F410987

General Info

Members Datasets Scaffolds Average Seq Length
332 213 332 127

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10001493|Ga0316575_100014932
Length 155
Sequence MYRSAVPLSSAAIHYPLIPAPTRYFLEFHVSRTPITTADAPQAIGTYSQAVRSGSTVYLSGQIPLDPASGQLVTGDMEAQVRRVFDNLRAVAVAAGSDLDSVVKLNVYLTDLGHFQLVNQVMAEYFSEPYPARAAVGVAALPRGAAVEMDCVLEL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
118 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
119 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
120 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
138 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
139 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
140 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
141 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
144 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
145 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
146 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
152 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
153 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.39
Metatranscriptomes 3.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0
Rhizoplane 0.6
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3686048 2162886007 Bacteria 2352
2 Ga0065714_10009671 3300005288 Bacteria 3734
3 Ga0065704_10003069 3300005289 Bacteria 5050
4 Ga0065712_10047467 3300005290 Bacteria 931
5 Ga0065715_10021991 3300005293 Bacteria 1692
6 Ga0065715_10295593 3300005293 Bacteria 1025
7 Ga0065707_10001309 3300005295 Bacteria 7022
8 Ga0065707_10867273 3300005295 Bacteria 577
9 Ga0070658_10499573 3300005327 Unclassified 1051
10 Ga0070676_10470857 3300005328 Bacteria 887
11 Ga0070670_100378702 3300005331 Bacteria 1246
12 Ga0068868_100790332 3300005338 Bacteria 855
13 Ga0070689_101192622 3300005340 Unclassified 683
14 Ga0070687_101094144 3300005343 Bacteria 583
15 Ga0070661_100286967 3300005344 Bacteria 1278
16 Ga0070669_100181304 3300005353 Bacteria 1647
17 Ga0070675_100141685 3300005354 Bacteria 2055
18 Ga0070675_100278235 3300005354 Bacteria 1470
19 Ga0070675_102033691 3300005354 Bacteria 530
20 Ga0070671_100240694 3300005355 Bacteria 1536
21 Ga0070673_100072300 3300005364 Bacteria 2773
22 Ga0070673_100372315 3300005364 Bacteria 1272
23 Ga0070688_101054640 3300005365 Unclassified 648
24 Ga0070659_100965532 3300005366 Bacteria 747
25 Ga0070667_100061410 3300005367 Bacteria 3182
26 Ga0070667_100402889 3300005367 Bacteria 1245
27 Ga0070694_100135618 3300005444 Bacteria 1783
28 Ga0070663_101107781 3300005455 Unclassified 692
29 Ga0070681_10692347 3300005458 Bacteria 935
30 Ga0068867_100142771 3300005459 Bacteria 1873
31 Ga0070672_100051048 3300005543 Bacteria 3224
32 Ga0070693_100487369 3300005547 Bacteria 872
33 Ga0070665_101692936 3300005548 Bacteria 640
34 Ga0070664_101115319 3300005564 Bacteria 743
35 Ga0068852_100325469 3300005616 Bacteria 1494
36 Ga0068852_100416342 3300005616 Bacteria 1325
37 Ga0068859_100212444 3300005617 Bacteria 2021
38 Ga0068859_100722548 3300005617 Bacteria 1086
39 Ga0068864_102509823 3300005618 Bacteria 521
40 Ga0068861_100608656 3300005719 Bacteria 1004
41 Ga0068861_100932445 3300005719 Bacteria 824
42 Ga0068870_10350711 3300005840 Bacteria 947
43 Ga0068863_101223122 3300005841 Bacteria 757
44 Ga0068862_100220760 3300005844 Bacteria 1716
45 Ga0068862_100374432 3300005844 Bacteria 1326
46 Ga0068862_101635771 3300005844 Unclassified 651
47 Ga0075427_10020246 3300006194 Bacteria 1053
48 Ga0075366_10340098 3300006195 Bacteria 920
49 Ga0097621_100385983 3300006237 Bacteria 1252
50 Ga0075428_100039616 3300006844 Bacteria 5186
51 Ga0075428_100107466 3300006844 Bacteria 3041
52 Ga0075428_100266066 3300006844 Bacteria 1845
53 Ga0075430_100017829 3300006846 Bacteria 6043
54 Ga0075430_100095582 3300006846 Bacteria 2483
55 Ga0075431_100010551 3300006847 Bacteria 9287
56 Ga0075431_100050602 3300006847 Bacteria 4283
57 Ga0075431_100143438 3300006847 Bacteria 2461
58 Ga0075434_102302652 3300006871 Bacteria 542
59 Ga0075429_100002254 3300006880 Bacteria 16146
60 Ga0075429_100101046 3300006880 Bacteria 2517
61 Ga0075429_100319728 3300006880 Bacteria 1358
62 Ga0075436_100415678 3300006914 Bacteria 976
63 Ga0097620_100212433 3300006931 Bacteria 2021
64 Ga0097620_100722600 3300006931 Bacteria 1086
65 Ga0105250_10000030 3300009092 Bacteria 177339
66 Ga0105240_10122244 3300009093 Bacteria 3133
67 Ga0111539_10014678 3300009094 Bacteria 9774
68 Ga0111539_10059263 3300009094 Bacteria 4541
69 Ga0111539_11603184 3300009094 Bacteria 755
70 Ga0114129_10002637 3300009147 Bacteria 24969
71 Ga0114129_10052221 3300009147 Bacteria 5737
72 Ga0105243_10024736 3300009148 Bacteria 4583
73 Ga0105242_11428731 3300009176 Bacteria 720
74 Ga0105248_11150475 3300009177 Bacteria 877
75 Ga0105249_10158403 3300009553 Bacteria 2186
76 Ga0105239_10224690 3300010375 Bacteria 2106
