F410281
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 330 | 187 | 329 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300049592|Ga0501076_0233970|Ga0501076_0233970_642_1196 |
| Length | 184 |
| Sequence | MGRGAAARAVVATRRIGASTTDEEDEVMASAVKPVPEGHHTVTPYLAIKNAAKALDFYKRAFGATETYTLMMPDGRVGHAEIRLGDSVIMLSDEFPEYGNKGPDAFGGSPVTLHLYVDDVDAFFGKAVAAGARERKPVTDQFYGDRSGQLEDPFGHLWWVATHKEDVPPGEMQKRVEAMFAGTK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 120 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 121 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 122 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 128 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 133 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 134 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 153 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 154 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 155 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 161 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 162 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 163 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 174 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 185 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 1.21 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 8.79 |
| Rhizosphere | 90.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10485128 | 3300005289 | Unclassified | 678 |
| 2 | Ga0065712_10115094 | 3300005290 | Bacteria | 1757 |
| 3 | Ga0065715_10090986 | 3300005293 | Archaea | 6243 |
| 4 | Ga0065707_10130117 | 3300005295 | Unclassified | 1935 |
| 5 | Ga0070658_10206480 | 3300005327 | Bacteria | 1659 |
| 6 | Ga0070658_10555597 | 3300005327 | Bacteria | 994 |
| 7 | Ga0070676_10576773 | 3300005328 | Unclassified | 808 |
| 8 | Ga0070683_100388661 | 3300005329 | Bacteria | 1330 |
| 9 | Ga0070683_100888152 | 3300005329 | Bacteria | 855 |
| 10 | Ga0070670_100001608 | 3300005331 | Bacteria | 18255 |
| 11 | Ga0070670_100024790 | 3300005331 | Bacteria | 5160 |
| 12 | Ga0070670_100053557 | 3300005331 | Bacteria | 3465 |
| 13 | Ga0070677_10102468 | 3300005333 | Bacteria | 1264 |
| 14 | Ga0070677_10406504 | 3300005333 | Bacteria | 719 |
| 15 | Ga0070666_10000898 | 3300005335 | Bacteria | 18102 |
| 16 | Ga0070666_10737065 | 3300005335 | Bacteria | 724 |
| 17 | Ga0068868_100358324 | 3300005338 | Bacteria | 1251 |
| 18 | Ga0070660_100591016 | 3300005339 | Bacteria | 928 |
| 19 | Ga0070661_100086721 | 3300005344 | Bacteria | 2315 |
| 20 | Ga0070661_100319272 | 3300005344 | Bacteria | 1213 |
| 21 | Ga0070661_100328598 | 3300005344 | Bacteria | 1195 |
| 22 | Ga0070661_100746186 | 3300005344 | Bacteria | 800 |
| 23 | Ga0070668_100600398 | 3300005347 | Bacteria | 963 |
| 24 | Ga0070675_100002680 | 3300005354 | Bacteria | 13382 |
| 25 | Ga0070675_100066175 | 3300005354 | Bacteria | 2989 |
| 26 | Ga0070675_100242910 | 3300005354 | Bacteria | 1574 |
| 27 | Ga0070671_100002159 | 3300005355 | Bacteria | 15168 |
| 28 | Ga0070671_100002514 | 3300005355 | Bacteria | 14204 |
| 29 | Ga0070671_100005299 | 3300005355 | Bacteria | 10286 |
| 30 | Ga0070674_100015502 | 3300005356 | Bacteria | 4758 |
| 31 | Ga0070673_100010631 | 3300005364 | Bacteria | 6239 |
| 32 | Ga0070673_100010813 | 3300005364 | Bacteria | 6198 |
| 33 | Ga0070673_100125395 | 3300005364 | Bacteria | 2148 |
| 34 | Ga0070659_100034629 | 3300005366 | Bacteria | 3928 |
| 35 | Ga0070659_100177585 | 3300005366 | Bacteria | 1746 |
| 36 | Ga0070667_100003286 | 3300005367 | Bacteria | 13811 |
| 37 | Ga0070667_100012982 | 3300005367 | Bacteria | 6889 |
| 38 | Ga0070709_10206796 | 3300005434 | Bacteria | 1393 |
| 39 | Ga0070709_10446408 | 3300005434 | Unclassified | 974 |
| 40 | Ga0070714_100043257 | 3300005435 | Bacteria | 3809 |
| 41 | Ga0070714_101055813 | 3300005435 | Unclassified | 791 |
| 42 | Ga0070713_100009963 | 3300005436 | Bacteria | 6845 |
| 43 | Ga0070701_10957936 | 3300005438 | Unclassified | 594 |
| 44 | Ga0070700_100552578 | 3300005441 | Archaea | 895 |
