Bacteria 2000
109 Ga0207691_10029639 3300025940 Bacteria 5119
110 Ga0207711_10239054 3300025941 Bacteria 1665
111 Ga0207689_10003011 3300025942 Bacteria 15531
112 Ga0207679_10001724 3300025945 Bacteria 13613
113 Ga0207651_10222294 3300025960 Bacteria 1527
114 Ga0207640_10147964 3300025981 Bacteria 1722
115 Ga0207677_10033106 3300026023 Bacteria 3330
116 Ga0207703_10057662 3300026035 Bacteria 3167
117 Ga0207639_10258624 3300026041 Bacteria 1521
118 Ga0207678_10003455 3300026067 Bacteria 14239
119 Ga0207708_10067949 3300026075 Bacteria 2727
120 Ga0207702_10003496 3300026078 Bacteria 14316
121 Ga0207702_10180664 3300026078 Bacteria 1943
122 Ga0207641_10094075 3300026088 Bacteria 2627
123 Ga0207648_10069674 3300026089 Bacteria 3065
124 Ga0207676_10001025 3300026095 Bacteria 21364
125 Ga0207675_100114855 3300026118 Bacteria 2543
126 Ga0207683_10000792 3300026121 Bacteria 28821
127 Ga0207698_10001508 3300026142 Bacteria 13550
128 Ga0207698_10432195 3300026142 Bacteria 1266
129 Ga0207428_10043496 3300027907 Bacteria 3627
130 Ga0268266_10066887 3300028379 Bacteria 3109
131 Ga0265338_10029938 3300028800 Bacteria 5382
132 Ga0265338_10059260 3300028800 Bacteria 3373
133 Ga0265316_10401606 3300031344 Bacteria 987
134 Ga0316578_10034522 3300031728 Bacteria 2904
135 Ga0316578_10211416 3300031728 Bacteria 1167
136 Ga0316577_10000054 3300031733 Bacteria 26858
137 Ga0307413_10033189 3300031824 Bacteria 2936
138 Ga0307413_10039636 3300031824 Bacteria 2741
139 Ga0307410_10198750 3300031852 Bacteria 1529
140 Ga0307409_100429566 3300031995 Bacteria 1269
141 Ga0307416_100158391 3300032002 Bacteria 2088
142 Ga0307416_100466776 3300032002 Bacteria 1319
143 Ga0307414_10500067 3300032004 Bacteria 1075
144 Ga0307411_10232068 3300032005 Bacteria 1439
145 Ga0307411_10329985 3300032005 Bacteria 1236
146 Ga0316574_0175167 3300035398 Bacteria 1381
147 Ga0373935_0230346 3300035692 Bacteria 1290
148 Ga0316582_0001016 3300036647 Bacteria 11738
149 Ga0316582_0114918 3300036647 Bacteria 1795
150 Ga0316584_0029339 3300036712 Bacteria 4060
151 Ga0395900_0002443 3300037418 Bacteria 20475
152 Ga0395898_0087943 3300037466 Bacteria 2992
153 Ga0395905_0960621 3300037471 Bacteria 757
154 Ga0395901_0174374 3300038443 Bacteria 2255
155 Ga0395901_0508345 3300038443 Bacteria 1226
156 Ga0436360_0455145 3300039438 Bacteria 4145
157 Ga0436361_0370863 3300039447 Bacteria 1089
158 Ga0436362_0508410 3300039453 Bacteria 924
159 Ga0436362_0788899 3300039453 Bacteria 1307
160 Ga0436362_0846256 3300039453 Bacteria 3780
161 Ga0451853_0459934 3300041512 Bacteria 3786
162 Ga0439448_0019167 3300042005 Bacteria 2104
163 Ga0439459_0005032 3300042438 Bacteria 2154
164 Ga0439460_0168196 3300042461 Bacteria 737
165 Ga0466963_0369135 3300044694 Bacteria 1011
166 Ga0453684_0238062 3300044712 Bacteria 2097
167 Ga0453684_1463188 3300044712 Bacteria 706
168 Ga0466970_0176909 3300044765 Bacteria 1183
169 Ga0466959_0021206 3300045049 Bacteria 4791
170 Ga0466959_0041085 3300045049 Bacteria 3415
171 Ga0466958_0383802 3300045836 Bacteria 906
172 Ga0466967_0007672 3300045976 Bacteria 7812
173 Ga0466967_0063612 3300045976 Bacteria 3279
174 Ga0466967_0078896 3300045976 Bacteria 2967
175 Ga0466967_0393163 3300045976 Bacteria 1348
176 Ga0495653_0023882 3300046463 Bacteria 4934