77 Ga0157374_10214795 3300013296 Bacteria 1886
78 Ga0157378_10034003 3300013297 Bacteria 4509
79 Ga0157375_10216203 3300013308 Bacteria 2075
80 Ga0157375_10510600 3300013308 Bacteria 1366
81 Ga0157375_10576227 3300013308 Bacteria 1286
82 Ga0157375_12441693 3300013308 Bacteria 624
83 Ga0163163_11110931 3300014325 Bacteria 853
84 Ga0157380_10194171 3300014326 Bacteria 1795
85 Ga0157380_10212438 3300014326 Bacteria 1725
86 Ga0157379_10000378 3300014968 Bacteria 35917
87 Ga0224572_1086801 3300024225 Bacteria 577
88 Ga0209233_1015131 3300025261 Bacteria 2158
89 Ga0207696_1000224 3300025711 Bacteria 81312
90 Ga0207645_10278122 3300025907 Bacteria 1111
91 Ga0207645_10737212 3300025907 Bacteria 670
92 Ga0207643_10067961 3300025908 Bacteria 2046
93 Ga0207684_10000009 3300025910 Bacteria 572126
94 Ga0207695_10198013 3300025913 Bacteria 1924
95 Ga0207649_10450204 3300025920 Bacteria 972
96 Ga0207681_10321893 3300025923 Bacteria 1230
97 Ga0207650_11111829 3300025925 Bacteria 673
98 Ga0207659_11434295 3300025926 Bacteria 591
99 Ga0207644_10059976 3300025931 Bacteria 2753
100 Ga0207644_10679776 3300025931 Bacteria 858
101 Ga0207709_10015576 3300025935 Bacteria 4217
102 Ga0207669_10016646 3300025937 Bacteria 3743
103 Ga0207669_11380397 3300025937 Bacteria 600
104 Ga0207704_11461407 3300025938 Unclassified 586
105 Ga0207691_10046293 3300025940 Bacteria 3998
106 Ga0207679_11595906 3300025945 Bacteria 598
107 Ga0207651_10012849 3300025960 Bacteria 4760
108 Ga0207651_10131038 3300025960 Bacteria 1920
109 Ga0207668_11066648 3300025972 Bacteria 724
110 Ga0207640_10660779 3300025981 Bacteria 892
111 Ga0207677_10773843 3300026023 Bacteria 857
112 Ga0207708_10012329 3300026075 Bacteria 6370
113 Ga0207648_10137224 3300026089 Bacteria 2155
114 Ga0207648_10171096 3300026089 Bacteria 1920
115 Ga0207675_100027005 3300026118 Bacteria 5345
116 Ga0207683_10528678 3300026121 Bacteria 1090
117 Ga0207683_10696004 3300026121 Bacteria 942
118 Ga0207698_10630847 3300026142 Bacteria 1059
119 Ga0207698_10984188 3300026142 Bacteria 854
120 Ga0209974_10033210 3300027876 Bacteria 1712
121 Ga0207428_10008110 3300027907 Bacteria 9519
122 Ga0207428_10098443 3300027907 Bacteria 2263
123 Ga0207428_10141634 3300027907 Bacteria 1835
124 Ga0265356_1002069 3300028017 Bacteria 2751
125 Ga0268266_11174470 3300028379 Bacteria 742
126 Ga0268265_10336899 3300028380 Unclassified 1372
127 Ga0265318_10068525 3300028577 Bacteria 1316
128 Ga0265332_10152550 3300031238 Bacteria 966
129 Ga0265320_10077942 3300031240 Bacteria 1550
130 Ga0265325_10084072 3300031241 Bacteria 1578
131 Ga0265340_10015426 3300031247 Bacteria 3969
132 Ga0265340_10158150 3300031247 Bacteria 1031
133 Ga0265339_10077725 3300031249 Bacteria 1759
134 Ga0265316_10117438 3300031344 Bacteria 2011
135 Ga0307408_100018718 3300031548 Bacteria 4653
136 Ga0307408_100663197 3300031548 Bacteria 934
137 Ga0307408_100728833 3300031548 Bacteria 893
138 Ga0307408_100971092 3300031548 Bacteria 781
139 Ga0307408_102371538 3300031548 Bacteria 515
140 Ga0316575_10001493 3300031665 Bacteria 7552
141 Ga0316575_10003536 3300031665 Bacteria 5400
142 Ga0316579_10010257 3300031691 Bacteria 3956
143 Ga0316579_10421589 3300031691 Bacteria 645
144 Ga0265314_10545970 3300031711 Bacteria 604
145 Ga0265342_10013912 3300031712 Bacteria 5367
146 Ga0316576_10015714 3300031727 Bacteria 5089
147 Ga0316576_10052106 3300031727 Bacteria 2979
148 Ga0316576_10073923 3300031727 Bacteria 2519
149 Ga0316576_10095350 3300031727 Bacteria 2219
150 Ga0316576_10097377 3300031727 Bacteria 2196
151 Ga0316576_10471567 3300031727 Unclassified 925
152 Ga0316576_10574402 3300031727 Bacteria 824
153 Ga0316578_10006982 3300031728 Bacteria 5618
154 Ga0316578_10046743 3300031728 Bacteria 2524
155 Ga0316578_10048903 3300031728 Bacteria 2470
156 Ga0316578_10063882 3300031728 Bacteria 2172
157 Ga0316578_10155438 3300031728 Bacteria 1378
158 Ga0316578_10612325 3300031728 Bacteria 637
159 Ga0307405_10218273 3300031731 Bacteria 1397
160 Ga0307405_10899836 3300031731 Bacteria 748
161 Ga0307405_11199971 3300031731 Bacteria 656
162 Ga0316577_10041831 3300031733 Bacteria 2564
163 Ga0316577_10056027 3300031733 Bacteria 2199
164 Ga0316577_10105052 3300031733 Bacteria 1584
165 Ga0316577_10119759 3300031733 Bacteria 1479
166 Ga0316577_10240793 3300031733 Bacteria 1023
167 Ga0316577_10308004 3300031733 Bacteria 897
168 Ga0307413_10528644 3300031824 Bacteria 952
169 Ga0307410_11969221 3300031852 Unclassified 521
170 Ga0307406_10097370 3300031901 Bacteria 1995
171 Ga0307406_10958466 3300031901 Bacteria 732
172 Ga0307406_11143657 3300031901 Bacteria 674
173 Ga0307406_11576677 3300031901 Bacteria 579
174 Ga0307407_10831698 3300031903 Bacteria 704
175 Ga0307407_10969652 3300031903 Bacteria 656
176 Ga0307412_10045313 3300031911 Bacteria 2874
177 Ga0307412_10443341 3300031911 Bacteria 1068
178 Ga0307409_102037490 3300031995 Bacteria 604