| 45 | Ga0070708_100091700 | 3300005445 | Bacteria | 2767 |
| 46 | Ga0070663_100196627 | 3300005455 | Bacteria | 1572 |
| 47 | Ga0070678_100000821 | 3300005456 | Bacteria | 15742 |
| 48 | Ga0070678_100485128 | 3300005456 | Bacteria | 1088 |
| 49 | Ga0070662_100005249 | 3300005457 | Bacteria | 8267 |
| 50 | Ga0070662_100147169 | 3300005457 | Bacteria | 1831 |
| 51 | Ga0070662_100209237 | 3300005457 | Bacteria | 1551 |
| 52 | Ga0068867_100163706 | 3300005459 | Bacteria | 1756 |
| 53 | Ga0068867_100577831 | 3300005459 | Archaea | 977 |
| 54 | Ga0070706_100087106 | 3300005467 | Unclassified | 2894 |
| 55 | Ga0070706_100273138 | 3300005467 | Unclassified | 1577 |
| 56 | Ga0070706_101011967 | 3300005467 | Bacteria | 766 |
| 57 | Ga0070707_100193096 | 3300005468 | Bacteria | 1985 |
| 58 | Ga0070698_100071801 | 3300005471 | Bacteria | 3470 |
| 59 | Ga0070698_100110045 | 3300005471 | Archaea | 2721 |
| 60 | Ga0070698_100820213 | 3300005471 | Bacteria | 875 |
| 61 | Ga0070698_101005044 | 3300005471 | Bacteria | 781 |
| 62 | Ga0070699_100070745 | 3300005518 | Bacteria | 3033 |
| 63 | Ga0070699_101042521 | 3300005518 | Archaea | 750 |
| 64 | Ga0070684_101786900 | 3300005535 | Unclassified | 580 |
| 65 | Ga0070697_100047796 | 3300005536 | Unclassified | 3469 |
| 66 | Ga0070697_100089836 | 3300005536 | Unclassified | 2538 |
| 67 | Ga0070697_101164218 | 3300005536 | Bacteria | 687 |
| 68 | Ga0070697_101325308 | 3300005536 | Archaea | 642 |
| 69 | Ga0070672_100005559 | 3300005543 | Bacteria | 8373 |
| 70 | Ga0070672_100751904 | 3300005543 | Bacteria | 856 |
| 71 | Ga0070665_100029450 | 3300005548 | Bacteria | 5527 |
| 72 | Ga0070664_100066539 | 3300005564 | Bacteria | 3078 |
| 73 | Ga0070664_100209249 | 3300005564 | Bacteria | 1743 |
| 74 | Ga0070664_100242743 | 3300005564 | Bacteria | 1617 |
| 75 | Ga0068857_100026491 | 3300005577 | Bacteria | 5111 |
| 76 | Ga0068854_100908887 | 3300005578 | Bacteria | 774 |
| 77 | Ga0070702_100339979 | 3300005615 | Unclassified | 1053 |
| 78 | Ga0068852_100102284 | 3300005616 | Bacteria | 2588 |
| 79 | Ga0068859_100954459 | 3300005617 | Bacteria | 941 |
| 80 | Ga0068864_100003154 | 3300005618 | Bacteria | 13627 |
| 81 | Ga0068864_100010223 | 3300005618 | Bacteria | 7750 |
| 82 | Ga0068864_100044246 | 3300005618 | Bacteria | 3815 |
| 83 | Ga0068864_100057473 | 3300005618 | Bacteria | 3361 |
| 84 | Ga0068864_100724982 | 3300005618 | Bacteria | 973 |
| 85 | Ga0068851_10093765 | 3300005834 | Bacteria | 1585 |
| 86 | Ga0068851_10204312 | 3300005834 | Bacteria | 1104 |
| 87 | Ga0068863_100034179 | 3300005841 | Bacteria | 4843 |
| 88 | Ga0068863_100572269 | 3300005841 | Bacteria | 1117 |
| 89 | Ga0068858_100001092 | 3300005842 | Bacteria | 28091 |
| 90 | Ga0068858_100445012 | 3300005842 | Bacteria | 1248 |
| 91 | Ga0068860_100958789 | 3300005843 | Bacteria | 873 |
| 92 | Ga0081539_10009382 | 3300005985 | Bacteria | 8190 |
| 93 | Ga0081539_10456073 | 3300005985 | Unclassified | 529 |
| 94 | Ga0070717_10002119 | 3300006028 | Bacteria | 13916 |
| 95 | Ga0070717_10034545 | 3300006028 | Bacteria | 4088 |
| 96 | Ga0070716_100010383 | 3300006173 | Bacteria | 4665 |
| 97 | Ga0097621_100105064 | 3300006237 | Bacteria | 2380 |
| 98 | Ga0068871_101048852 | 3300006358 | Archaea | 761 |
| 99 | Ga0075428_100230604 | 3300006844 | Bacteria | 1998 |
| 100 | Ga0075428_100893922 | 3300006844 | Bacteria | 942 |
| 101 | Ga0075428_101185825 | 3300006844 | Bacteria | 805 |
| 102 | Ga0075430_100017622 | 3300006846 | Bacteria | 6082 |
| 103 | Ga0075430_100116638 | 3300006846 | Unclassified | 2225 |
| 104 | Ga0075431_100003904 | 3300006847 | Bacteria | 14511 |
| 105 | Ga0075433_10332067 | 3300006852 | Bacteria | 1344 |
| 106 | Ga0075433_10337471 | 3300006852 | Unclassified | 1332 |
| 107 | Ga0075429_100003421 | 3300006880 | Bacteria | 13533 |
| 108 | Ga0075429_100103928 | 3300006880 | Unclassified | 2481 |
| 109 | Ga0097620_100954572 | 3300006931 | Bacteria | 941 |
| 110 | Ga0099795_10026350 | 3300007788 | Bacteria | 1958 |
| 111 | Ga0111539_10998646 | 3300009094 | Unclassified | 973 |