177 Ga0495664_0000011 3300046477 Bacteria 253351
178 Ga0495618_0000142 3300046514 Bacteria 51147
179 Ga0495645_0000034 3300046543 Bacteria 102615
180 Ga0495645_0015823 3300046543 Bacteria 5371
181 Ga0495658_0043446 3300046683 Bacteria 2514
182 Ga0495676_0042918 3300047321 Bacteria 3707
183 Ga0496101_0013134 3300048904 Bacteria 5541
184 Ga0496102_0001115 3300048905 Bacteria 24631
185 Ga0496102_0020783 3300048905 Bacteria 5801
186 Ga0496103_0002109 3300048906 Bacteria 12673
187 Ga0496104_0128104 3300048907 Bacteria 2437
188 Ga0496105_0030859 3300048908 Bacteria 4393
189 Ga0496106_0095011 3300048909 Bacteria 2305
190 Ga0496107_0098085 3300048910 Bacteria 2146
191 Ga0496108_0014123 3300048911 Bacteria 6514
192 Ga0496109_0014268 3300048912 Bacteria 6913
193 Ga0496111_0002954 3300048914 Bacteria 10402
194 Ga0496112_0166421 3300048915 Bacteria 2170
195 Ga0496112_0920442 3300048915 Bacteria 796
196 Ga0496114_0203594 3300048917 Bacteria 1734
197 Ga0496115_0022187 3300048918 Bacteria 4915
198 Ga0496122_0081224 3300048925 Bacteria 2257
199 Ga0496123_0019304 3300048926 Bacteria 5380
200 Ga0496124_0085527 3300048927 Bacteria 2584
201 Ga0501031_0024835 3300049568 Bacteria 3908
202 Ga0501031_0100109 3300049568 Bacteria 1891
203 Ga0501031_0409341 3300049568 Bacteria 877
204 Ga0501034_1009703 3300049571 Bacteria 716
205 Ga0501038_0060756 3300049574 Bacteria 3234
206 Ga0501039_0037118 3300049575 Bacteria 3761
207 Ga0501039_0107320 3300049575 Bacteria 2181
208 Ga0501039_0195637 3300049575 Bacteria 1589
209 Ga0501039_0231126 3300049575 Bacteria 1454
210 Ga0501039_0337059 3300049575 Bacteria 1185
211 Ga0501039_0660357 3300049575 Bacteria 818
212 Ga0501040_0002837 3300049576 Bacteria 11185
213 Ga0501040_0010357 3300049576 Bacteria 6094
214 Ga0501040_0019471 3300049576 Bacteria 4514
215 Ga0501040_0021516 3300049576 Bacteria 4308
216 Ga0501040_0030152 3300049576 Bacteria 3663
217 Ga0501040_0031226 3300049576 Bacteria 3598
218 Ga0501041_0031803 3300049577 Bacteria 3190
219 Ga0501041_0043530 3300049577 Bacteria 2730
220 Ga0501041_0112366 3300049577 Bacteria 1690
221 Ga0501041_0427066 3300049577 Bacteria 840
222 Ga0501042_0015240 3300049578 Bacteria 5261
223 Ga0501042_0062560 3300049578 Bacteria 2659
224 Ga0501042_0153716 3300049578 Bacteria 1659
225 Ga0501042_0329733 3300049578 Bacteria 1103
226 Ga0501042_0340395 3300049578 Bacteria 1084
227 Ga0501042_0345594 3300049578 Bacteria 1076
228 Ga0501046_0153546 3300049580 Bacteria 1736
229 Ga0501046_0373947 3300049580 Bacteria 1032
230 Ga0501048_0058087 3300049582 Bacteria 2743
231 Ga0501048_0122422 3300049582 Bacteria 1838
232 Ga0501048_0155208 3300049582 Bacteria 1619
233 Ga0501048_0399437 3300049582 Bacteria 982
234 Ga0501048_0529102 3300049582 Bacteria 846
235 Ga0501067_0065496 3300049583 Bacteria 2011
236 Ga0501068_0101933 3300049584 Bacteria 1780
237 Ga0501068_0124583 3300049584 Bacteria 1608
238 Ga0501068_0216832 3300049584 Bacteria 1216
239 Ga0501069_0104181 3300049585 Bacteria 1612
240 Ga0501069_0111802 3300049585 Bacteria 1556
241 Ga0501069_0158069 3300049585 Bacteria 1305
242 Ga0501069_0317841 3300049585 Bacteria 914
243 Ga0501070_0140230 3300049586 Bacteria 1996
244 Ga0501070_0675786 3300049586 Bacteria 818
245 Ga0501071_0001782 3300049587 Bacteria 12700