179 Ga0307416_100108895 3300032002 Bacteria 2435
180 Ga0307416_101744237 3300032002 Bacteria 727
181 Ga0307414_10114624 3300032004 Bacteria 2059
182 Ga0307414_10284705 3300032004 Bacteria 1391
183 Ga0307414_10315934 3300032004 Bacteria 1327
184 Ga0307414_10331840 3300032004 Bacteria 1299
185 Ga0307411_10082416 3300032005 Bacteria 2218
186 Ga0307411_10332670 3300032005 Bacteria 1231
187 Ga0307411_11499991 3300032005 Unclassified 620
188 Ga0307411_11912331 3300032005 Unclassified 552
189 Ga0307411_11915684 3300032005 Bacteria 552
190 Ga0316583_10015102 3300032133 Bacteria 2779
191 Ga0316585_10012867 3300032137 Bacteria 2486
192 Ga0316580_10001288 3300032139 Bacteria 6488
193 Ga0316580_10042787 3300032139 Unclassified 1398
194 Ga0316593_10033247 3300032168 Bacteria 1688
195 Ga0316593_10093641 3300032168 Bacteria 1059
196 Ga0316593_10208054 3300032168 Bacteria 725
197 Ga0316593_10221656 3300032168 Bacteria 703
198 Ga0316592_1001379 3300033524 Bacteria 3881
199 Ga0316592_1067056 3300033524 Bacteria 809
200 Ga0316586_1006652 3300033527 Bacteria 1664
201 Ga0316588_1001177 3300033528 Bacteria 4170
202 Ga0316588_1011672 3300033528 Bacteria 1879
203 Ga0316587_1000828 3300033529 Bacteria 3454
204 Ga0316596_1002704 3300033541 Bacteria 3812
205 Ga0316596_1107669 3300033541 Bacteria 755
206 Ga0373952_0000039 3300035092 Bacteria 15480
207 Ga0373941_0234156 3300035115 Bacteria 711
208 Ga0373953_0573564 3300035117 Bacteria 502
209 Ga0373960_0003205 3300035121 Bacteria 3701
210 Ga0373955_0182578 3300035172 Bacteria 1245
211 Ga0373962_0262135 3300035242 Bacteria 603
212 Ga0316574_0030404 3300035398 Bacteria 3270
213 Ga0316574_0042956 3300035398 Bacteria 2791
214 Ga0316574_0115228 3300035398 Bacteria 1723
215 Ga0316574_0588133 3300035398 Bacteria 689
216 Ga0316574_0833093 3300035398 Bacteria 560
217 Ga0373933_0084336 3300035724 Bacteria 1952
218 Ga0373937_0125678 3300036401 Bacteria 2392
219 Ga0373937_0170629 3300036401 Bacteria 2041
220 Ga0316582_0058567 3300036647 Bacteria 2463
221 Ga0316582_0119936 3300036647 Bacteria 1759
222 Ga0316582_0189346 3300036647 Bacteria 1401
223 Ga0316582_0369046 3300036647 Bacteria 988
224 Ga0316584_0040175 3300036712 Bacteria 3485
225 Ga0316584_0054826 3300036712 Bacteria 2985
226 Ga0316584_0062589 3300036712 Bacteria 2786
227 Ga0316584_0092807 3300036712 Bacteria 2260
228 Ga0316584_0096006 3300036712 Bacteria 2219
229 Ga0316584_0153370 3300036712 Bacteria 1714
230 Ga0316584_0238852 3300036712 Bacteria 1330
231 Ga0316584_0380608 3300036712 Bacteria 1008
232 Ga0400484_08892 3300038725 Bacteria 2614
233 Ga0400490_34574 3300038726 Bacteria 2262
234 Ga0400488_21557 3300038741 Bacteria 1837
235 Ga0400488_58184 3300038741 Bacteria 2416
236 Ga0400483_142109 3300039062 Bacteria 1712
237 Ga0400483_161552 3300039062 Unclassified 1464
238 Ga0400487_02009 3300039110 Bacteria 5161
239 Ga0451837_0500343 3300041494 Bacteria 576
240 Ga0451839_1125110 3300041496 Bacteria 1170
241 Ga0451841_0868405 3300041498 Bacteria 714
242 Ga0451847_0630536 3300041503 Bacteria 803
243 Ga0451855_0875701 3300041511 Unclassified 606
244 Ga0451853_0843523 3300041512 Bacteria 539
245 Ga0439431_0087950 3300041997 Bacteria 844
246 Ga0439442_055387 3300042002 Bacteria 838
247 Ga0439448_0201913 3300042005 Bacteria 697
248 Ga0450894_030694 3300042131 Bacteria 749
249 Ga0450902_076910 3300042137 Bacteria 585
250 Ga0450889_011363 3300042144 Bacteria 926
251 Ga0439444_0176591 3300042437 Bacteria 528
252 Ga0439460_0087301 3300042461 Bacteria 987
253 Ga0451577_0037730 3300042876 Bacteria 4348
254 Ga0451577_0069248 3300042876 Bacteria 3146
255 Ga0451577_0115529 3300042876 Bacteria 2403
256 Ga0451577_1337022 3300042876 Bacteria 637
257 Ga0439440_0252547 3300042993 Bacteria 537
258 Ga0453683_0060473 3300044673 Bacteria 2369
259 Ga0453684_0032784 3300044712 Bacteria 7258
260 Ga0453684_0288584 3300044712 Bacteria 1869
261 Ga0453684_0446166 3300044712 Bacteria 1441
262 Ga0453684_2137575 3300044712 Bacteria 560
263 Ga0451576_0042385 3300045051 Bacteria 4805
264 Ga0451576_0499669 3300045051 Bacteria 1278
265 Ga0466958_0750734 3300045836 Bacteria 636
266 Ga0466967_0541900 3300045976 Bacteria 1145
267 Ga0495603_0113918 3300046455 Bacteria 1577
268 Ga0495603_0302320 3300046455 Bacteria 919
269 Ga0495650_0002220 3300046471 Bacteria 16320
270 Ga0495594_0232760 3300046499 Unclassified 1050
271 Ga0495583_0052079 3300046506 Bacteria 1864
272 Ga0495598_0080289 3300046537 Bacteria 1045
273 Ga0495599_0370911 3300046678 Bacteria 856
274 Ga0495599_0573804 3300046678 Unclassified 659
275 Ga0495600_0544464 3300046809 Unclassified 710
276 Ga0495680_0364693 3300047322 Unclassified 1003
277 Ga0496110_0697203 3300048913 Bacteria 917
278 Ga0496114_0354490 3300048917 Unclassified 1298
279 Ga0496116_0000008 3300048919 Bacteria 726753
280 Ga0496121_0001480 3300048924 Bacteria 39560
281 Ga0501032_0014371 3300049569 Bacteria 5607