| 112 | Ga0114129_10007348 | 3300009147 | Bacteria | 15682 |
| 113 | Ga0114129_10093469 | 3300009147 | Bacteria | 4166 |
| 114 | Ga0114129_10124649 | 3300009147 | Bacteria | 3543 |
| 115 | Ga0114129_10185650 | 3300009147 | Bacteria | 2826 |
| 116 | Ga0105242_10085135 | 3300009176 | Archaea | 2651 |
| 117 | Ga0105242_10664543 | 3300009176 | Archaea | 1015 |
| 118 | Ga0105248_10000269 | 3300009177 | Bacteria | 61063 |
| 119 | Ga0105248_10017544 | 3300009177 | Bacteria | 7894 |
| 120 | Ga0105248_10028157 | 3300009177 | Bacteria | 6258 |
| 121 | Ga0105248_10075580 | 3300009177 | Bacteria | 3786 |
| 122 | Ga0105239_10655885 | 3300010375 | Archaea | 1199 |
| 123 | Ga0105246_10200844 | 3300011119 | Archaea | 1550 |
| 124 | Ga0157373_10131391 | 3300013100 | Bacteria | 1761 |
| 125 | Ga0157374_10003140 | 3300013296 | Bacteria | 13883 |
| 126 | Ga0157378_10244620 | 3300013297 | Archaea | 1715 |
| 127 | Ga0163162_10305766 | 3300013306 | Bacteria | 1722 |
| 128 | Ga0163162_10806952 | 3300013306 | Archaea | 1056 |
| 129 | Ga0163162_10910008 | 3300013306 | Bacteria | 992 |
| 130 | Ga0157375_10015586 | 3300013308 | Bacteria | 6807 |
| 131 | Ga0157375_10174430 | 3300013308 | Bacteria | 2299 |
| 132 | Ga0157375_11103236 | 3300013308 | Archaea | 929 |
| 133 | Ga0163163_10000903 | 3300014325 | Bacteria | 25169 |
| 134 | Ga0163163_10893483 | 3300014325 | Bacteria | 952 |
| 135 | Ga0163163_11381464 | 3300014325 | Archaea | 766 |
| 136 | Ga0157377_10716076 | 3300014745 | Archaea | 728 |
| 137 | Ga0157377_10737389 | 3300014745 | Bacteria | 719 |
| 138 | Ga0206350_11540781 | 3300020080 | Bacteria | 896 |
| 139 | Ga0224712_10329793 | 3300022467 | Bacteria | 718 |
| 140 | Ga0207697_10057912 | 3300025315 | Bacteria | 1609 |
| 141 | Ga0207697_10097490 | 3300025315 | Bacteria | 1251 |
| 142 | Ga0207697_10418203 | 3300025315 | Bacteria | 595 |
| 143 | Ga0207656_10302352 | 3300025321 | Bacteria | 792 |
| 144 | Ga0207682_10298253 | 3300025893 | Bacteria | 755 |
| 145 | Ga0207680_10022349 | 3300025903 | Bacteria | 3438 |
| 146 | Ga0207680_10134791 | 3300025903 | Bacteria | 1631 |
| 147 | Ga0207647_10435725 | 3300025904 | Archaea | 736 |
| 148 | Ga0207699_10258528 | 3300025906 | Bacteria | 1203 |
| 149 | Ga0207705_10019819 | 3300025909 | Bacteria | 4810 |
| 150 | Ga0207684_10135407 | 3300025910 | Bacteria | 2115 |
| 151 | Ga0207684_10231008 | 3300025910 | Unclassified | 1596 |
| 152 | Ga0207684_10609486 | 3300025910 | Unclassified | 932 |
| 153 | Ga0207657_10353374 | 3300025919 | Bacteria | 1159 |
| 154 | Ga0207649_10727134 | 3300025920 | Bacteria | 771 |
| 155 | Ga0207649_10963255 | 3300025920 | Bacteria | 670 |
| 156 | Ga0207646_10120539 | 3300025922 | Bacteria | 2356 |
| 157 | Ga0207646_10390034 | 3300025922 | Unclassified | 1258 |
| 158 | Ga0207650_10014804 | 3300025925 | Bacteria | 5424 |
| 159 | Ga0207650_10045047 | 3300025925 | Bacteria | 3245 |
| 160 | Ga0207650_10075835 | 3300025925 | Bacteria | 2539 |
| 161 | Ga0207659_10002913 | 3300025926 | Bacteria | 10190 |
| 162 | Ga0207659_10160483 | 3300025926 | Bacteria | 1764 |
| 163 | Ga0207659_10375389 | 3300025926 | Bacteria | 1185 |
| 164 | Ga0207700_10072832 | 3300025928 | Bacteria | 2651 |
| 165 | Ga0207664_10201511 | 3300025929 | Bacteria | 1718 |
| 166 | Ga0207644_10000425 | 3300025931 | Bacteria | 27368 |
| 167 | Ga0207644_10009529 | 3300025931 | Bacteria | 6378 |
| 168 | Ga0207644_10181800 | 3300025931 | Bacteria | 1648 |
| 169 | Ga0207690_10061755 | 3300025932 | Bacteria | 2549 |
| 170 | Ga0207690_10085177 | 3300025932 | Bacteria | 2218 |
| 171 | Ga0207706_10004122 | 3300025933 | Bacteria | 13712 |
| 172 | Ga0207706_10285666 | 3300025933 | Bacteria | 1439 |
| 173 | Ga0207706_10327590 | 3300025933 | Bacteria | 1333 |
| 174 | Ga0207706_10554199 | 3300025933 | Bacteria | 989 |
| 175 | Ga0207665_10100121 | 3300025939 | Bacteria | 2022 |
| 176 | Ga0207665_10371038 | 3300025939 | Unclassified | 1084 |
| 177 | Ga0207691_10014418 | 3300025940 | Bacteria | 7538 |
| 178 | Ga0207691_10059566 | 3300025940 | Bacteria | 3471 |
| 179 | Ga0207711_10000122 | 3300025941 | Bacteria | 81465 |
