F410281

General Info

Members Datasets Scaffolds Average Seq Length
330 187 329 159

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0233970|Ga0501076_0233970_642_1196
Length 184
Sequence MGRGAAARAVVATRRIGASTTDEEDEVMASAVKPVPEGHHTVTPYLAIKNAAKALDFYKRAFGATETYTLMMPDGRVGHAEIRLGDSVIMLSDEFPEYGNKGPDAFGGSPVTLHLYVDDVDAFFGKAVAAGARERKPVTDQFYGDRSGQLEDPFGHLWWVATHKEDVPPGEMQKRVEAMFAGTK

Samples

Sample ID Description Type Environment
1 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
162 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
184 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.21
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 8.79
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10485128 3300005289 Unclassified 678
2 Ga0065712_10115094 3300005290 Bacteria 1757
3 Ga0065715_10090986 3300005293 Archaea 6243
4 Ga0065707_10130117 3300005295 Unclassified 1935
5 Ga0070658_10206480 3300005327 Bacteria 1659
6 Ga0070658_10555597 3300005327 Bacteria 994
7 Ga0070676_10576773 3300005328 Unclassified 808
8 Ga0070683_100388661 3300005329 Bacteria 1330
9 Ga0070683_100888152 3300005329 Bacteria 855
10 Ga0070670_100001608 3300005331 Bacteria 18255
11 Ga0070670_100024790 3300005331 Bacteria 5160
12 Ga0070670_100053557 3300005331 Bacteria 3465
13 Ga0070677_10102468 3300005333 Bacteria 1264
14 Ga0070677_10406504 3300005333 Bacteria 719
15 Ga0070666_10000898 3300005335 Bacteria 18102
16 Ga0070666_10737065 3300005335 Bacteria 724
17 Ga0068868_100358324 3300005338 Bacteria 1251
18 Ga0070660_100591016 3300005339 Bacteria 928
19 Ga0070661_100086721 3300005344 Bacteria 2315
20 Ga0070661_100319272 3300005344 Bacteria 1213
21 Ga0070661_100328598 3300005344 Bacteria 1195
22 Ga0070661_100746186 3300005344 Bacteria 800
23 Ga0070668_100600398 3300005347 Bacteria 963
24 Ga0070675_100002680 3300005354 Bacteria 13382
25 Ga0070675_100066175 3300005354 Bacteria 2989
26 Ga0070675_100242910 3300005354 Bacteria 1574
27 Ga0070671_100002159 3300005355 Bacteria 15168
28 Ga0070671_100002514 3300005355 Bacteria 14204
29 Ga0070671_100005299 3300005355 Bacteria 10286
30 Ga0070674_100015502 3300005356 Bacteria 4758
31 Ga0070673_100010631 3300005364 Bacteria 6239
32 Ga0070673_100010813 3300005364 Bacteria 6198
33 Ga0070673_100125395 3300005364 Bacteria 2148
34 Ga0070659_100034629 3300005366 Bacteria 3928
35 Ga0070659_100177585 3300005366 Bacteria 1746
36 Ga0070667_100003286 3300005367 Bacteria 13811
37 Ga0070667_100012982 3300005367 Bacteria 6889
38 Ga0070709_10206796 3300005434 Bacteria 1393
39 Ga0070709_10446408 3300005434 Unclassified 974
40 Ga0070714_100043257 3300005435 Bacteria 3809
41 Ga0070714_101055813 3300005435 Unclassified 791
42 Ga0070713_100009963 3300005436 Bacteria 6845
43 Ga0070701_10957936 3300005438 Unclassified 594
44 Ga0070700_100552578 3300005441 Archaea 895
45 Ga0070708_100091700 3300005445 Bacteria 2767
46 Ga0070663_100196627 3300005455 Bacteria 1572
47 Ga0070678_100000821 3300005456 Bacteria 15742
48 Ga0070678_100485128 3300005456 Bacteria 1088
49 Ga0070662_100005249 3300005457 Bacteria 8267
50 Ga0070662_100147169 3300005457 Bacteria 1831
51 Ga0070662_100209237 3300005457 Bacteria 1551
52 Ga0068867_100163706 3300005459 Bacteria 1756
53 Ga0068867_100577831 3300005459 Archaea 977
54 Ga0070706_100087106 3300005467 Unclassified 2894
55 Ga0070706_100273138 3300005467 Unclassified 1577
56 Ga0070706_101011967 3300005467 Bacteria 766
57 Ga0070707_100193096 3300005468 Bacteria 1985
58 Ga0070698_100071801 3300005471 Bacteria 3470
59 Ga0070698_100110045 3300005471 Archaea 2721
60 Ga0070698_100820213 3300005471 Bacteria 875
61 Ga0070698_101005044 3300005471 Bacteria 781
62 Ga0070699_100070745 3300005518 Bacteria 3033
63 Ga0070699_101042521 3300005518 Archaea 750
64 Ga0070684_101786900 3300005535 Unclassified 580
65 Ga0070697_100047796 3300005536 Unclassified 3469
66 Ga0070697_100089836 3300005536 Unclassified 2538
67 Ga0070697_101164218 3300005536 Bacteria 687
68 Ga0070697_101325308 3300005536 Archaea 642
69 Ga0070672_100005559 3300005543 Bacteria 8373
70 Ga0070672_100751904 3300005543 Bacteria 856
71 Ga0070665_100029450 3300005548 Bacteria 5527