282 Ga0501033_0110818 3300049570 Bacteria 1997
283 Ga0501034_0009796 3300049571 Bacteria 10021
284 Ga0501036_0017888 3300049572 Bacteria 5933
285 Ga0501036_0836997 3300049572 Bacteria 757
286 Ga0501037_0004691 3300049573 Bacteria 9935
287 Ga0501038_0014667 3300049574 Bacteria 7140
288 Ga0501039_0021305 3300049575 Bacteria 4973
289 Ga0501040_0001169 3300049576 Bacteria 16704
290 Ga0501040_0407631 3300049576 Unclassified 976
291 Ga0501042_0002857 3300049578 Bacteria 10706
292 Ga0501042_0080573 3300049578 Bacteria 2332
293 Ga0501043_0014832 3300049579 Bacteria 6101
294 Ga0501046_0010597 3300049580 Bacteria 7911
295 Ga0501047_0010186 3300049581 Bacteria 8888
296 Ga0501048_0031217 3300049582 Bacteria 3854
297 Ga0501048_0165486 3300049582 Bacteria 1566
298 Ga0501067_0004019 3300049583 Bacteria 8115
299 Ga0501068_0008389 3300049584 Bacteria 5746
300 Ga0501069_0002128 3300049585 Bacteria 9970
301 Ga0501070_0013448 3300049586 Bacteria 6898
302 Ga0501071_0011504 3300049587 Bacteria 5966
303 Ga0501072_0040890 3300049588 Bacteria 3641
304 Ga0501073_0142707 3300049589 Bacteria 1659
305 Ga0501074_0033576 3300049590 Bacteria 3719
306 Ga0501076_0287554 3300049592 Bacteria 1347
307 Ga0501079_0010517 3300049741 Bacteria 7034
308 Ga0501081_0140683 3300049743 Bacteria 1729
309 Ga0501081_0383176 3300049743 Bacteria 1039
310 Ga0501083_0004432 3300049744 Bacteria 9911
311 Ga0501083_0676648 3300049744 Bacteria 671
312 Ga0501035_0006878 3300049822 Bacteria 10624
313 Ga0501044_0022643 3300049823 Bacteria 6691
314 Ga0501045_0013333 3300049824 Bacteria 5803
315 Ga0501045_0200630 3300049824 Bacteria 1486
316 nmdc:mga0k408_315340_c1 3300050493 Bacteria 933
317 nmdc:mga05p37_1145_c1 3300050507 Bacteria 30507
318 nmdc:mga05p37_47281_c2 3300050507 Bacteria 4472
319 nmdc:mga09592_24683_c1 3300050508 Bacteria 4972
320 nmdc:mga09592_3989_c1 3300050508 Bacteria 11894
321 nmdc:mga0qj67_32854_c1 3300050509 Bacteria 4048
322 nmdc:mga06r32_2704_c1 3300050510 Bacteria 15862
323 nmdc:mga06r32_6144_c1 3300050510 Bacteria 10785
324 nmdc:mga06r32_9158_c1 3300050510 Bacteria 8923
325 nmdc:mga08y16_1919_c1 3300050511 Bacteria 20743
326 nmdc:mga08y16_26385_c1 3300050511 Bacteria 6126
327 nmdc:mga08y16_304232_c1 3300050511 Bacteria 1643
328 nmdc:mga0n895_1180043_c1 3300050512 Bacteria 740
329 nmdc:mga0a205_291061_c1 3300050515 Bacteria 1507
330 Ga0500556_0000121 3300053104 Bacteria 67560
331 Ga0500622_0004686 3300053156 Bacteria 8461
332 Ga0501084_0685327 3300054114 Unclassified 864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005290 Ga0065712_10047467 Ga0065712_100474672 124
2 3300005367 Ga0070667_100402889 Ga0070667_1004028892 124
3 3300005616 Ga0068852_100325469 Ga0068852_1003254691 124
4 3300005617 Ga0068859_100212444 Ga0068859_1002124442 124
5 3300005618 Ga0068864_102509823 Ga0068864_1025098232 124
6 3300006931 Ga0097620_100212433 Ga0097620_1002124332 124
7 3300025935 Ga0207709_10015576 Ga0207709_100155764 124
8 3300025981 Ga0207640_10660779 Ga0207640_106607792 124
9 3300026075 Ga0207708_10012329 Ga0207708_100123293 124
10 3300026089 Ga0207648_10137224 Ga0207648_101372242 124
11 3300026142 Ga0207698_10630847 Ga0207698_106308472 124
12 3300005340 Ga0070689_101192622 Ga0070689_1011926221 125
13 3300005458 Ga0070681_10692347 Ga0070681_106923472 125
14 3300006195 Ga0075366_10340098 Ga0075366_103400982 125
15 3300006914 Ga0075436_100415678 Ga0075436_1004156782 125
16 3300009148 Ga0105243_10024736 Ga0105243_100247362 125
17 3300009176 Ga0105242_11428731 Ga0105242_114287311 125
18 3300009177 Ga0105248_11150475 Ga0105248_111504752 125
19 3300009553 Ga0105249_10158403 Ga0105249_101584032 125
20 3300013296 Ga0157374_10214795 Ga0157374_102147952 125
21 3300013297 Ga0157378_10034003 Ga0157378_100340033 125
22 3300014325 Ga0163163_11110931 Ga0163163_111109312 125
23 3300032002 Ga0307416_101744237 Ga0307416_1017442371 125
24 3300032005 Ga0307411_11915684 Ga0307411_119156841 125
25 3300035092 Ga0373952_0000039 Ga0373952_0000039_9121_9501 125
26 3300035121 Ga0373960_0003205 Ga0373960_0003205_961_1341 125
27 3300035242 Ga0373962_0262135 Ga0373962_0262135_74_514 125
28 3300045051 Ga0451576_0499669 Ga0451576_0499669_814_1194 125
29 3300046499 Ga0495594_0232760 Ga0495594_0232760_495_878 125
30 3300048919 Ga0496116_0000008 Ga0496116_0000008_27494_27871 125
31 3300048924 Ga0496121_0001480 Ga0496121_0001480_7495_7872 125
32 3300050493 nmdc:mga0k408_315340_c1 nmdc:mga0k408_315340_c1_13_393 125
33 2162886007 SwRhRL2b_contig_3686048 SwRhRL2b_0413.00000430 126
34 3300005288 Ga0065714_10009671 Ga0065714_100096712 126
35 3300005289 Ga0065704_10003069 Ga0065704_100030696 126
36 3300005293 Ga0065715_10021991 Ga0065715_100219912 126
37 3300005293 Ga0065715_10295593 Ga0065715_102955932 126
38 3300005295 Ga0065707_10001309 Ga0065707_100013097 126
39 3300005295 Ga0065707_10867273 Ga0065707_108672731 126
40 3300005327 Ga0070658_10499573 Ga0070658_104995732 126