| 180 | Ga0207711_10006525 | 3300025941 | Bacteria | 9823 |
| 181 | Ga0207711_10095874 | 3300025941 | Bacteria | 2617 |
| 182 | Ga0207661_11432287 | 3300025944 | Bacteria | 634 |
| 183 | Ga0207679_10195849 | 3300025945 | Bacteria | 1684 |
| 184 | Ga0207679_10314767 | 3300025945 | Bacteria | 1353 |
| 185 | Ga0207651_10086827 | 3300025960 | Bacteria | 2275 |
| 186 | Ga0207658_10127849 | 3300025986 | Bacteria | 2036 |
| 187 | Ga0207658_10547499 | 3300025986 | Bacteria | 1035 |
| 188 | Ga0207677_10425994 | 3300026023 | Bacteria | 1131 |
| 189 | Ga0207703_10030405 | 3300026035 | Bacteria | 4268 |
| 190 | Ga0207703_11467172 | 3300026035 | Bacteria | 656 |
| 191 | Ga0207678_10081544 | 3300026067 | Bacteria | 2769 |
| 192 | Ga0207708_10543758 | 3300026075 | Archaea | 979 |
| 193 | Ga0207641_10026291 | 3300026088 | Bacteria | 4803 |
| 194 | Ga0207641_10123568 | 3300026088 | Bacteria | 2313 |
| 195 | Ga0207648_10324898 | 3300026089 | Bacteria | 1383 |
| 196 | Ga0207676_10008045 | 3300026095 | Bacteria | 7497 |
| 197 | Ga0207676_10019364 | 3300026095 | Bacteria | 4964 |
| 198 | Ga0207676_10021889 | 3300026095 | Bacteria | 4695 |
| 199 | Ga0207676_10099060 | 3300026095 | Bacteria | 2411 |
| 200 | Ga0207676_10815577 | 3300026095 | Bacteria | 911 |
| 201 | Ga0207674_10035202 | 3300026116 | Bacteria | 5227 |
| 202 | Ga0207683_10009993 | 3300026121 | Bacteria | 8098 |
| 203 | Ga0207683_10425391 | 3300026121 | Bacteria | 1223 |
| 204 | Ga0207683_10564861 | 3300026121 | Archaea | 1052 |
| 205 | Ga0207698_10104924 | 3300026142 | Bacteria | 2353 |
| 206 | Ga0209971_1066863 | 3300027682 | Archaea | 871 |
| 207 | Ga0209974_10250681 | 3300027876 | Bacteria | 666 |
| 208 | Ga0268264_10931191 | 3300028381 | Bacteria | 873 |
| 209 | Ga0265760_10054639 | 3300031090 | Bacteria | 1206 |
| 210 | Ga0265760_10233369 | 3300031090 | Unclassified | 631 |
| 211 | Ga0307405_10225059 | 3300031731 | Bacteria | 1379 |
| 212 | Ga0307405_10256627 | 3300031731 | Bacteria | 1303 |
| 213 | Ga0307413_10080438 | 3300031824 | Bacteria | 2086 |
| 214 | Ga0307407_11069437 | 3300031903 | Bacteria | 626 |
| 215 | Ga0307412_10167979 | 3300031911 | Bacteria | 1638 |
| 216 | Ga0307409_100058613 | 3300031995 | Bacteria | 2992 |
| 217 | Ga0307409_100296773 | 3300031995 | Bacteria | 1501 |
| 218 | Ga0307409_100984264 | 3300031995 | Unclassified | 861 |
| 219 | Ga0307416_100116452 | 3300032002 | Bacteria | 2369 |
| 220 | Ga0307415_100320119 | 3300032126 | Bacteria | 1293 |
| 221 | Ga0373961_0001266 | 3300035241 | Archaea | 7693 |
| 222 | Ga0373935_0823706 | 3300035692 | Bacteria | 686 |
| 223 | Ga0373937_1157962 | 3300036401 | Bacteria | 722 |
| 224 | Ga0395899_0130536 | 3300037312 | Bacteria | 1794 |
| 225 | Ga0395899_0302520 | 3300037312 | Bacteria | 1082 |
| 226 | Ga0395900_0121363 | 3300037418 | Bacteria | 2681 |
| 227 | Ga0395900_0215996 | 3300037418 | Bacteria | 1935 |
| 228 | Ga0395900_0514742 | 3300037418 | Bacteria | 1145 |
| 229 | Ga0395905_0005799 | 3300037471 | Bacteria | 12544 |
| 230 | Ga0395905_0026518 | 3300037471 | Bacteria | 5463 |
| 231 | Ga0395905_0129228 | 3300037471 | Bacteria | 2376 |
| 232 | Ga0395905_0157589 | 3300037471 | Bacteria | 2135 |
| 233 | Ga0395905_0161244 | 3300037471 | Bacteria | 2107 |
| 234 | Ga0395905_0228872 | 3300037471 | Bacteria | 1739 |
| 235 | Ga0436364_0707532 | 3300037853 | Bacteria | 1434 |
| 236 | Ga0395901_0642177 | 3300038443 | Bacteria | 1066 |
| 237 | Ga0395901_0980151 | 3300038443 | Bacteria | 822 |
| 238 | Ga0242420_055040 | 3300038996 | Bacteria | 784 |
| 239 | Ga0439432_065292 | 3300042006 | Bacteria | 1116 |
| 240 | Ga0466964_0437062 | 3300044706 | Bacteria | 691 |
| 241 | Ga0466967_0008200 | 3300045976 | Bacteria | 7629 |
| 242 | Ga0466967_0137944 | 3300045976 | Bacteria | 2269 |
| 243 | Ga0466967_0560358 | 3300045976 | Bacteria | 1125 |
| 244 | Ga0495629_0241506 | 3300046459 | Bacteria | 1244 |
| 245 | Ga0495580_0120363 | 3300046472 | Bacteria | 1823 |
| 246 | Ga0495585_0076559 | 3300046492 | Bacteria | 1817 |
| 247 | Ga0495644_0187836 | 3300046523 | Bacteria | 795 |