72 Ga0070664_100066539 3300005564 Bacteria 3078
73 Ga0070664_100209249 3300005564 Bacteria 1743
74 Ga0070664_100242743 3300005564 Bacteria 1617
75 Ga0068857_100026491 3300005577 Bacteria 5111
76 Ga0068854_100908887 3300005578 Bacteria 774
77 Ga0070702_100339979 3300005615 Unclassified 1053
78 Ga0068852_100102284 3300005616 Bacteria 2588
79 Ga0068859_100954459 3300005617 Bacteria 941
80 Ga0068864_100003154 3300005618 Bacteria 13627
81 Ga0068864_100010223 3300005618 Bacteria 7750
82 Ga0068864_100044246 3300005618 Bacteria 3815
83 Ga0068864_100057473 3300005618 Bacteria 3361
84 Ga0068864_100724982 3300005618 Bacteria 973
85 Ga0068851_10093765 3300005834 Bacteria 1585
86 Ga0068851_10204312 3300005834 Bacteria 1104
87 Ga0068863_100034179 3300005841 Bacteria 4843
88 Ga0068863_100572269 3300005841 Bacteria 1117
89 Ga0068858_100001092 3300005842 Bacteria 28091
90 Ga0068858_100445012 3300005842 Bacteria 1248
91 Ga0068860_100958789 3300005843 Bacteria 873
92 Ga0081539_10009382 3300005985 Bacteria 8190
93 Ga0081539_10456073 3300005985 Unclassified 529
94 Ga0070717_10002119 3300006028 Bacteria 13916
95 Ga0070717_10034545 3300006028 Bacteria 4088
96 Ga0070716_100010383 3300006173 Bacteria 4665
97 Ga0097621_100105064 3300006237 Bacteria 2380
98 Ga0068871_101048852 3300006358 Archaea 761
99 Ga0075428_100230604 3300006844 Bacteria 1998
100 Ga0075428_100893922 3300006844 Bacteria 942
101 Ga0075428_101185825 3300006844 Bacteria 805
102 Ga0075430_100017622 3300006846 Bacteria 6082
103 Ga0075430_100116638 3300006846 Unclassified 2225
104 Ga0075431_100003904 3300006847 Bacteria 14511
105 Ga0075433_10332067 3300006852 Bacteria 1344
106 Ga0075433_10337471 3300006852 Unclassified 1332
107 Ga0075429_100003421 3300006880 Bacteria 13533
108 Ga0075429_100103928 3300006880 Unclassified 2481
109 Ga0097620_100954572 3300006931 Bacteria 941
110 Ga0099795_10026350 3300007788 Bacteria 1958
111 Ga0111539_10998646 3300009094 Unclassified 973
112 Ga0114129_10007348 3300009147 Bacteria 15682
113 Ga0114129_10093469 3300009147 Bacteria 4166
114 Ga0114129_10124649 3300009147 Bacteria 3543
115 Ga0114129_10185650 3300009147 Bacteria 2826
116 Ga0105242_10085135 3300009176 Archaea 2651
117 Ga0105242_10664543 3300009176 Archaea 1015
118 Ga0105248_10000269 3300009177 Bacteria 61063
119 Ga0105248_10017544 3300009177 Bacteria 7894
120 Ga0105248_10028157 3300009177 Bacteria 6258
121 Ga0105248_10075580 3300009177 Bacteria 3786
122 Ga0105239_10655885 3300010375 Archaea 1199
123 Ga0105246_10200844 3300011119 Archaea 1550
124 Ga0157373_10131391 3300013100 Bacteria 1761
125 Ga0157374_10003140 3300013296 Bacteria 13883
126 Ga0157378_10244620 3300013297 Archaea 1715
127 Ga0163162_10305766 3300013306 Bacteria 1722
128 Ga0163162_10806952 3300013306 Archaea 1056
129 Ga0163162_10910008 3300013306 Bacteria 992
130 Ga0157375_10015586 3300013308 Bacteria 6807
131 Ga0157375_10174430 3300013308 Bacteria 2299
132 Ga0157375_11103236 3300013308 Archaea 929
133 Ga0163163_10000903 3300014325 Bacteria 25169
134 Ga0163163_10893483 3300014325 Bacteria 952
135 Ga0163163_11381464 3300014325 Archaea 766
136 Ga0157377_10716076 3300014745 Archaea 728
137 Ga0157377_10737389 3300014745 Bacteria 719
138 Ga0206350_11540781 3300020080 Bacteria 896
139 Ga0224712_10329793 3300022467 Bacteria 718
140 Ga0207697_10057912 3300025315 Bacteria 1609
141 Ga0207697_10097490 3300025315 Bacteria 1251
142 Ga0207697_10418203 3300025315 Bacteria 595
143 Ga0207656_10302352 3300025321 Bacteria 792
144 Ga0207682_10298253 3300025893 Bacteria 755
145 Ga0207680_10022349 3300025903 Bacteria 3438
146 Ga0207680_10134791 3300025903 Bacteria 1631
147 Ga0207647_10435725 3300025904 Archaea 736
148 Ga0207699_10258528 3300025906 Bacteria 1203
149 Ga0207705_10019819 3300025909 Bacteria 4810
150 Ga0207684_10135407 3300025910 Bacteria 2115
151 Ga0207684_10231008 3300025910 Unclassified 1596
152 Ga0207684_10609486 3300025910 Unclassified 932
153 Ga0207657_10353374 3300025919 Bacteria 1159
154 Ga0207649_10727134 3300025920 Bacteria 771
155 Ga0207649_10963255 3300025920 Bacteria 670
156 Ga0207646_10120539 3300025922 Bacteria 2356
157 Ga0207646_10390034 3300025922 Unclassified 1258