41 3300005328 Ga0070676_10470857 Ga0070676_104708572 126
42 3300005331 Ga0070670_100378702 Ga0070670_1003787022 126
43 3300005338 Ga0068868_100790332 Ga0068868_1007903321 126
44 3300005343 Ga0070687_101094144 Ga0070687_1010941441 126
45 3300005344 Ga0070661_100286967 Ga0070661_1002869672 126
46 3300005353 Ga0070669_100181304 Ga0070669_1001813042 126
47 3300005354 Ga0070675_100141685 Ga0070675_1001416852 126
48 3300005354 Ga0070675_100278235 Ga0070675_1002782352 126
49 3300005354 Ga0070675_102033691 Ga0070675_1020336911 126
50 3300005355 Ga0070671_100240694 Ga0070671_1002406942 126
51 3300005364 Ga0070673_100072300 Ga0070673_1000723001 126
52 3300005364 Ga0070673_100372315 Ga0070673_1003723152 126
53 3300005365 Ga0070688_101054640 Ga0070688_1010546402 126
54 3300005366 Ga0070659_100965532 Ga0070659_1009655322 126
55 3300005367 Ga0070667_100061410 Ga0070667_1000614102 126
56 3300005444 Ga0070694_100135618 Ga0070694_1001356181 126
57 3300005455 Ga0070663_101107781 Ga0070663_1011077811 126
58 3300005459 Ga0068867_100142771 Ga0068867_1001427712 126
59 3300005543 Ga0070672_100051048 Ga0070672_1000510482 126
60 3300005547 Ga0070693_100487369 Ga0070693_1004873692 126
61 3300005548 Ga0070665_101692936 Ga0070665_1016929361 126
62 3300005564 Ga0070664_101115319 Ga0070664_1011153191 126
63 3300005616 Ga0068852_100416342 Ga0068852_1004163422 126
64 3300005617 Ga0068859_100722548 Ga0068859_1007225482 126
65 3300005719 Ga0068861_100608656 Ga0068861_1006086562 126
66 3300005719 Ga0068861_100932445 Ga0068861_1009324452 126
67 3300005840 Ga0068870_10350711 Ga0068870_103507112 126
68 3300005841 Ga0068863_101223122 Ga0068863_1012231222 126
69 3300005844 Ga0068862_100220760 Ga0068862_1002207602 126
70 3300005844 Ga0068862_100374432 Ga0068862_1003744322 126
71 3300005844 Ga0068862_101635771 Ga0068862_1016357712 126
72 3300006194 Ga0075427_10020246 Ga0075427_100202462 126
73 3300006237 Ga0097621_100385983 Ga0097621_1003859832 126
74 3300006844 Ga0075428_100039616 Ga0075428_1000396166 126
75 3300006844 Ga0075428_100107466 Ga0075428_1001074663 126
76 3300006844 Ga0075428_100266066 Ga0075428_1002660662 126
77 3300006846 Ga0075430_100017829 Ga0075430_1000178293 126
78 3300006846 Ga0075430_100095582 Ga0075430_1000955822 126
79 3300006847 Ga0075431_100010551 Ga0075431_1000105519 126
80 3300006847 Ga0075431_100050602 Ga0075431_1000506022 126
81 3300006847 Ga0075431_100143438 Ga0075431_1001434382 126
82 3300006871 Ga0075434_102302652 Ga0075434_1023026521 126
83 3300006880 Ga0075429_100002254 Ga0075429_1000022549 126
84 3300006880 Ga0075429_100101046 Ga0075429_1001010462 126
85 3300006880 Ga0075429_100319728 Ga0075429_1003197282 126
86 3300006931 Ga0097620_100722600 Ga0097620_1007226002 126
87 3300009092 Ga0105250_10000030 Ga0105250_1000003052 126
88 3300009093 Ga0105240_10122244 Ga0105240_101222442 126
89 3300009094 Ga0111539_10014678 Ga0111539_100146782 126
90 3300009094 Ga0111539_10059263 Ga0111539_100592633 126
91 3300009094 Ga0111539_11603184 Ga0111539_116031842 126
92 3300009147 Ga0114129_10002637 Ga0114129_100026379 126
93 3300009147 Ga0114129_10052221 Ga0114129_100522214 126
94 3300010375 Ga0105239_10224690 Ga0105239_102246902 126
95 3300013308 Ga0157375_10216203 Ga0157375_102162032 126
96 3300013308 Ga0157375_10510600 Ga0157375_105106002 126
97 3300013308 Ga0157375_10576227 Ga0157375_105762272 126
98 3300013308 Ga0157375_12441693 Ga0157375_124416931 126
99 3300014326 Ga0157380_10194171 Ga0157380_101941712 126
100 3300014326 Ga0157380_10212438 Ga0157380_102124382 126
101 3300014968 Ga0157379_10000378 Ga0157379_1000037833 126
102 3300024225 Ga0224572_1086801 Ga0224572_10868012 126
103 3300025261 Ga0209233_1015131 Ga0209233_10151312 126
104 3300025711 Ga0207696_1000224 Ga0207696_100022430 126
105 3300025907 Ga0207645_10278122 Ga0207645_102781222 126
106 3300025907 Ga0207645_10737212 Ga0207645_107372121 126
107 3300025908 Ga0207643_10067961 Ga0207643_100679612 126
108 3300025910 Ga0207684_10000009 Ga0207684_1000000977 126
109 3300025913 Ga0207695_10198013 Ga0207695_101980132 126
110 3300025920 Ga0207649_10450204 Ga0207649_104502042 126
111 3300025923 Ga0207681_10321893 Ga0207681_103218932 126
112 3300025925 Ga0207650_11111829 Ga0207650_111118291 126
113 3300025926 Ga0207659_11434295 Ga0207659_114342951 126
114 3300025931 Ga0207644_10059976 Ga0207644_100599762 126
115 3300025931 Ga0207644_10679776 Ga0207644_106797761 126
116 3300025937 Ga0207669_10016646 Ga0207669_100166463 126
117 3300025937 Ga0207669_11380397 Ga0207669_113803972 126
118 3300025938 Ga0207704_11461407 Ga0207704_114614071 126
119 3300025940 Ga0207691_10046293 Ga0207691_100462932 126
120 3300025945 Ga0207679_11595906 Ga0207679_115959061 126
121 3300025960 Ga0207651_10012849 Ga0207651_100128491 126
122 3300025960 Ga0207651_10131038 Ga0207651_101310382 126
123 3300025972 Ga0207668_11066648 Ga0207668_110666482 126