| 248 | Ga0495663_0001007 | 3300046525 | Bacteria | 9325 |
| 249 | Ga0495663_0178682 | 3300046525 | Bacteria | 734 |
| 250 | Ga0495642_0373996 | 3300046528 | Bacteria | 627 |
| 251 | Ga0495598_0000300 | 3300046537 | Bacteria | 8890 |
| 252 | Ga0495621_0005399 | 3300046539 | Bacteria | 3671 |
| 253 | Ga0495633_0006030 | 3300046558 | Bacteria | 7270 |
| 254 | Ga0495659_0299541 | 3300046664 | Bacteria | 679 |
| 255 | Ga0495661_0028885 | 3300046665 | Bacteria | 3545 |
| 256 | Ga0495670_0002214 | 3300046691 | Bacteria | 9609 |
| 257 | Ga0495677_0010062 | 3300047445 | Bacteria | 3481 |
| 258 | Ga0495677_0090768 | 3300047445 | Bacteria | 1151 |
| 259 | Ga0496100_0025228 | 3300048903 | Bacteria | 3634 |
| 260 | Ga0496101_0008590 | 3300048904 | Bacteria | 6676 |
| 261 | Ga0496101_0411696 | 3300048904 | Bacteria | 1065 |
| 262 | Ga0496102_0344749 | 3300048905 | Bacteria | 1403 |
| 263 | Ga0496105_0419392 | 3300048908 | Bacteria | 1060 |
| 264 | Ga0496106_0001364 | 3300048909 | Bacteria | 18291 |
| 265 | Ga0496106_0284012 | 3300048909 | Bacteria | 1326 |
| 266 | Ga0496106_0439237 | 3300048909 | Archaea | 1049 |
| 267 | Ga0496107_0001881 | 3300048910 | Bacteria | 13284 |
| 268 | Ga0496107_0338072 | 3300048910 | Bacteria | 1120 |
| 269 | Ga0496108_0014599 | 3300048911 | Bacteria | 6411 |
| 270 | Ga0496108_0173091 | 3300048911 | Bacteria | 1868 |
| 271 | Ga0496108_0198141 | 3300048911 | Bacteria | 1742 |
| 272 | Ga0496108_0271548 | 3300048911 | Bacteria | 1476 |
| 273 | Ga0496109_0000659 | 3300048912 | Bacteria | 28619 |
| 274 | Ga0496109_0017334 | 3300048912 | Bacteria | 6311 |
| 275 | Ga0496109_0049271 | 3300048912 | Bacteria | 3834 |
| 276 | Ga0496110_0003992 | 3300048913 | Bacteria | 11361 |
| 277 | Ga0496110_0194536 | 3300048913 | Bacteria | 1841 |
| 278 | Ga0496111_0025865 | 3300048914 | Bacteria | 4141 |
| 279 | Ga0496111_0041989 | 3300048914 | Bacteria | 3283 |
| 280 | Ga0496111_0092584 | 3300048914 | Bacteria | 2216 |
| 281 | Ga0496111_0134440 | 3300048914 | Bacteria | 1831 |
| 282 | Ga0496112_0001821 | 3300048915 | Bacteria | 16758 |
| 283 | Ga0496112_0010868 | 3300048915 | Bacteria | 8284 |
| 284 | Ga0496112_0043472 | 3300048915 | Bacteria | 4399 |
| 285 | Ga0496113_0029770 | 3300048916 | Bacteria | 3946 |
| 286 | Ga0496113_0102681 | 3300048916 | Bacteria | 2217 |
| 287 | Ga0496113_0112213 | 3300048916 | Bacteria | 2123 |
| 288 | Ga0496126_0000018 | 3300048929 | Bacteria | 581170 |
| 289 | Ga0501299_134645 | 3300049522 | Unclassified | 609 |
| 290 | Ga0501039_0314535 | 3300049575 | Unclassified | 1231 |
| 291 | Ga0501047_0134146 | 3300049581 | Bacteria | 2356 |
| 292 | Ga0501047_0221795 | 3300049581 | Bacteria | 1747 |
| 293 | Ga0501048_0383878 | 3300049582 | Bacteria | 1003 |
| 294 | Ga0501067_0064644 | 3300049583 | Bacteria | 2025 |
| 295 | Ga0501067_0071261 | 3300049583 | Bacteria | 1925 |
| 296 | Ga0501069_0105140 | 3300049585 | Bacteria | 1604 |
| 297 | Ga0501071_0693786 | 3300049587 | Bacteria | 784 |
| 298 | Ga0501071_0732311 | 3300049587 | Bacteria | 762 |
| 299 | Ga0501072_0107589 | 3300049588 | Bacteria | 2218 |
| 300 | Ga0501073_0133713 | 3300049589 | Bacteria | 1719 |
| 301 | Ga0501075_0646815 | 3300049591 | Unclassified | 806 |
| 302 | Ga0501076_0233970 | 3300049592 | Bacteria | 1502 |
| 303 | Ga0501076_0927419 | 3300049592 | Unclassified | 718 |
| 304 | Ga0501249_046757 | 3300049679 | Bacteria | 989 |
| 305 | Ga0501079_0940851 | 3300049741 | Unclassified | 680 |
| 306 | Ga0501080_0151806 | 3300049742 | Bacteria | 2141 |
| 307 | Ga0501080_0403801 | 3300049742 | Bacteria | 1229 |
| 308 | Ga0501081_0564661 | 3300049743 | Bacteria | 850 |
| 309 | Ga0501081_1144365 | 3300049743 | Unclassified | 589 |
| 310 | Ga0501083_0028997 | 3300049744 | Bacteria | 3811 |
| 311 | Ga0501044_0478124 | 3300049823 | Bacteria | 1149 |
| 312 | nmdc:mga05p37_40943_c1 | 3300050507 | Bacteria | 5689 |
| 313 | nmdc:mga05p37_70842_c1 | 3300050507 | Bacteria | 4288 |
| 314 | nmdc:mga05p37_7909_c1 | 3300050507 | Bacteria | 12550 |
| 315 | nmdc:mga09592_28864_c1 | 3300050508 | Bacteria | 4612 |