158 Ga0207650_10014804 3300025925 Bacteria 5424
159 Ga0207650_10045047 3300025925 Bacteria 3245
160 Ga0207650_10075835 3300025925 Bacteria 2539
161 Ga0207659_10002913 3300025926 Bacteria 10190
162 Ga0207659_10160483 3300025926 Bacteria 1764
163 Ga0207659_10375389 3300025926 Bacteria 1185
164 Ga0207700_10072832 3300025928 Bacteria 2651
165 Ga0207664_10201511 3300025929 Bacteria 1718
166 Ga0207644_10000425 3300025931 Bacteria 27368
167 Ga0207644_10009529 3300025931 Bacteria 6378
168 Ga0207644_10181800 3300025931 Bacteria 1648
169 Ga0207690_10061755 3300025932 Bacteria 2549
170 Ga0207690_10085177 3300025932 Bacteria 2218
171 Ga0207706_10004122 3300025933 Bacteria 13712
172 Ga0207706_10285666 3300025933 Bacteria 1439
173 Ga0207706_10327590 3300025933 Bacteria 1333
174 Ga0207706_10554199 3300025933 Bacteria 989
175 Ga0207665_10100121 3300025939 Bacteria 2022
176 Ga0207665_10371038 3300025939 Unclassified 1084
177 Ga0207691_10014418 3300025940 Bacteria 7538
178 Ga0207691_10059566 3300025940 Bacteria 3471
179 Ga0207711_10000122 3300025941 Bacteria 81465
180 Ga0207711_10006525 3300025941 Bacteria 9823
181 Ga0207711_10095874 3300025941 Bacteria 2617
182 Ga0207661_11432287 3300025944 Bacteria 634
183 Ga0207679_10195849 3300025945 Bacteria 1684
184 Ga0207679_10314767 3300025945 Bacteria 1353
185 Ga0207651_10086827 3300025960 Bacteria 2275
186 Ga0207658_10127849 3300025986 Bacteria 2036
187 Ga0207658_10547499 3300025986 Bacteria 1035
188 Ga0207677_10425994 3300026023 Bacteria 1131
189 Ga0207703_10030405 3300026035 Bacteria 4268
190 Ga0207703_11467172 3300026035 Bacteria 656
191 Ga0207678_10081544 3300026067 Bacteria 2769
192 Ga0207708_10543758 3300026075 Archaea 979
193 Ga0207641_10026291 3300026088 Bacteria 4803
194 Ga0207641_10123568 3300026088 Bacteria 2313
195 Ga0207648_10324898 3300026089 Bacteria 1383
196 Ga0207676_10008045 3300026095 Bacteria 7497
197 Ga0207676_10019364 3300026095 Bacteria 4964
198 Ga0207676_10021889 3300026095 Bacteria 4695
199 Ga0207676_10099060 3300026095 Bacteria 2411
200 Ga0207676_10815577 3300026095 Bacteria 911
201 Ga0207674_10035202 3300026116 Bacteria 5227
202 Ga0207683_10009993 3300026121 Bacteria 8098
203 Ga0207683_10425391 3300026121 Bacteria 1223
204 Ga0207683_10564861 3300026121 Archaea 1052
205 Ga0207698_10104924 3300026142 Bacteria 2353
206 Ga0209971_1066863 3300027682 Archaea 871
207 Ga0209974_10250681 3300027876 Bacteria 666
208 Ga0268264_10931191 3300028381 Bacteria 873
209 Ga0265760_10054639 3300031090 Bacteria 1206
210 Ga0265760_10233369 3300031090 Unclassified 631
211 Ga0307405_10225059 3300031731 Bacteria 1379
212 Ga0307405_10256627 3300031731 Bacteria 1303
213 Ga0307413_10080438 3300031824 Bacteria 2086
214 Ga0307407_11069437 3300031903 Bacteria 626
215 Ga0307412_10167979 3300031911 Bacteria 1638
216 Ga0307409_100058613 3300031995 Bacteria 2992
217 Ga0307409_100296773 3300031995 Bacteria 1501
218 Ga0307409_100984264 3300031995 Unclassified 861
219 Ga0307416_100116452 3300032002 Bacteria 2369
220 Ga0307415_100320119 3300032126 Bacteria 1293
221 Ga0373961_0001266 3300035241 Archaea 7693
222 Ga0373935_0823706 3300035692 Bacteria 686
223 Ga0373937_1157962 3300036401 Bacteria 722
224 Ga0395899_0130536 3300037312 Bacteria 1794
225 Ga0395899_0302520 3300037312 Bacteria 1082
226 Ga0395900_0121363 3300037418 Bacteria 2681
227 Ga0395900_0215996 3300037418 Bacteria 1935
228 Ga0395900_0514742 3300037418 Bacteria 1145
229 Ga0395905_0005799 3300037471 Bacteria 12544
230 Ga0395905_0026518 3300037471 Bacteria 5463
231 Ga0395905_0129228 3300037471 Bacteria 2376
232 Ga0395905_0157589 3300037471 Bacteria 2135
233 Ga0395905_0161244 3300037471 Bacteria 2107
234 Ga0395905_0228872 3300037471 Bacteria 1739
235 Ga0436364_0707532 3300037853 Bacteria 1434
236 Ga0395901_0642177 3300038443 Bacteria 1066
237 Ga0395901_0980151 3300038443 Bacteria 822
238 Ga0242420_055040 3300038996 Bacteria 784
239 Ga0439432_065292 3300042006 Bacteria 1116
240 Ga0466964_0437062 3300044706 Bacteria 691
241 Ga0466967_0008200 3300045976 Bacteria 7629
242 Ga0466967_0137944 3300045976 Bacteria 2269
243 Ga0466967_0560358 3300045976 Bacteria 1125