124 3300026023 Ga0207677_10773843 Ga0207677_107738432 126
125 3300026089 Ga0207648_10171096 Ga0207648_101710962 126
126 3300026118 Ga0207675_100027005 Ga0207675_1000270053 126
127 3300026121 Ga0207683_10528678 Ga0207683_105286781 126
128 3300026121 Ga0207683_10696004 Ga0207683_106960042 126
129 3300026142 Ga0207698_10984188 Ga0207698_109841881 126
130 3300027876 Ga0209974_10033210 Ga0209974_100332102 126
131 3300027907 Ga0207428_10008110 Ga0207428_100081105 126
132 3300027907 Ga0207428_10098443 Ga0207428_100984432 126
133 3300027907 Ga0207428_10141634 Ga0207428_101416342 126
134 3300028017 Ga0265356_1002069 Ga0265356_10020692 126
135 3300028379 Ga0268266_11174470 Ga0268266_111744702 126
136 3300028380 Ga0268265_10336899 Ga0268265_103368992 126
137 3300028577 Ga0265318_10068525 Ga0265318_100685252 126
138 3300031238 Ga0265332_10152550 Ga0265332_101525502 126
139 3300031240 Ga0265320_10077942 Ga0265320_100779421 126
140 3300031241 Ga0265325_10084072 Ga0265325_100840722 126
141 3300031247 Ga0265340_10015426 Ga0265340_100154262 126
142 3300031247 Ga0265340_10158150 Ga0265340_101581502 126
143 3300031249 Ga0265339_10077725 Ga0265339_100777252 126
144 3300031344 Ga0265316_10117438 Ga0265316_101174382 126
145 3300031548 Ga0307408_100018718 Ga0307408_1000187182 126
146 3300031548 Ga0307408_100663197 Ga0307408_1006631972 126
147 3300031548 Ga0307408_100728833 Ga0307408_1007288332 126
148 3300031548 Ga0307408_100971092 Ga0307408_1009710921 126
149 3300031548 Ga0307408_102371538 Ga0307408_1023715381 126
150 3300031665 Ga0316575_10001493 Ga0316575_100014932 126
151 3300031665 Ga0316575_10003536 Ga0316575_100035364 126
152 3300031691 Ga0316579_10010257 Ga0316579_100102571 126
153 3300031691 Ga0316579_10421589 Ga0316579_104215892 126
154 3300031711 Ga0265314_10545970 Ga0265314_105459701 126
155 3300031712 Ga0265342_10013912 Ga0265342_100139123 126
156 3300031727 Ga0316576_10015714 Ga0316576_100157142 126
157 3300031727 Ga0316576_10052106 Ga0316576_100521063 126
158 3300031727 Ga0316576_10073923 Ga0316576_100739231 126
159 3300031727 Ga0316576_10095350 Ga0316576_100953502 126
160 3300031727 Ga0316576_10097377 Ga0316576_100973772 126
161 3300031727 Ga0316576_10471567 Ga0316576_104715672 126
162 3300031727 Ga0316576_10574402 Ga0316576_105744021 126
163 3300031728 Ga0316578_10006982 Ga0316578_100069821 126
164 3300031728 Ga0316578_10046743 Ga0316578_100467432 126
165 3300031728 Ga0316578_10048903 Ga0316578_100489032 126
166 3300031728 Ga0316578_10063882 Ga0316578_100638822 126
167 3300031728 Ga0316578_10155438 Ga0316578_101554382 126
168 3300031728 Ga0316578_10612325 Ga0316578_106123252 126
169 3300031731 Ga0307405_10218273 Ga0307405_102182732 126
170 3300031731 Ga0307405_10899836 Ga0307405_108998362 126
171 3300031731 Ga0307405_11199971 Ga0307405_111999711 126
172 3300031733 Ga0316577_10041831 Ga0316577_100418312 126
173 3300031733 Ga0316577_10056027 Ga0316577_100560272 126
174 3300031733 Ga0316577_10105052 Ga0316577_101050522 126
175 3300031733 Ga0316577_10119759 Ga0316577_101197591 126
176 3300031733 Ga0316577_10240793 Ga0316577_102407932 126
177 3300031733 Ga0316577_10308004 Ga0316577_103080042 126
178 3300031824 Ga0307413_10528644 Ga0307413_105286442 126
179 3300031852 Ga0307410_11969221 Ga0307410_119692211 126
180 3300031901 Ga0307406_10097370 Ga0307406_100973702 126
181 3300031901 Ga0307406_10958466 Ga0307406_109584662 126
182 3300031901 Ga0307406_11143657 Ga0307406_111436572 126
183 3300031901 Ga0307406_11576677 Ga0307406_115766772 126
184 3300031903 Ga0307407_10831698 Ga0307407_108316982 126
185 3300031903 Ga0307407_10969652 Ga0307407_109696521 126
186 3300031911 Ga0307412_10045313 Ga0307412_100453132 126
187 3300031911 Ga0307412_10443341 Ga0307412_104433412 126
188 3300031995 Ga0307409_102037490 Ga0307409_1020374902 126
189 3300032002 Ga0307416_100108895 Ga0307416_1001088952 126
190 3300032004 Ga0307414_10114624 Ga0307414_101146243 126
191 3300032004 Ga0307414_10284705 Ga0307414_102847052 126
192 3300032004 Ga0307414_10315934 Ga0307414_103159341 126
193 3300032004 Ga0307414_10331840 Ga0307414_103318402 126
194 3300032005 Ga0307411_10082416 Ga0307411_100824162 126
195 3300032005 Ga0307411_10332670 Ga0307411_103326701 126
196 3300032005 Ga0307411_11499991 Ga0307411_114999911 126
197 3300032005 Ga0307411_11912331 Ga0307411_119123311 126
198 3300032133 Ga0316583_10015102 Ga0316583_100151023 126
199 3300032137 Ga0316585_10012867 Ga0316585_100128672 126
200 3300032139 Ga0316580_10001288 Ga0316580_100012885 126
201 3300032139 Ga0316580_10042787 Ga0316580_100427872 126
202 3300032168 Ga0316593_10033247 Ga0316593_100332473 126
203 3300032168 Ga0316593_10093641 Ga0316593_100936412 126
204 3300032168 Ga0316593_10208054 Ga0316593_102080542 126
205 3300032168 Ga0316593_10221656 Ga0316593_102216561 126
206 3300033524 Ga0316592_1001379 Ga0316592_10013794 126
207 3300033524 Ga0316592_1067056 Ga0316592_10670562 126