| 316 | nmdc:mga09592_94946_c1 | 3300050508 | Unclassified | 2550 |
| 317 | nmdc:mga0qj67_11773_c1 | 3300050509 | Bacteria | 6566 |
| 318 | nmdc:mga0qj67_33423_c1 | 3300050509 | Bacteria | 4013 |
| 319 | nmdc:mga06r32_39200_c1 | 3300050510 | Bacteria | 4495 |
| 320 | nmdc:mga06r32_49020_c1 | 3300050510 | Bacteria | 4039 |
| 321 | nmdc:mga0n895_1065192_c1 | 3300050512 | Bacteria | 787 |
| 322 | Ga0500595_011705 | 3300053119 | Bacteria | 3419 |
| 323 | Ga0501084_0093200 | 3300054114 | Bacteria | 2529 |
| 324 | Ga0501084_0130236 | 3300054114 | Unclassified | 2118 |
| 325 | Ga0501084_0442295 | 3300054114 | Bacteria | 1099 |
| 326 | Ga0501082_0355048 | 3300060353 | Unclassified | 1278 |
| 327 | Ga0501082_0463046 | 3300060353 | Bacteria | 1108 |
| 328 | Ga0501082_0764786 | 3300060353 | Bacteria | 845 |
| 329 | Ga0530510_0065665 | 3300061734 | Unclassified | 2629 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005471 | Ga0070698_101005044 | Ga0070698_1010050442 | 126 |
| 2 | 3300005438 | Ga0070701_10957936 | Ga0070701_109579361 | 128 |
| 3 | 3300010375 | Ga0105239_10655885 | Ga0105239_106558851 | 132 |
| 4 | 3300014745 | Ga0157377_10716076 | Ga0157377_107160761 | 132 |
| 5 | 3300026075 | Ga0207708_10543758 | Ga0207708_105437581 | 134 |
| 6 | 3300037853 | Ga0436364_0707532 | Ga0436364_0707532_236_676 | 142 |
| 7 | 3300050512 | nmdc:mga0n895_1065192_c1 | nmdc:mga0n895_1065192_c1_158_661 | 142 |
| 8 | 3300006844 | Ga0075428_100230604 | Ga0075428_1002306041 | 144 |
| 9 | 3300006846 | Ga0075430_100116638 | Ga0075430_1001166383 | 144 |
| 10 | 3300006847 | Ga0075431_100003904 | Ga0075431_1000039042 | 144 |
| 11 | 3300006880 | Ga0075429_100103928 | Ga0075429_1001039282 | 144 |
| 12 | 3300009147 | Ga0114129_10007348 | Ga0114129_100073485 | 144 |
| 13 | 3300026023 | Ga0207677_10425994 | Ga0207677_104259941 | 144 |
| 14 | 3300050507 | nmdc:mga05p37_7909_c1 | nmdc:mga05p37_7909_c1_10397_10870 | 144 |
| 15 | 3300050508 | nmdc:mga09592_94946_c1 | nmdc:mga09592_94946_c1_1528_2001 | 144 |
| 16 | 3300050509 | nmdc:mga0qj67_11773_c1 | nmdc:mga0qj67_11773_c1_4933_5406 | 144 |
| 17 | 3300050510 | nmdc:mga06r32_39200_c1 | nmdc:mga06r32_39200_c1_2245_2718 | 144 |
| 18 | 3300006844 | Ga0075428_101185825 | Ga0075428_1011858251 | 146 |
| 19 | 3300031090 | Ga0265760_10054639 | Ga0265760_100546392 | 146 |
| 20 | 3300025315 | Ga0207697_10418203 | Ga0207697_104182031 | 147 |
| 21 | 3300031090 | Ga0265760_10233369 | Ga0265760_102333691 | 147 |
| 22 | 3300006852 | Ga0075433_10332067 | Ga0075433_103320673 | 148 |
| 23 | 3300025920 | Ga0207649_10727134 | Ga0207649_107271342 | 149 |
| 24 | 3300048929 | Ga0496126_0000018 | Ga0496126_0000018_38695_39168 | 150 |
| 25 | 3300049743 | Ga0501081_1144365 | Ga0501081_1144365_11_472 | 150 |
| 26 | 3300005536 | Ga0070697_100047796 | Ga0070697_1000477965 | 152 |
| 27 | 3300007788 | Ga0099795_10026350 | Ga0099795_100263502 | 152 |
| 28 | 3300009147 | Ga0114129_10185650 | Ga0114129_101856501 | 152 |
| 29 | 3300025910 | Ga0207684_10609486 | Ga0207684_106094862 | 152 |
| 30 | 3300045976 | Ga0466967_0137944 | Ga0466967_0137944_882_1358 | 152 |
| 31 | 3300045976 | Ga0466967_0560358 | Ga0466967_0560358_544_1020 | 152 |
| 32 | iso_pu_bacteria | 2883354860 | 2883359645 | 152 |
| 33 | 3300005467 | Ga0070706_101011967 | Ga0070706_1010119671 | 153 |
| 34 | 3300006844 | Ga0075428_100893922 | Ga0075428_1008939222 | 153 |
| 35 | 3300006846 | Ga0075430_100017622 | Ga0075430_1000176225 | 153 |
| 36 | 3300006880 | Ga0075429_100003421 | Ga0075429_10000342114 | 153 |
| 37 | 3300009147 | Ga0114129_10124649 | Ga0114129_101246492 | 153 |
| 38 | 3300027682 | Ga0209971_1066863 | Ga0209971_10668631 | 153 |
| 39 | 3300027876 | Ga0209974_10250681 | Ga0209974_102506812 | 153 |
| 40 | 3300049575 | Ga0501039_0314535 | Ga0501039_0314535_135_605 | 153 |
| 41 | 3300049587 | Ga0501071_0732311 | Ga0501071_0732311_196_666 | 153 |
| 42 | 3300049588 | Ga0501072_0107589 | Ga0501072_0107589_404_874 | 153 |
| 43 | 3300049591 | Ga0501075_0646815 | Ga0501075_0646815_104_574 | 153 |