244 Ga0495629_0241506 3300046459 Bacteria 1244
245 Ga0495580_0120363 3300046472 Bacteria 1823
246 Ga0495585_0076559 3300046492 Bacteria 1817
247 Ga0495644_0187836 3300046523 Bacteria 795
248 Ga0495663_0001007 3300046525 Bacteria 9325
249 Ga0495663_0178682 3300046525 Bacteria 734
250 Ga0495642_0373996 3300046528 Bacteria 627
251 Ga0495598_0000300 3300046537 Bacteria 8890
252 Ga0495621_0005399 3300046539 Bacteria 3671
253 Ga0495633_0006030 3300046558 Bacteria 7270
254 Ga0495659_0299541 3300046664 Bacteria 679
255 Ga0495661_0028885 3300046665 Bacteria 3545
256 Ga0495670_0002214 3300046691 Bacteria 9609
257 Ga0495677_0010062 3300047445 Bacteria 3481
258 Ga0495677_0090768 3300047445 Bacteria 1151
259 Ga0496100_0025228 3300048903 Bacteria 3634
260 Ga0496101_0008590 3300048904 Bacteria 6676
261 Ga0496101_0411696 3300048904 Bacteria 1065
262 Ga0496102_0344749 3300048905 Bacteria 1403
263 Ga0496105_0419392 3300048908 Bacteria 1060
264 Ga0496106_0001364 3300048909 Bacteria 18291
265 Ga0496106_0284012 3300048909 Bacteria 1326
266 Ga0496106_0439237 3300048909 Archaea 1049
267 Ga0496107_0001881 3300048910 Bacteria 13284
268 Ga0496107_0338072 3300048910 Bacteria 1120
269 Ga0496108_0014599 3300048911 Bacteria 6411
270 Ga0496108_0173091 3300048911 Bacteria 1868
271 Ga0496108_0198141 3300048911 Bacteria 1742
272 Ga0496108_0271548 3300048911 Bacteria 1476
273 Ga0496109_0000659 3300048912 Bacteria 28619
274 Ga0496109_0017334 3300048912 Bacteria 6311
275 Ga0496109_0049271 3300048912 Bacteria 3834
276 Ga0496110_0003992 3300048913 Bacteria 11361
277 Ga0496110_0194536 3300048913 Bacteria 1841
278 Ga0496111_0025865 3300048914 Bacteria 4141
279 Ga0496111_0041989 3300048914 Bacteria 3283
280 Ga0496111_0092584 3300048914 Bacteria 2216
281 Ga0496111_0134440 3300048914 Bacteria 1831
282 Ga0496112_0001821 3300048915 Bacteria 16758
283 Ga0496112_0010868 3300048915 Bacteria 8284
284 Ga0496112_0043472 3300048915 Bacteria 4399
285 Ga0496113_0029770 3300048916 Bacteria 3946
286 Ga0496113_0102681 3300048916 Bacteria 2217
287 Ga0496113_0112213 3300048916 Bacteria 2123
288 Ga0496126_0000018 3300048929 Bacteria 581170
289 Ga0501299_134645 3300049522 Unclassified 609
290 Ga0501039_0314535 3300049575 Unclassified 1231
291 Ga0501047_0134146 3300049581 Bacteria 2356
292 Ga0501047_0221795 3300049581 Bacteria 1747
293 Ga0501048_0383878 3300049582 Bacteria 1003
294 Ga0501067_0064644 3300049583 Bacteria 2025
295 Ga0501067_0071261 3300049583 Bacteria 1925
296 Ga0501069_0105140 3300049585 Bacteria 1604
297 Ga0501071_0693786 3300049587 Bacteria 784
298 Ga0501071_0732311 3300049587 Bacteria 762
299 Ga0501072_0107589 3300049588 Bacteria 2218
300 Ga0501073_0133713 3300049589 Bacteria 1719
301 Ga0501075_0646815 3300049591 Unclassified 806
302 Ga0501076_0233970 3300049592 Bacteria 1502
303 Ga0501076_0927419 3300049592 Unclassified 718
304 Ga0501249_046757 3300049679 Bacteria 989
305 Ga0501079_0940851 3300049741 Unclassified 680
306 Ga0501080_0151806 3300049742 Bacteria 2141
307 Ga0501080_0403801 3300049742 Bacteria 1229
308 Ga0501081_0564661 3300049743 Bacteria 850
309 Ga0501081_1144365 3300049743 Unclassified 589
310 Ga0501083_0028997 3300049744 Bacteria 3811
311 Ga0501044_0478124 3300049823 Bacteria 1149
312 nmdc:mga05p37_40943_c1 3300050507 Bacteria 5689
313 nmdc:mga05p37_70842_c1 3300050507 Bacteria 4288
314 nmdc:mga05p37_7909_c1 3300050507 Bacteria 12550
315 nmdc:mga09592_28864_c1 3300050508 Bacteria 4612
316 nmdc:mga09592_94946_c1 3300050508 Unclassified 2550
317 nmdc:mga0qj67_11773_c1 3300050509 Bacteria 6566
318 nmdc:mga0qj67_33423_c1 3300050509 Bacteria 4013
319 nmdc:mga06r32_39200_c1 3300050510 Bacteria 4495
320 nmdc:mga06r32_49020_c1 3300050510 Bacteria 4039
321 nmdc:mga0n895_1065192_c1 3300050512 Bacteria 787
322 Ga0500595_011705 3300053119 Bacteria 3419
323 Ga0501084_0093200 3300054114 Bacteria 2529
324 Ga0501084_0130236 3300054114 Unclassified 2118
325 Ga0501084_0442295 3300054114 Bacteria 1099
326 Ga0501082_0355048 3300060353 Unclassified 1278
327 Ga0501082_0463046 3300060353 Bacteria 1108
328 Ga0501082_0764786 3300060353 Bacteria 845
329 Ga0530510_0065665 3300061734 Unclassified 2629