208 3300033527 Ga0316586_1006652 Ga0316586_10066522 126
209 3300033528 Ga0316588_1001177 Ga0316588_10011772 126
210 3300033528 Ga0316588_1011672 Ga0316588_10116722 126
211 3300033529 Ga0316587_1000828 Ga0316587_10008284 126
212 3300033541 Ga0316596_1002704 Ga0316596_10027044 126
213 3300033541 Ga0316596_1107669 Ga0316596_11076691 126
214 3300035115 Ga0373941_0234156 Ga0373941_0234156_72_455 126
215 3300035117 Ga0373953_0573564 Ga0373953_0573564_42_422 126
216 3300035172 Ga0373955_0182578 Ga0373955_0182578_229_609 126
217 3300035398 Ga0316574_0030404 Ga0316574_0030404_2216_2596 126
218 3300035398 Ga0316574_0042956 Ga0316574_0042956_918_1301 126
219 3300035398 Ga0316574_0115228 Ga0316574_0115228_275_661 126
220 3300035398 Ga0316574_0588133 Ga0316574_0588133_163_558 126
221 3300035398 Ga0316574_0833093 Ga0316574_0833093_72_467 126
222 3300035724 Ga0373933_0084336 Ga0373933_0084336_666_1046 126
223 3300036401 Ga0373937_0125678 Ga0373937_0125678_617_997 126
224 3300036401 Ga0373937_0170629 Ga0373937_0170629_1244_1624 126
225 3300036647 Ga0316582_0058567 Ga0316582_0058567_1637_2023 126
226 3300036647 Ga0316582_0119936 Ga0316582_0119936_1109_1492 126
227 3300036647 Ga0316582_0189346 Ga0316582_0189346_21_416 126
228 3300036647 Ga0316582_0369046 Ga0316582_0369046_343_729 126
229 3300036712 Ga0316584_0040175 Ga0316584_0040175_2347_2742 126
230 3300036712 Ga0316584_0054826 Ga0316584_0054826_1834_2214 126
231 3300036712 Ga0316584_0062589 Ga0316584_0062589_1732_2112 126
232 3300036712 Ga0316584_0092807 Ga0316584_0092807_250_636 126
233 3300036712 Ga0316584_0096006 Ga0316584_0096006_1430_1813 126
234 3300036712 Ga0316584_0153370 Ga0316584_0153370_692_1078 126
235 3300036712 Ga0316584_0238852 Ga0316584_0238852_10_396 126
236 3300036712 Ga0316584_0380608 Ga0316584_0380608_404_919 126
237 3300038725 Ga0400484_08892 Ga0400484_08892_1974_2360 126
238 3300038726 Ga0400490_34574 Ga0400490_34574_1124_1507 126
239 3300038741 Ga0400488_21557 Ga0400488_21557_1150_1536 126
240 3300038741 Ga0400488_58184 Ga0400488_58184_1852_2235 126
241 3300039062 Ga0400483_142109 Ga0400483_142109_343_726 126
242 3300039062 Ga0400483_161552 Ga0400483_161552_916_1299 126
243 3300039110 Ga0400487_02009 Ga0400487_02009_2737_3123 126
244 3300041494 Ga0451837_0500343 Ga0451837_0500343_41_421 126
245 3300041496 Ga0451839_1125110 Ga0451839_1125110_381_761 126
246 3300041498 Ga0451841_0868405 Ga0451841_0868405_286_666 126
247 3300041503 Ga0451847_0630536 Ga0451847_0630536_225_605 126
248 3300041511 Ga0451855_0875701 Ga0451855_0875701_62_442 126
249 3300041512 Ga0451853_0843523 Ga0451853_0843523_105_485 126
250 3300041997 Ga0439431_0087950 Ga0439431_0087950_27_410 126
251 3300042002 Ga0439442_055387 Ga0439442_055387_97_480 126
252 3300042005 Ga0439448_0201913 Ga0439448_0201913_240_623 126
253 3300042131 Ga0450894_030694 Ga0450894_030694_202_585 126
254 3300042137 Ga0450902_076910 Ga0450902_076910_99_482 126
255 3300042144 Ga0450889_011363 Ga0450889_011363_415_798 126
256 3300042437 Ga0439444_0176591 Ga0439444_0176591_120_503 126
257 3300042461 Ga0439460_0087301 Ga0439460_0087301_347_730 126
258 3300042876 Ga0451577_0037730 Ga0451577_0037730_1092_1472 126
259 3300042876 Ga0451577_0069248 Ga0451577_0069248_1022_1402 126
260 3300042876 Ga0451577_0115529 Ga0451577_0115529_1475_1858 126
261 3300042876 Ga0451577_1337022 Ga0451577_1337022_94_474 126
262 3300042993 Ga0439440_0252547 Ga0439440_0252547_18_401 126
263 3300044673 Ga0453683_0060473 Ga0453683_0060473_1062_1442 126
264 3300044712 Ga0453684_0032784 Ga0453684_0032784_4019_4399 126
265 3300044712 Ga0453684_0288584 Ga0453684_0288584_1248_1643 126
266 3300044712 Ga0453684_0446166 Ga0453684_0446166_472_852 126
267 3300044712 Ga0453684_2137575 Ga0453684_2137575_10_390 126
268 3300045051 Ga0451576_0042385 Ga0451576_0042385_2757_3137 126
269 3300045836 Ga0466958_0750734 Ga0466958_0750734_177_560 126
270 3300045976 Ga0466967_0541900 Ga0466967_0541900_131_514 126
271 3300046455 Ga0495603_0113918 Ga0495603_0113918_1029_1421 126
272 3300046455 Ga0495603_0302320 Ga0495603_0302320_102_482 126
273 3300046471 Ga0495650_0002220 Ga0495650_0002220_278_661 126
274 3300046506 Ga0495583_0052079 Ga0495583_0052079_590_973 126
275 3300046537 Ga0495598_0080289 Ga0495598_0080289_281_664 126
276 3300046678 Ga0495599_0370911 Ga0495599_0370911_457_837 126
277 3300046678 Ga0495599_0573804 Ga0495599_0573804_179_559 126
278 3300046809 Ga0495600_0544464 Ga0495600_0544464_85_465 126
279 3300047322 Ga0495680_0364693 Ga0495680_0364693_287_667 126
280 3300048913 Ga0496110_0697203 Ga0496110_0697203_162_545 126
281 3300048917 Ga0496114_0354490 Ga0496114_0354490_716_1099 126
282 3300049569 Ga0501032_0014371 Ga0501032_0014371_1113_1502 126
283 3300049570 Ga0501033_0110818 Ga0501033_0110818_496_885 126
284 3300049571 Ga0501034_0009796 Ga0501034_0009796_8520_8909 126