| 44 | 3300049592 | Ga0501076_0927419 | Ga0501076_0927419_172_642 | 153 |
| 45 | 3300049741 | Ga0501079_0940851 | Ga0501079_0940851_173_643 | 153 |
| 46 | 3300050507 | nmdc:mga05p37_40943_c1 | nmdc:mga05p37_40943_c1_4767_5237 | 153 |
| 47 | 3300050508 | nmdc:mga09592_28864_c1 | nmdc:mga09592_28864_c1_2206_2676 | 153 |
| 48 | 3300050509 | nmdc:mga0qj67_33423_c1 | nmdc:mga0qj67_33423_c1_963_1433 | 153 |
| 49 | 3300050510 | nmdc:mga06r32_49020_c1 | nmdc:mga06r32_49020_c1_1540_2010 | 153 |
| 50 | 3300054114 | Ga0501084_0130236 | Ga0501084_0130236_95_565 | 153 |
| 51 | 3300060353 | Ga0501082_0355048 | Ga0501082_0355048_239_709 | 153 |
| 52 | 3300061734 | Ga0530510_0065665 | Ga0530510_0065665_1760_2233 | 153 |
| 53 | 3300005290 | Ga0065712_10115094 | Ga0065712_101150942 | 154 |
| 54 | 3300005327 | Ga0070658_10555597 | Ga0070658_105555971 | 154 |
| 55 | 3300005328 | Ga0070676_10576773 | Ga0070676_105767731 | 154 |
| 56 | 3300005329 | Ga0070683_100388661 | Ga0070683_1003886612 | 154 |
| 57 | 3300005329 | Ga0070683_100888152 | Ga0070683_1008881521 | 154 |
| 58 | 3300005331 | Ga0070670_100001608 | Ga0070670_10000160816 | 154 |
| 59 | 3300005331 | Ga0070670_100024790 | Ga0070670_1000247906 | 154 |
| 60 | 3300005331 | Ga0070670_100053557 | Ga0070670_1000535573 | 154 |
| 61 | 3300005333 | Ga0070677_10102468 | Ga0070677_101024682 | 154 |
| 62 | 3300005333 | Ga0070677_10406504 | Ga0070677_104065041 | 154 |
| 63 | 3300005335 | Ga0070666_10000898 | Ga0070666_100008982 | 154 |
| 64 | 3300005335 | Ga0070666_10737065 | Ga0070666_107370651 | 154 |
| 65 | 3300005338 | Ga0068868_100358324 | Ga0068868_1003583242 | 154 |
| 66 | 3300005344 | Ga0070661_100086721 | Ga0070661_1000867212 | 154 |
| 67 | 3300005344 | Ga0070661_100319272 | Ga0070661_1003192722 | 154 |
| 68 | 3300005344 | Ga0070661_100328598 | Ga0070661_1003285982 | 154 |
| 69 | 3300005344 | Ga0070661_100746186 | Ga0070661_1007461861 | 154 |
| 70 | 3300005347 | Ga0070668_100600398 | Ga0070668_1006003981 | 154 |
| 71 | 3300005354 | Ga0070675_100002680 | Ga0070675_10000268010 | 154 |
| 72 | 3300005354 | Ga0070675_100066175 | Ga0070675_1000661752 | 154 |
| 73 | 3300005354 | Ga0070675_100242910 | Ga0070675_1002429103 | 154 |
| 74 | 3300005355 | Ga0070671_100002159 | Ga0070671_1000021592 | 154 |
| 75 | 3300005355 | Ga0070671_100002514 | Ga0070671_1000025149 | 154 |
| 76 | 3300005355 | Ga0070671_100005299 | Ga0070671_10000529911 | 154 |
| 77 | 3300005356 | Ga0070674_100015502 | Ga0070674_1000155022 | 154 |
| 78 | 3300005364 | Ga0070673_100010631 | Ga0070673_1000106312 | 154 |
| 79 | 3300005364 | Ga0070673_100010813 | Ga0070673_1000108132 | 154 |
| 80 | 3300005364 | Ga0070673_100125395 | Ga0070673_1001253952 | 154 |
| 81 | 3300005366 | Ga0070659_100034629 | Ga0070659_1000346292 | 154 |
| 82 | 3300005366 | Ga0070659_100177585 | Ga0070659_1001775851 | 154 |
| 83 | 3300005367 | Ga0070667_100003286 | Ga0070667_1000032862 | 154 |
| 84 | 3300005367 | Ga0070667_100012982 | Ga0070667_1000129822 | 154 |
| 85 | 3300005434 | Ga0070709_10206796 | Ga0070709_102067961 | 154 |
| 86 | 3300005435 | Ga0070714_100043257 | Ga0070714_1000432572 | 154 |
| 87 | 3300005436 | Ga0070713_100009963 | Ga0070713_1000099635 | 154 |
| 88 | 3300005455 | Ga0070663_100196627 | Ga0070663_1001966272 | 154 |
| 89 | 3300005456 | Ga0070678_100000821 | Ga0070678_10000082117 | 154 |
| 90 | 3300005456 | Ga0070678_100485128 | Ga0070678_1004851282 | 154 |
| 91 | 3300005457 | Ga0070662_100005249 | Ga0070662_10000524910 | 154 |
| 92 | 3300005457 | Ga0070662_100147169 | Ga0070662_1001471692 | 154 |
| 93 | 3300005457 | Ga0070662_100209237 | Ga0070662_1002092373 | 154 |
| 94 | 3300005459 | Ga0068867_100163706 | Ga0068867_1001637062 | 154 |
| 95 | 3300005535 | Ga0070684_101786900 | Ga0070684_1017869001 | 154 |
| 96 | 3300005536 | Ga0070697_101164218 | Ga0070697_1011642181 | 154 |
| 97 | 3300005543 | Ga0070672_100005559 | Ga0070672_1000055592 | 154 |
| 98 | 3300005543 | Ga0070672_100751904 | Ga0070672_1007519042 | 154 |
| 99 | 3300005548 | Ga0070665_100029450 | Ga0070665_1000294502 | 154 |