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005471 Ga0070698_101005044 Ga0070698_1010050442 126
2 3300005438 Ga0070701_10957936 Ga0070701_109579361 128
3 3300010375 Ga0105239_10655885 Ga0105239_106558851 132
4 3300014745 Ga0157377_10716076 Ga0157377_107160761 132
5 3300026075 Ga0207708_10543758 Ga0207708_105437581 134
6 3300037853 Ga0436364_0707532 Ga0436364_0707532_236_676 142
7 3300050512 nmdc:mga0n895_1065192_c1 nmdc:mga0n895_1065192_c1_158_661 142
8 3300006844 Ga0075428_100230604 Ga0075428_1002306041 144
9 3300006846 Ga0075430_100116638 Ga0075430_1001166383 144
10 3300006847 Ga0075431_100003904 Ga0075431_1000039042 144
11 3300006880 Ga0075429_100103928 Ga0075429_1001039282 144
12 3300009147 Ga0114129_10007348 Ga0114129_100073485 144
13 3300026023 Ga0207677_10425994 Ga0207677_104259941 144
14 3300050507 nmdc:mga05p37_7909_c1 nmdc:mga05p37_7909_c1_10397_10870 144
15 3300050508 nmdc:mga09592_94946_c1 nmdc:mga09592_94946_c1_1528_2001 144
16 3300050509 nmdc:mga0qj67_11773_c1 nmdc:mga0qj67_11773_c1_4933_5406 144
17 3300050510 nmdc:mga06r32_39200_c1 nmdc:mga06r32_39200_c1_2245_2718 144
18 3300006844 Ga0075428_101185825 Ga0075428_1011858251 146
19 3300031090 Ga0265760_10054639 Ga0265760_100546392 146
20 3300025315 Ga0207697_10418203 Ga0207697_104182031 147
21 3300031090 Ga0265760_10233369 Ga0265760_102333691 147
22 3300006852 Ga0075433_10332067 Ga0075433_103320673 148
23 3300025920 Ga0207649_10727134 Ga0207649_107271342 149
24 3300048929 Ga0496126_0000018 Ga0496126_0000018_38695_39168 150
25 3300049743 Ga0501081_1144365 Ga0501081_1144365_11_472 150
26 3300005536 Ga0070697_100047796 Ga0070697_1000477965 152
27 3300007788 Ga0099795_10026350 Ga0099795_100263502 152
28 3300009147 Ga0114129_10185650 Ga0114129_101856501 152
29 3300025910 Ga0207684_10609486 Ga0207684_106094862 152
30 3300045976 Ga0466967_0137944 Ga0466967_0137944_882_1358 152
31 3300045976 Ga0466967_0560358 Ga0466967_0560358_544_1020 152
32 iso_pu_bacteria 2883354860 2883359645 152
33 3300005467 Ga0070706_101011967 Ga0070706_1010119671 153
34 3300006844 Ga0075428_100893922 Ga0075428_1008939222 153
35 3300006846 Ga0075430_100017622 Ga0075430_1000176225 153
36 3300006880 Ga0075429_100003421 Ga0075429_10000342114 153
37 3300009147 Ga0114129_10124649 Ga0114129_101246492 153
38 3300027682 Ga0209971_1066863 Ga0209971_10668631 153
39 3300027876 Ga0209974_10250681 Ga0209974_102506812 153
40 3300049575 Ga0501039_0314535 Ga0501039_0314535_135_605 153
41 3300049587 Ga0501071_0732311 Ga0501071_0732311_196_666 153
42 3300049588 Ga0501072_0107589 Ga0501072_0107589_404_874 153
43 3300049591 Ga0501075_0646815 Ga0501075_0646815_104_574 153
44 3300049592 Ga0501076_0927419 Ga0501076_0927419_172_642 153
45 3300049741 Ga0501079_0940851 Ga0501079_0940851_173_643 153
46 3300050507 nmdc:mga05p37_40943_c1 nmdc:mga05p37_40943_c1_4767_5237 153
47 3300050508 nmdc:mga09592_28864_c1 nmdc:mga09592_28864_c1_2206_2676 153
48 3300050509 nmdc:mga0qj67_33423_c1 nmdc:mga0qj67_33423_c1_963_1433 153
49 3300050510 nmdc:mga06r32_49020_c1 nmdc:mga06r32_49020_c1_1540_2010 153
50 3300054114 Ga0501084_0130236 Ga0501084_0130236_95_565 153
51 3300060353 Ga0501082_0355048 Ga0501082_0355048_239_709 153
52 3300061734 Ga0530510_0065665 Ga0530510_0065665_1760_2233 153
53 3300005290 Ga0065712_10115094 Ga0065712_101150942 154
54 3300005327 Ga0070658_10555597 Ga0070658_105555971 154
55 3300005328 Ga0070676_10576773 Ga0070676_105767731 154
56 3300005329 Ga0070683_100388661 Ga0070683_1003886612 154
57 3300005329 Ga0070683_100888152 Ga0070683_1008881521 154
58 3300005331 Ga0070670_100001608 Ga0070670_10000160816 154
59 3300005331 Ga0070670_100024790 Ga0070670_1000247906 154
60 3300005331 Ga0070670_100053557 Ga0070670_1000535573 154
61 3300005333 Ga0070677_10102468 Ga0070677_101024682 154
62 3300005333 Ga0070677_10406504 Ga0070677_104065041 154
63 3300005335 Ga0070666_10000898 Ga0070666_100008982 154
64 3300005335 Ga0070666_10737065 Ga0070666_107370651 154
65 3300005338 Ga0068868_100358324 Ga0068868_1003583242 154
66 3300005344 Ga0070661_100086721 Ga0070661_1000867212 154
67 3300005344 Ga0070661_100319272 Ga0070661_1003192722 154
68 3300005344 Ga0070661_100328598 Ga0070661_1003285982 154
69 3300005344 Ga0070661_100746186 Ga0070661_1007461861 154
70 3300005347 Ga0070668_100600398 Ga0070668_1006003981 154
71 3300005354 Ga0070675_100002680 Ga0070675_10000268010 154
72 3300005354 Ga0070675_100066175 Ga0070675_1000661752 154
73 3300005354 Ga0070675_100242910 Ga0070675_1002429103 154
74 3300005355 Ga0070671_100002159 Ga0070671_1000021592 154
75 3300005355 Ga0070671_100002514 Ga0070671_1000025149 154
76 3300005355 Ga0070671_100005299 Ga0070671_10000529911 154
77 3300005356 Ga0070674_100015502 Ga0070674_1000155022 154
78 3300005364 Ga0070673_100010631 Ga0070673_1000106312 154
79 3300005364 Ga0070673_100010813 Ga0070673_1000108132 154
80 3300005364 Ga0070673_100125395 Ga0070673_1001253952 154
81 3300005366 Ga0070659_100034629 Ga0070659_1000346292 154
82 3300005366 Ga0070659_100177585 Ga0070659_1001775851 154
83 3300005367 Ga0070667_100003286 Ga0070667_1000032862 154
84 3300005367 Ga0070667_100012982 Ga0070667_1000129822 154
85 3300005434 Ga0070709_10206796 Ga0070709_102067961 154
86 3300005435 Ga0070714_100043257 Ga0070714_1000432572 154
87 3300005436 Ga0070713_100009963 Ga0070713_1000099635 154