246 Ga0501071_0013643 3300049587 Bacteria 5540
247 Ga0501071_0049975 3300049587 Bacteria 3011
248 Ga0501071_0116306 3300049587 Bacteria 1979
249 Ga0501072_0028372 3300049588 Bacteria 4370
250 Ga0501072_0111830 3300049588 Bacteria 2174
251 Ga0501072_0403965 3300049588 Bacteria 1083
252 Ga0501074_0003423 3300049590 Bacteria 11243
253 Ga0501074_0038810 3300049590 Bacteria 3450
254 Ga0501074_0176279 3300049590 Bacteria 1525
255 Ga0501074_0194547 3300049590 Bacteria 1445
256 Ga0501074_0252047 3300049590 Bacteria 1255
257 Ga0501075_0009870 3300049591 Bacteria 6690
258 Ga0501075_0024473 3300049591 Bacteria 4428
259 Ga0501075_0036019 3300049591 Bacteria 3692
260 Ga0501075_0160868 3300049591 Bacteria 1713
261 Ga0501075_0306589 3300049591 Bacteria 1210
262 Ga0501076_0003612 3300049592 Bacteria 10866
263 Ga0501076_0017677 3300049592 Bacteria 5420
264 Ga0501076_0056688 3300049592 Bacteria 3110
265 Ga0501076_0128741 3300049592 Bacteria 2052
266 Ga0501076_0296368 3300049592 Bacteria 1325
267 Ga0501076_0400412 3300049592 Bacteria 1129
268 Ga0501077_0030264 3300049593 Bacteria 3445
269 Ga0501077_0043307 3300049593 Bacteria 2861
270 Ga0501077_0147585 3300049593 Bacteria 1492
271 Ga0501077_0566470 3300049593 Bacteria 729
272 Ga0501079_0025392 3300049741 Bacteria 4545
273 Ga0501079_0041718 3300049741 Bacteria 3543
274 Ga0501079_0042996 3300049741 Bacteria 3488
275 Ga0501079_0226842 3300049741 Bacteria 1459
276 Ga0501079_0391835 3300049741 Bacteria 1089
277 Ga0501080_0236158 3300049742 Bacteria 1670
278 Ga0501080_0370607 3300049742 Bacteria 1291
279 Ga0501081_0013386 3300049743 Bacteria 5396
280 Ga0501081_0023122 3300049743 Bacteria 4165
281 Ga0501081_0059312 3300049743 Bacteria 2649
282 Ga0501083_0290322 3300049744 Bacteria 1064
283 Ga0501083_0377434 3300049744 Bacteria 922
284 Ga0501035_0286089 3300049822 Bacteria 1392
285 Ga0501035_0496209 3300049822 Bacteria 1005
286 Ga0501035_0512778 3300049822 Bacteria 986
287 Ga0501035_0808833 3300049822 Bacteria 748
288 Ga0501045_0005930 3300049824 Bacteria 8450
289 Ga0501045_0027882 3300049824 Bacteria 4073
290 Ga0501045_0106517 3300049824 Bacteria 2077
291 Ga0501045_0160903 3300049824 Bacteria 1671
292 Ga0501045_0211028 3300049824 Bacteria 1446
293 Ga0501045_0488753 3300049824 Bacteria 914
294 nmdc:mga00v17_1327_c1 3300050491 Bacteria 12961
295 nmdc:mga07m45_55872_c1 3300050496 Bacteria 2231
296 nmdc:mga05p37_206611_c1 3300050507 Bacteria 2375
297 nmdc:mga05p37_37471_c1 3300050507 Bacteria 5945
298 nmdc:mga05p37_674863_c1 3300050507 Bacteria 1153
299 nmdc:mga09592_830631_c1 3300050508 Bacteria 780
300 nmdc:mga08y16_50177_c1 3300050511 Bacteria 4367
301 nmdc:mga08y16_949701_c1 3300050511 Bacteria 843
302 nmdc:mga0n895_1071934_c1 3300050512 Bacteria 784
303 nmdc:mga0n895_16519_c1 3300050512 Bacteria 6775
304 nmdc:mga0rr50_27674_c1 3300050513 Bacteria 3974
305 nmdc:mga08x19_3479_c1 3300050514 Bacteria 9385
306 nmdc:mga0a205_148461_c1 3300050515 Bacteria 2244
307 nmdc:mga0a205_84779_c1 3300050515 Bacteria 3061
308 Ga0495601_0001981 3300053077 Bacteria 11457
309 Ga0495601_0352895 3300053077 Bacteria 956
310 Ga0495601_0469653 3300053077 Bacteria 813
311 Ga0495601_0470797 3300053077 Bacteria 812
312 Ga0500641_0001641 3300053096 Bacteria 7970
313 Ga0500595_013322 3300053119 Bacteria 3153