285 3300049572 Ga0501036_0017888 Ga0501036_0017888_306_695 126
286 3300049572 Ga0501036_0836997 Ga0501036_0836997_345_728 126
287 3300049573 Ga0501037_0004691 Ga0501037_0004691_3197_3586 126
288 3300049574 Ga0501038_0014667 Ga0501038_0014667_2748_3137 126
289 3300049575 Ga0501039_0021305 Ga0501039_0021305_3472_3861 126
290 3300049576 Ga0501040_0001169 Ga0501040_0001169_12133_12519 126
291 3300049576 Ga0501040_0407631 Ga0501040_0407631_255_644 126
292 3300049578 Ga0501042_0002857 Ga0501042_0002857_2660_3046 126
293 3300049578 Ga0501042_0080573 Ga0501042_0080573_337_723 126
294 3300049579 Ga0501043_0014832 Ga0501043_0014832_318_707 126
295 3300049580 Ga0501046_0010597 Ga0501046_0010597_3417_3806 126
296 3300049581 Ga0501047_0010186 Ga0501047_0010186_2748_3137 126
297 3300049582 Ga0501048_0031217 Ga0501048_0031217_404_793 126
298 3300049582 Ga0501048_0165486 Ga0501048_0165486_39_422 126
299 3300049583 Ga0501067_0004019 Ga0501067_0004019_1918_2307 126
300 3300049584 Ga0501068_0008389 Ga0501068_0008389_99_488 126
301 3300049585 Ga0501069_0002128 Ga0501069_0002128_6111_6500 126
302 3300049586 Ga0501070_0013448 Ga0501070_0013448_5397_5786 126
303 3300049587 Ga0501071_0011504 Ga0501071_0011504_2923_3312 126
304 3300049588 Ga0501072_0040890 Ga0501072_0040890_3179_3568 126
305 3300049589 Ga0501073_0142707 Ga0501073_0142707_158_547 126
306 3300049590 Ga0501074_0033576 Ga0501074_0033576_583_972 126
307 3300049592 Ga0501076_0287554 Ga0501076_0287554_97_480 126
308 3300049741 Ga0501079_0010517 Ga0501079_0010517_2339_2728 126
309 3300049743 Ga0501081_0140683 Ga0501081_0140683_1172_1561 126
310 3300049743 Ga0501081_0383176 Ga0501081_0383176_556_939 126
311 3300049744 Ga0501083_0004432 Ga0501083_0004432_3885_4274 126
312 3300049744 Ga0501083_0676648 Ga0501083_0676648_20_403 126
313 3300049822 Ga0501035_0006878 Ga0501035_0006878_6350_6739 126
314 3300049823 Ga0501044_0022643 Ga0501044_0022643_5985_6374 126
315 3300049824 Ga0501045_0013333 Ga0501045_0013333_1010_1399 126
316 3300049824 Ga0501045_0200630 Ga0501045_0200630_903_1286 126
317 3300050507 nmdc:mga05p37_1145_c1 nmdc:mga05p37_1145_c1_7024_7407 126
318 3300050507 nmdc:mga05p37_47281_c2 nmdc:mga05p37_47281_c2_2299_2682 126
319 3300050508 nmdc:mga09592_24683_c1 nmdc:mga09592_24683_c1_1810_2193 126
320 3300050508 nmdc:mga09592_3989_c1 nmdc:mga09592_3989_c1_3770_4153 126
321 3300050509 nmdc:mga0qj67_32854_c1 nmdc:mga0qj67_32854_c1_887_1270 126
322 3300050510 nmdc:mga06r32_2704_c1 nmdc:mga06r32_2704_c1_5824_6207 126
323 3300050510 nmdc:mga06r32_6144_c1 nmdc:mga06r32_6144_c1_2801_3184 126
324 3300050510 nmdc:mga06r32_9158_c1 nmdc:mga06r32_9158_c1_1517_1900 126
325 3300050511 nmdc:mga08y16_1919_c1 nmdc:mga08y16_1919_c1_12735_13118 126
326 3300050511 nmdc:mga08y16_26385_c1 nmdc:mga08y16_26385_c1_3011_3394 126
327 3300050511 nmdc:mga08y16_304232_c1 nmdc:mga08y16_304232_c1_471_854 126
328 3300050512 nmdc:mga0n895_1180043_c1 nmdc:mga0n895_1180043_c1_32_415 126
329 3300050515 nmdc:mga0a205_291061_c1 nmdc:mga0a205_291061_c1_1087_1470 126
330 3300053104 Ga0500556_0000121 Ga0500556_0000121_46179_46562 126
331 3300053156 Ga0500622_0004686 Ga0500622_0004686_7665_8048 126
332 3300054114 Ga0501084_0685327 Ga0501084_0685327_85_474 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

37

155

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k0t-assembly1.cif.gz_B crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. tomato str. dc3000 0.9926 4 126
1xrg-assembly1.cif.gz_C conserved hypothetical protein from clostridium thermocellum cth-2968 0.9906 3 126
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9895 2 126
3r0p-assembly2.cif.gz_C crystal structure of l-psp putative endoribonuclease from uncultured organism 0.9887 2 126
1oni-assembly2.cif.gz_D crystal structure of a human p14.5, a translational inhibitor reveals different mode of ligand binding near the invariant residues of the yjgf/uk114 protein family 0.9865 3 125
ID Description Score Start End Superfamily
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9838 2 125 3.30.1330.40
3k0tB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9824 4 126 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9752 4 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9744 19 126 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9724 2 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A348UNJ8-F1-model_v4 Reactive intermediate/imine deaminase 1.001 4 126 GO:0005829
GO:0019239
AF-A0A1H5VNA2-F1-model_v4 Reactive intermediate/imine deaminase 0.9986 3 125 GO:0005829
GO:0019239
AF-A0A1S0VBZ2-F1-model_v4 deleted 0.9981 2 126
AF-A0A0W0WLD6-F1-model_v4 Endoribonuclease L-PSP 0.9968 3 125 GO:0005829
GO:0019239
AF-A0A358XXB9-F1-model_v4 Reactive intermediate/imine deaminase 0.9965 3 126 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
96.06 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map