88 3300005455 Ga0070663_100196627 Ga0070663_1001966272 154
89 3300005456 Ga0070678_100000821 Ga0070678_10000082117 154
90 3300005456 Ga0070678_100485128 Ga0070678_1004851282 154
91 3300005457 Ga0070662_100005249 Ga0070662_10000524910 154
92 3300005457 Ga0070662_100147169 Ga0070662_1001471692 154
93 3300005457 Ga0070662_100209237 Ga0070662_1002092373 154
94 3300005459 Ga0068867_100163706 Ga0068867_1001637062 154
95 3300005535 Ga0070684_101786900 Ga0070684_1017869001 154
96 3300005536 Ga0070697_101164218 Ga0070697_1011642181 154
97 3300005543 Ga0070672_100005559 Ga0070672_1000055592 154
98 3300005543 Ga0070672_100751904 Ga0070672_1007519042 154
99 3300005548 Ga0070665_100029450 Ga0070665_1000294502 154
100 3300005564 Ga0070664_100066539 Ga0070664_1000665392 154
101 3300005564 Ga0070664_100209249 Ga0070664_1002092492 154
102 3300005564 Ga0070664_100242743 Ga0070664_1002427432 154
103 3300005577 Ga0068857_100026491 Ga0068857_1000264912 154
104 3300005578 Ga0068854_100908887 Ga0068854_1009088872 154
105 3300005615 Ga0070702_100339979 Ga0070702_1003399792 154
106 3300005616 Ga0068852_100102284 Ga0068852_1001022842 154
107 3300005617 Ga0068859_100954459 Ga0068859_1009544592 154
108 3300005618 Ga0068864_100003154 Ga0068864_10000315412 154
109 3300005618 Ga0068864_100010223 Ga0068864_1000102239 154
110 3300005618 Ga0068864_100044246 Ga0068864_1000442466 154
111 3300005618 Ga0068864_100057473 Ga0068864_1000574735 154
112 3300005618 Ga0068864_100724982 Ga0068864_1007249822 154
113 3300005834 Ga0068851_10093765 Ga0068851_100937652 154
114 3300005834 Ga0068851_10204312 Ga0068851_102043122 154
115 3300005841 Ga0068863_100034179 Ga0068863_1000341795 154
116 3300005841 Ga0068863_100572269 Ga0068863_1005722692 154
117 3300005842 Ga0068858_100001092 Ga0068858_1000010922 154
118 3300005842 Ga0068858_100445012 Ga0068858_1004450122 154
119 3300005843 Ga0068860_100958789 Ga0068860_1009587892 154
120 3300006028 Ga0070717_10002119 Ga0070717_1000211914 154
121 3300006173 Ga0070716_100010383 Ga0070716_1000103831 154
122 3300006237 Ga0097621_100105064 Ga0097621_1001050641 154
123 3300006852 Ga0075433_10337471 Ga0075433_103374713 154
124 3300006931 Ga0097620_100954572 Ga0097620_1009545722 154
125 3300009147 Ga0114129_10093469 Ga0114129_100934692 154
126 3300009177 Ga0105248_10000269 Ga0105248_1000026939 154
127 3300009177 Ga0105248_10017544 Ga0105248_100175448 154
128 3300009177 Ga0105248_10075580 Ga0105248_100755802 154
129 3300013100 Ga0157373_10131391 Ga0157373_101313912 154
130 3300013296 Ga0157374_10003140 Ga0157374_100031407 154
131 3300013306 Ga0163162_10305766 Ga0163162_103057663 154
132 3300013308 Ga0157375_10015586 Ga0157375_100155862 154
133 3300014325 Ga0163163_10000903 Ga0163163_1000090316 154
134 3300014325 Ga0163163_10893483 Ga0163163_108934831 154
135 3300014745 Ga0157377_10737389 Ga0157377_107373891 154
136 3300025315 Ga0207697_10057912 Ga0207697_100579121 154
137 3300025315 Ga0207697_10097490 Ga0207697_100974901 154
138 3300025321 Ga0207656_10302352 Ga0207656_103023521 154
139 3300025893 Ga0207682_10298253 Ga0207682_102982531 154
140 3300025903 Ga0207680_10022349 Ga0207680_100223495 154
141 3300025903 Ga0207680_10134791 Ga0207680_101347912 154
142 3300025906 Ga0207699_10258528 Ga0207699_102585282 154
143 3300025909 Ga0207705_10019819 Ga0207705_100198192 154
144 3300025919 Ga0207657_10353374 Ga0207657_103533742 154
145 3300025920 Ga0207649_10963255 Ga0207649_109632551 154
146 3300025925 Ga0207650_10014804 Ga0207650_100148042 154
147 3300025925 Ga0207650_10045047 Ga0207650_100450472 154
148 3300025925 Ga0207650_10075835 Ga0207650_100758352 154
149 3300025926 Ga0207659_10002913 Ga0207659_100029132 154
150 3300025926 Ga0207659_10160483 Ga0207659_101604832 154
151 3300025926 Ga0207659_10375389 Ga0207659_103753892 154
152 3300025928 Ga0207700_10072832 Ga0207700_100728322 154
153 3300025929 Ga0207664_10201511 Ga0207664_102015111 154
154 3300025931 Ga0207644_10000425 Ga0207644_1000042526 154
155 3300025931 Ga0207644_10009529 Ga0207644_100095293 154
156 3300025931 Ga0207644_10181800 Ga0207644_101818002 154
157 3300025932 Ga0207690_10061755 Ga0207690_100617552 154
158 3300025932 Ga0207690_10085177 Ga0207690_100851772 154
159 3300025933 Ga0207706_10004122 Ga0207706_100041226 154
160 3300025933 Ga0207706_10285666 Ga0207706_102856662 154
161 3300025933 Ga0207706_10327590 Ga0207706_103275902 154
162 3300025933 Ga0207706_10554199 Ga0207706_105541991 154
163 3300025939 Ga0207665_10100121 Ga0207665_101001211 154
164 3300025940 Ga0207691_10014418 Ga0207691_100144182 154
165 3300025940 Ga0207691_10059566 Ga0207691_100595662 154
166 3300025941 Ga0207711_10000122 Ga0207711_1000012233 154
167 3300025941 Ga0207711_10006525 Ga0207711_100065252 154
168 3300025941 Ga0207711_10095874 Ga0207711_100958742 154
169 3300025944 Ga0207661_11432287 Ga0207661_114322871 154
170 3300025945 Ga0207679_10195849 Ga0207679_101958492 154
171 3300025945 Ga0207679_10314767 Ga0207679_103147671 154
172 3300025960 Ga0207651_10086827 Ga0207651_100868272 154
173 3300025986 Ga0207658_10127849 Ga0207658_101278492 154
174 3300025986 Ga0207658_10547499 Ga0207658_105474991 154
175 3300026035 Ga0207703_10030405 Ga0207703_100304055 154
176 3300026035 Ga0207703_11467172 Ga0207703_114671721 154
177 3300026067 Ga0207678_10081544 Ga0207678_100815442 154
178 3300026088 Ga0207641_10026291 Ga0207641_100262912 154