314 Ga0501084_0021639 3300054114 Bacteria 5362
315 Ga0501084_0050422 3300054114 Bacteria 3484
316 Ga0501084_0081378 3300054114 Bacteria 2716
317 Ga0501084_0447964 3300054114 Bacteria 1091
318 Ga0501082_0003831 3300060353 Bacteria 13152
319 Ga0501082_0051175 3300060353 Bacteria 3560
320 Ga0501082_0076302 3300060353 Bacteria 2889
321 Ga0501082_0080200 3300060353 Bacteria 2816
322 Ga0501082_0334587 3300060353 Bacteria 1319
323 Ga0501082_0478425 3300060353 Bacteria 1088
324 Ga0530510_0017099 3300061734 Bacteria 5136
325 Ga0530510_0063045 3300061734 Bacteria 2683
326 Ga0530510_0201448 3300061734 Bacteria 1478
327 2644457742 2643221681 Bacteria 3707866
328 2645722632 2643221961 Bacteria 3919167
329 2645725598 2643221962 Bacteria 3874254
330 2739793909 2739367756 Bacteria 4553612
331 2898796503 2898795034 Bacteria 4294459
332 2919679517 2919679072 Bacteria 4629602
333 3002142048 3002141150 Bacteria 5254435
334 Ga0070684_100322459
335 JGI24752J21851_1009501
336 JGI25407J50210_10006070
337 Ga0058863_10025369
338 Ga0070658_10136842
339 Ga0070676_10182673
340 Ga0068869_100031589
341 Ga0070666_10401142
342 Ga0070680_100117330
343 Ga0070682_100005994
344 Ga0068868_100017061
345 Ga0070691_10000784
346 Ga0070687_100054700
347 Ga0070692_10005885
348 Ga0070675_100110446
349 Ga0070671_100006587
350 Ga0070671_100014925
351 Ga0070673_100288830
352 Ga0070659_100093097
353 Ga0070659_100101470
354 Ga0070667_100017246
355 Ga0070714_100311893
356 Ga0070711_100003728
357 Ga0070711_100172449
358 Ga0070705_100142621
359 Ga0070678_100001810
360 Ga0070662_100128759
361 Ga0070672_100058326
362 Ga0070665_100059978
363 Ga0068855_100092559
364 Ga0070664_100514781
365 Ga0068854_100042605
366 Ga0068856_100091257
367 Ga0068856_100116683
368 Ga0068859_100152707
369 Ga0068864_100068638
370 Ga0068851_10027786
371 Ga0068870_10003946
372 Ga0068863_100006835
373 Ga0068858_100028807
374 Ga0068860_100064545
375 Ga0068862_100421248
376 Ga0075364_10001557
377 Ga0068871_100054332
378 Ga0075428_100801949
379 Ga0075430_100189444
380 Ga0075433_10034457
381 Ga0075434_100048231
382 Ga0075434_100977042
383 Ga0075429_100886637
384 Ga0097620_100152705
385 Ga0075435_100001805
386 Ga0105251_10098115
387 Ga0111539_10424569
388 Ga0111539_10824735
389 Ga0105247_10016014
390 Ga0114129_10053052
391 Ga0114129_10084302
392 Ga0114129_10283447
393 Ga0105243_11119295
394 Ga0105241_10001558
395 Ga0105242_10843077
396 Ga0105248_11080327
397 Ga0105237_10097049
398 Ga0105238_10121100
399 Ga0105239_10144820
400 Ga0157373_10071451
401 Ga0157371_10009610
402 Ga0157374_10039136
403 Ga0157378_10964707
404 Ga0157375_10456841
405 Ga0157375_11449180
406 Ga0163163_10581980
407 Ga0157380_10074890
408 Ga0157380_11634751
409 Ga0157377_10002387
410 Ga0157379_10619656
411 Ga0163161_10500754
412 Ga0197907_10476114
413 Ga0206356_10287356
414 Ga0206356_10290718
415 Ga0206349_1811945
416 Ga0206353_11133714
417 Ga0224712_10005583
418 Ga0224712_10010126
419 Ga0207710_10034617
420 Ga0207688_10018663
421 Ga0207647_10102698
422 Ga0207645_10093188
423 Ga0207643_10000509
424 Ga0207705_10026085
425 Ga0207654_10020065
426 Ga0207707_10080835
427 Ga0207707_10155439
428 Ga0207663_10005299
429 Ga0207657_10218694
430 Ga0207649_10120745
431 Ga0207652_10003277
432 Ga0207652_10020183
433 Ga0207694_10095149
434 Ga0207650_10036944
435 Ga0207659_10027957
436 Ga0207644_10044035
437 Ga0207644_10122534
438 Ga0207690_10039880
439 Ga0207690_10068880
440 Ga0207706_10077576
441 Ga0207669_10089442
442 Ga0207691_10029639
443 Ga0207711_10239054
444 Ga0207689_10003011
445 Ga0207679_10001724
446 Ga0207651_10222294
447 Ga0207640_10147964
448 Ga0207677_10033106
449 Ga0207703_10057662
450 Ga0207639_10258624
451 Ga0207678_10003455
452 Ga0207708_10067949
453 Ga0207702_10003496
454 Ga0207702_10180664
455 Ga0207641_10094075
456 Ga0207648_10069674
457 Ga0207676_10001025
458 Ga0207675_100114855
459 Ga0207683_10000792
460 Ga0207698_10001508
461 Ga0207698_10432195
462 Ga0207428_10043496
463 Ga0268266_10066887
464 Ga0265338_10029938
465 Ga0265338_10059260
466 Ga0265316_10401606
467 Ga0316578_10034522
468 Ga0316578_10211416
469 Ga0316577_10000054
470 Ga0307413_10033189
471 Ga0307413_10039636
472 Ga0307410_10198750
473 Ga0307409_100429566
474 Ga0307416_100158391
475 Ga0307416_100466776
476 Ga0307414_10500067
477 Ga0307411_10232068
478 Ga0307411_10329985
479 Ga0316574_0175167
480 Ga0373935_0230346
481 Ga0316582_0001016
482 Ga0316582_0114918
483 Ga0316584_0029339
484 Ga0395900_0002443
485 Ga0395898_0087943
486 Ga0395905_0960621
487 Ga0395901_0174374
488 Ga0395901_0508345
489 Ga0436360_0455145
490 Ga0436361_0370863
491 Ga0436362_0508410
492 Ga0436362_0788899
493 Ga0436362_0846256
494 Ga0451853_0459934
495 Ga0439448_0019167
496 Ga0439459_0005032
497 Ga0439460_0168196
498 Ga0466963_0369135
499 Ga0453684_0238062
500 Ga0453684_1463188
501 Ga0466970_0176909
502 Ga0466959_0021206
503 Ga0466959_0041085
504 Ga0466958_0383802
505 Ga0466967_0007672
506 Ga0466967_0063612
507 Ga0466967_0078896
508 Ga0466967_0393163
509 Ga0495653_0023882
510 Ga0495664_0000011
511 Ga0495618_0000142
512 Ga0495645_0000034
513 Ga0495645_0015823
514 Ga0495658_0043446
515 Ga0495676_0042918
516 Ga0496101_0013134
517 Ga0496102_0001115
518 Ga0496102_0020783
519 Ga0496103_0002109
520 Ga0496104_0128104
521 Ga0496105_0030859
522 Ga0496106_0095011
523 Ga0496107_0098085
524 Ga0496108_0014123
525 Ga0496109_0014268
526 Ga0496111_0002954
527 Ga0496112_0166421
528 Ga0496112_0920442
529 Ga0496114_0203594
530 Ga0496115_0022187
531 Ga0496122_0081224
532 Ga0496123_0019304
533 Ga0496124_0085527
534 Ga0501031_0024835
535 Ga0501031_0100109
536 Ga0501031_0409341
537 Ga0501034_1009703
538 Ga0501038_0060756
539 Ga0501039_0037118
540 Ga0501039_0107320
541 Ga0501039_0195637
542 Ga0501039_0231126
543 Ga0501039_0337059
544 Ga0501039_0660357
545 Ga0501040_0002837
546 Ga0501040_0010357
547 Ga0501040_0019471
548 Ga0501040_0021516
549 Ga0501040_0030152
550 Ga0501040_0031226
551 Ga0501041_0031803
552 Ga0501041_0043530
553 Ga0501041_0112366
554 Ga0501041_0427066
555 Ga0501042_0015240
556 Ga0501042_0062560
557 Ga0501042_0153716
558 Ga0501042_0329733
559 Ga0501042_0340395
560 Ga0501042_0345594
561 Ga0501046_0153546
562 Ga0501046_0373947
563 Ga0501048_0058087
564 Ga0501048_0122422
565 Ga0501048_0155208
566 Ga0501048_0399437
567 Ga0501048_0529102
568 Ga0501067_0065496
569 Ga0501068_0101933
570 Ga0501068_0124583
571 Ga0501068_0216832
572 Ga0501069_0104181
573 Ga0501069_0111802
574 Ga0501069_0158069
575 Ga0501069_0317841
576 Ga0501070_0140230
577 Ga0501070_0675786
578 Ga0501071_0001782