179 3300026088 Ga0207641_10123568 Ga0207641_101235682 154
180 3300026089 Ga0207648_10324898 Ga0207648_103248982 154
181 3300026095 Ga0207676_10008045 Ga0207676_100080452 154
182 3300026095 Ga0207676_10019364 Ga0207676_100193647 154
183 3300026095 Ga0207676_10021889 Ga0207676_100218893 154
184 3300026095 Ga0207676_10099060 Ga0207676_100990602 154
185 3300026095 Ga0207676_10815577 Ga0207676_108155772 154
186 3300026116 Ga0207674_10035202 Ga0207674_100352025 154
187 3300026121 Ga0207683_10009993 Ga0207683_100099935 154
188 3300026121 Ga0207683_10425391 Ga0207683_104253912 154
189 3300026142 Ga0207698_10104924 Ga0207698_101049242 154
190 3300028381 Ga0268264_10931191 Ga0268264_109311911 154
191 3300031731 Ga0307405_10225059 Ga0307405_102250592 154
192 3300031731 Ga0307405_10256627 Ga0307405_102566272 154
193 3300031824 Ga0307413_10080438 Ga0307413_100804382 154
194 3300031911 Ga0307412_10167979 Ga0307412_101679792 154
195 3300031995 Ga0307409_100058613 Ga0307409_1000586131 154
196 3300031995 Ga0307409_100296773 Ga0307409_1002967734 154
197 3300031995 Ga0307409_100984264 Ga0307409_1009842642 154
198 3300032002 Ga0307416_100116452 Ga0307416_1001164522 154
199 3300036401 Ga0373937_1157962 Ga0373937_1157962_19_501 154
200 3300037312 Ga0395899_0130536 Ga0395899_0130536_852_1334 154
201 3300037312 Ga0395899_0302520 Ga0395899_0302520_190_672 154
202 3300037418 Ga0395900_0215996 Ga0395900_0215996_792_1274 154
203 3300037418 Ga0395900_0514742 Ga0395900_0514742_310_786 154
204 3300037471 Ga0395905_0026518 Ga0395905_0026518_126_608 154
205 3300037471 Ga0395905_0129228 Ga0395905_0129228_945_1427 154
206 3300037471 Ga0395905_0157589 Ga0395905_0157589_497_979 154
207 3300037471 Ga0395905_0161244 Ga0395905_0161244_1059_1541 154
208 3300037471 Ga0395905_0228872 Ga0395905_0228872_808_1284 154
209 3300038443 Ga0395901_0642177 Ga0395901_0642177_521_1003 154
210 3300038443 Ga0395901_0980151 Ga0395901_0980151_115_597 154
211 3300038996 Ga0242420_055040 Ga0242420_055040_37_510 154
212 3300046459 Ga0495629_0241506 Ga0495629_0241506_295_777 154
213 3300046472 Ga0495580_0120363 Ga0495580_0120363_659_1141 154
214 3300046492 Ga0495585_0076559 Ga0495585_0076559_299_775 154
215 3300046523 Ga0495644_0187836 Ga0495644_0187836_270_746 154
216 3300046525 Ga0495663_0001007 Ga0495663_0001007_7911_8387 154
217 3300046525 Ga0495663_0178682 Ga0495663_0178682_237_719 154
218 3300046528 Ga0495642_0373996 Ga0495642_0373996_80_556 154
219 3300046537 Ga0495598_0000300 Ga0495598_0000300_3535_4011 154
220 3300046539 Ga0495621_0005399 Ga0495621_0005399_1884_2360 154
221 3300046558 Ga0495633_0006030 Ga0495633_0006030_5161_5637 154
222 3300046664 Ga0495659_0299541 Ga0495659_0299541_41_517 154
223 3300046665 Ga0495661_0028885 Ga0495661_0028885_2879_3355 154
224 3300046691 Ga0495670_0002214 Ga0495670_0002214_7607_8083 154
225 3300047445 Ga0495677_0010062 Ga0495677_0010062_865_1341 154
226 3300047445 Ga0495677_0090768 Ga0495677_0090768_222_704 154
227 3300048903 Ga0496100_0025228 Ga0496100_0025228_115_597 154
228 3300048904 Ga0496101_0008590 Ga0496101_0008590_5616_6098 154
229 3300048904 Ga0496101_0411696 Ga0496101_0411696_146_628 154
230 3300048905 Ga0496102_0344749 Ga0496102_0344749_464_946 154
231 3300048908 Ga0496105_0419392 Ga0496105_0419392_71_553 154
232 3300048909 Ga0496106_0001364 Ga0496106_0001364_17069_17551 154
233 3300048909 Ga0496106_0284012 Ga0496106_0284012_574_1056 154
234 3300048910 Ga0496107_0001881 Ga0496107_0001881_8212_8694 154
235 3300048911 Ga0496108_0014599 Ga0496108_0014599_5506_5988 154
236 3300048911 Ga0496108_0173091 Ga0496108_0173091_379_861 154
237 3300048911 Ga0496108_0198141 Ga0496108_0198141_476_958 154
238 3300048912 Ga0496109_0000659 Ga0496109_0000659_24750_25232 154
239 3300048912 Ga0496109_0017334 Ga0496109_0017334_468_950 154
240 3300048912 Ga0496109_0049271 Ga0496109_0049271_3018_3500 154
241 3300048913 Ga0496110_0194536 Ga0496110_0194536_445_927 154
242 3300048914 Ga0496111_0025865 Ga0496111_0025865_3171_3653 154
243 3300048914 Ga0496111_0092584 Ga0496111_0092584_525_1007 154
244 3300048914 Ga0496111_0134440 Ga0496111_0134440_1076_1558 154
245 3300048915 Ga0496112_0001821 Ga0496112_0001821_11153_11635 154
246 3300048915 Ga0496112_0010868 Ga0496112_0010868_4857_5339 154
247 3300048915 Ga0496112_0043472 Ga0496112_0043472_1460_1942 154
248 3300048916 Ga0496113_0029770 Ga0496113_0029770_2543_3025 154
249 3300048916 Ga0496113_0102681 Ga0496113_0102681_1226_1708 154
250 3300048916 Ga0496113_0112213 Ga0496113_0112213_1161_1643 154
251 3300049582 Ga0501048_0383878 Ga0501048_0383878_423_896 154
252 3300049583 Ga0501067_0064644 Ga0501067_0064644_1424_1897 154
253 3300049585 Ga0501069_0105140 Ga0501069_0105140_1013_1486 154
254 3300049587 Ga0501071_0693786 Ga0501071_0693786_299_772 154
255 3300049592 Ga0501076_0233970 Ga0501076_0233970_642_1196 154
256 3300049679 Ga0501249_046757 Ga0501249_046757_405_881 154
257 3300049743 Ga0501081_0564661 Ga0501081_0564661_33_506 154
258 3300050507 nmdc:mga05p37_70842_c1 nmdc:mga05p37_70842_c1_2081_2554 154
259 3300054114 Ga0501084_0093200 Ga0501084_0093200_1207_1761 154
260 3300054114 Ga0501084_0442295 Ga0501084_0442295_321_794 154
261 3300060353 Ga0501082_0463046 Ga0501082_0463046_261_755 154
262 3300022467 Ga0224712_10329793 Ga0224712_103297932 155
263 3300031903 Ga0307407_11069437 Ga0307407_110694371 155
264 3300042006 Ga0439432_065292 Ga0439432_065292_214_705 155
265 3300049581 Ga0501047_0134146 Ga0501047_0134146_1769_2245 155
266 3300049742 Ga0501080_0151806 Ga0501080_0151806_612_1088 155
267 3300049823 Ga0501044_0478124 Ga0501044_0478124_363_839 155
268 3300053119 Ga0500595_011705 Ga0500595_011705_735_1211 155
269 3300005434 Ga0070709_10446408 Ga0070709_104464081 156
270 3300005435 Ga0070714_101055813 Ga0070714_1010558131 156
271 3300005445 Ga0070708_100091700 Ga0070708_1000917002 156
272 3300005467 Ga0070706_100087106 Ga0070706_1000871062 156
273 3300005467 Ga0070706_100273138 Ga0070706_1002731382 156
274 3300005468 Ga0070707_100193096 Ga0070707_1001930962 156
275 3300005471 Ga0070698_100071801 Ga0070698_1000718014 156
276 3300005518 Ga0070699_100070745 Ga0070699_1000707455 156
277 3300005536 Ga0070697_100089836 Ga0070697_1000898364 156
278 3300005985 Ga0081539_10009382 Ga0081539_100093825 156
279 3300005985 Ga0081539_10456073 Ga0081539_104560731 156
280 3300006028 Ga0070717_10034545 Ga0070717_100345454 156
281 3300020080 Ga0206350_11540781 Ga0206350_115407811 156
282 3300025910 Ga0207684_10135407 Ga0207684_101354073 156
283 3300025910 Ga0207684_10231008 Ga0207684_102310083 156
284 3300025922 Ga0207646_10120539 Ga0207646_101205393 156
285 3300025922 Ga0207646_10390034 Ga0207646_103900341 156
286 3300025939 Ga0207665_10371038 Ga0207665_103710381 156
287 3300049581 Ga0501047_0221795 Ga0501047_0221795_745_1224 156
288 3300049583 Ga0501067_0071261 Ga0501067_0071261_14_493 156
289 3300049589 Ga0501073_0133713 Ga0501073_0133713_1048_1527 156
290 3300049742 Ga0501080_0403801 Ga0501080_0403801_103_582 156
291 3300049744 Ga0501083_0028997 Ga0501083_0028997_657_1136 156
292 3300060353 Ga0501082_0764786 Ga0501082_0764786_14_493 156
293 3300005327 Ga0070658_10206480 Ga0070658_102064803 157
294 3300005339 Ga0070660_100591016 Ga0070660_1005910162 157
295 3300009177 Ga0105248_10028157 Ga0105248_100281572 157
296 3300013306 Ga0163162_10910008 Ga0163162_109100082 157
297 3300013308 Ga0157375_10174430 Ga0157375_101744304 157
298 3300037418 Ga0395900_0121363 Ga0395900_0121363_1870_2370 157
299 3300037471 Ga0395905_0005799 Ga0395905_0005799_6157_6657 157
300 3300044706 Ga0466964_0437062 Ga0466964_0437062_64_588 157
301 3300045976 Ga0466967_0008200 Ga0466967_0008200_467_991 157
302 3300048910 Ga0496107_0338072 Ga0496107_0338072_339_875 157
303 3300048911 Ga0496108_0271548 Ga0496108_0271548_196_732 157
304 3300048913 Ga0496110_0003992 Ga0496110_0003992_9354_9890 157
305 3300048914 Ga0496111_0041989 Ga0496111_0041989_359_895 157
306 3300049522 Ga0501299_134645 Ga0501299_134645_27_539 157
307 3300005293 Ga0065715_10090986 Ga0065715_100909868 159
308 3300005441 Ga0070700_100552578 Ga0070700_1005525781 159
309 3300005459 Ga0068867_100577831 Ga0068867_1005778312 159
310 3300005471 Ga0070698_100110045 Ga0070698_1001100455 159
311 3300005471 Ga0070698_100820213 Ga0070698_1008202132 159
312 3300005518 Ga0070699_101042521 Ga0070699_1010425211 159
313 3300005536 Ga0070697_101325308 Ga0070697_1013253081 159
314 3300006358 Ga0068871_101048852 Ga0068871_1010488521 159
315 3300009176 Ga0105242_10085135 Ga0105242_100851352 159
316 3300009176 Ga0105242_10664543 Ga0105242_106645431 159
317 3300011119 Ga0105246_10200844 Ga0105246_102008442 159
318 3300013297 Ga0157378_10244620 Ga0157378_102446202 159
319 3300013306 Ga0163162_10806952 Ga0163162_108069522 159
320 3300013308 Ga0157375_11103236 Ga0157375_111032361 159
321 3300014325 Ga0163163_11381464 Ga0163163_113814641 159
322 3300025904 Ga0207647_10435725 Ga0207647_104357251 159
323 3300026121 Ga0207683_10564861 Ga0207683_105648611 159
324 3300032126 Ga0307415_100320119 Ga0307415_1003201191 159
325 3300035241 Ga0373961_0001266 Ga0373961_0001266_4977_5468 159
326 3300035692 Ga0373935_0823706 Ga0373935_0823706_34_528 159
327 3300048909 Ga0496106_0439237 Ga0496106_0439237_229_735 159
328 3300009094 Ga0111539_10998646 Ga0111539_109986462 164
329 3300005289 Ga0065704_10485128 Ga0065704_104851281 165
330 3300005295 Ga0065707_10130117 Ga0065707_101301172 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

160

0.94

PF18029

Glyoxalase_6

Glyoxalase-like domain

45

161

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.7943 13 143
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.7891 12 136
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.7884 13 143
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7876 12 138
1xy7-assembly1.cif.gz_A x-ray structure of gene product from arabidopsis thaliana at5g48480 0.7804 12 135
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9359 81 151 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9101 81 151 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8577 83 138 3.30.720.110
2zw4A02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8044 13 137 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8027 83 144 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2E6PKE6-F1-model_v4 Glyoxalase 0.954 19 156
AF-A0A4R5K6X6-F1-model_v4 VOC family protein 0.9501 19 140
AF-A0A2E9T231-F1-model_v4 Glyoxalase 0.9493 69 161
AF-A0A523KTB3-F1-model_v4 deleted 0.9484 6 143
AF-A0A1I3F6H9-F1-model_v4 PhnB protein 0.9446 13 156

Feature Viewer

pLDDT pTM Quality
89.9 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map