579 Ga0501071_0013643
580 Ga0501071_0049975
581 Ga0501071_0116306
582 Ga0501072_0028372
583 Ga0501072_0111830
584 Ga0501072_0403965
585 Ga0501074_0003423
586 Ga0501074_0038810
587 Ga0501074_0176279
588 Ga0501074_0194547
589 Ga0501074_0252047
590 Ga0501075_0009870
591 Ga0501075_0024473
592 Ga0501075_0036019
593 Ga0501075_0160868
594 Ga0501075_0306589
595 Ga0501076_0003612
596 Ga0501076_0017677
597 Ga0501076_0056688
598 Ga0501076_0128741
599 Ga0501076_0296368
600 Ga0501076_0400412
601 Ga0501077_0030264
602 Ga0501077_0043307
603 Ga0501077_0147585
604 Ga0501077_0566470
605 Ga0501079_0025392
606 Ga0501079_0041718
607 Ga0501079_0042996
608 Ga0501079_0226842
609 Ga0501079_0391835
610 Ga0501080_0236158
611 Ga0501080_0370607
612 Ga0501081_0013386
613 Ga0501081_0023122
614 Ga0501081_0059312
615 Ga0501083_0290322
616 Ga0501083_0377434
617 Ga0501035_0286089
618 Ga0501035_0496209
619 Ga0501035_0512778
620 Ga0501035_0808833
621 Ga0501045_0005930
622 Ga0501045_0027882
623 Ga0501045_0106517
624 Ga0501045_0160903
625 Ga0501045_0211028
626 Ga0501045_0488753
627 nmdc:mga00v17_1327_c1
628 nmdc:mga07m45_55872_c1
629 nmdc:mga05p37_206611_c1
630 nmdc:mga05p37_37471_c1
631 nmdc:mga05p37_674863_c1
632 nmdc:mga09592_830631_c1
633 nmdc:mga08y16_50177_c1
634 nmdc:mga08y16_949701_c1
635 nmdc:mga0n895_1071934_c1
636 nmdc:mga0n895_16519_c1
637 nmdc:mga0rr50_27674_c1
638 nmdc:mga08x19_3479_c1
639 nmdc:mga0a205_148461_c1
640 nmdc:mga0a205_84779_c1
641 Ga0495601_0001981
642 Ga0495601_0352895
643 Ga0495601_0469653
644 Ga0495601_0470797
645 Ga0500641_0001641
646 Ga0500595_013322
647 Ga0501084_0021639
648 Ga0501084_0050422
649 Ga0501084_0081378
650 Ga0501084_0447964
651 Ga0501082_0003831
652 Ga0501082_0051175
653 Ga0501082_0076302
654 Ga0501082_0080200
655 Ga0501082_0334587
656 Ga0501082_0478425
657 Ga0530510_0017099
658 Ga0530510_0063045
659 Ga0530510_0201448
660 2644457742
661 2645722632
662 2645725598
663 2739793909
664 2898796503
665 2919679517
666 3002142048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

48

205

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9811 18 219
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9804 17 207
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9763 18 219
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9753 17 207
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9689 18 202
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9573 55 203 3.30.1060.10
af_Q09859_1_167_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9535 55 213 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.953 14 205 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9383 55 203 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9338 14 205 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9956 43 193 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A3C1N8T3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9914 54 218 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A0L8FPK6-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9912 79 219 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A354CAY5-F1-model_v4 deleted 0.9908 71 222
AF-A0A257NGS9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9905 57 217 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map