| 100 | 3300005564 | Ga0070664_100066539 | Ga0070664_1000665392 | 154 |
| 101 | 3300005564 | Ga0070664_100209249 | Ga0070664_1002092492 | 154 |
| 102 | 3300005564 | Ga0070664_100242743 | Ga0070664_1002427432 | 154 |
| 103 | 3300005577 | Ga0068857_100026491 | Ga0068857_1000264912 | 154 |
| 104 | 3300005578 | Ga0068854_100908887 | Ga0068854_1009088872 | 154 |
| 105 | 3300005615 | Ga0070702_100339979 | Ga0070702_1003399792 | 154 |
| 106 | 3300005616 | Ga0068852_100102284 | Ga0068852_1001022842 | 154 |
| 107 | 3300005617 | Ga0068859_100954459 | Ga0068859_1009544592 | 154 |
| 108 | 3300005618 | Ga0068864_100003154 | Ga0068864_10000315412 | 154 |
| 109 | 3300005618 | Ga0068864_100010223 | Ga0068864_1000102239 | 154 |
| 110 | 3300005618 | Ga0068864_100044246 | Ga0068864_1000442466 | 154 |
| 111 | 3300005618 | Ga0068864_100057473 | Ga0068864_1000574735 | 154 |
| 112 | 3300005618 | Ga0068864_100724982 | Ga0068864_1007249822 | 154 |
| 113 | 3300005834 | Ga0068851_10093765 | Ga0068851_100937652 | 154 |
| 114 | 3300005834 | Ga0068851_10204312 | Ga0068851_102043122 | 154 |
| 115 | 3300005841 | Ga0068863_100034179 | Ga0068863_1000341795 | 154 |
| 116 | 3300005841 | Ga0068863_100572269 | Ga0068863_1005722692 | 154 |
| 117 | 3300005842 | Ga0068858_100001092 | Ga0068858_1000010922 | 154 |
| 118 | 3300005842 | Ga0068858_100445012 | Ga0068858_1004450122 | 154 |
| 119 | 3300005843 | Ga0068860_100958789 | Ga0068860_1009587892 | 154 |
| 120 | 3300006028 | Ga0070717_10002119 | Ga0070717_1000211914 | 154 |
| 121 | 3300006173 | Ga0070716_100010383 | Ga0070716_1000103831 | 154 |
| 122 | 3300006237 | Ga0097621_100105064 | Ga0097621_1001050641 | 154 |
| 123 | 3300006852 | Ga0075433_10337471 | Ga0075433_103374713 | 154 |
| 124 | 3300006931 | Ga0097620_100954572 | Ga0097620_1009545722 | 154 |
| 125 | 3300009147 | Ga0114129_10093469 | Ga0114129_100934692 | 154 |
| 126 | 3300009177 | Ga0105248_10000269 | Ga0105248_1000026939 | 154 |
| 127 | 3300009177 | Ga0105248_10017544 | Ga0105248_100175448 | 154 |
| 128 | 3300009177 | Ga0105248_10075580 | Ga0105248_100755802 | 154 |
| 129 | 3300013100 | Ga0157373_10131391 | Ga0157373_101313912 | 154 |
| 130 | 3300013296 | Ga0157374_10003140 | Ga0157374_100031407 | 154 |
| 131 | 3300013306 | Ga0163162_10305766 | Ga0163162_103057663 | 154 |
| 132 | 3300013308 | Ga0157375_10015586 | Ga0157375_100155862 | 154 |
| 133 | 3300014325 | Ga0163163_10000903 | Ga0163163_1000090316 | 154 |
| 134 | 3300014325 | Ga0163163_10893483 | Ga0163163_108934831 | 154 |
| 135 | 3300014745 | Ga0157377_10737389 | Ga0157377_107373891 | 154 |
| 136 | 3300025315 | Ga0207697_10057912 | Ga0207697_100579121 | 154 |
| 137 | 3300025315 | Ga0207697_10097490 | Ga0207697_100974901 | 154 |
| 138 | 3300025321 | Ga0207656_10302352 | Ga0207656_103023521 | 154 |
| 139 | 3300025893 | Ga0207682_10298253 | Ga0207682_102982531 | 154 |
| 140 | 3300025903 | Ga0207680_10022349 | Ga0207680_100223495 | 154 |
| 141 | 3300025903 | Ga0207680_10134791 | Ga0207680_101347912 | 154 |
| 142 | 3300025906 | Ga0207699_10258528 | Ga0207699_102585282 | 154 |
| 143 | 3300025909 | Ga0207705_10019819 | Ga0207705_100198192 | 154 |
| 144 | 3300025919 | Ga0207657_10353374 | Ga0207657_103533742 | 154 |
| 145 | 3300025920 | Ga0207649_10963255 | Ga0207649_109632551 | 154 |
| 146 | 3300025925 | Ga0207650_10014804 | Ga0207650_100148042 | 154 |
| 147 | 3300025925 | Ga0207650_10045047 | Ga0207650_100450472 | 154 |
| 148 | 3300025925 | Ga0207650_10075835 | Ga0207650_100758352 | 154 |
| 149 | 3300025926 | Ga0207659_10002913 | Ga0207659_100029132 | 154 |
| 150 | 3300025926 | Ga0207659_10160483 | Ga0207659_101604832 | 154 |
| 151 | 3300025926 | Ga0207659_10375389 | Ga0207659_103753892 | 154 |
| 152 | 3300025928 | Ga0207700_10072832 | Ga0207700_100728322 | 154 |
| 153 | 3300025929 | Ga0207664_10201511 | Ga0207664_102015111 | 154 |
| 154 | 3300025931 | Ga0207644_10000425 | Ga0207644_1000042526 | 154 |
| 155 | 3300025931 | Ga0207644_10009529 | Ga0207644_100095293 | 154 |
| 156 | 3300025931 | Ga0207644_10181800 | Ga0207644_101818002 | 154 |
| 157 | 3300025932 | Ga0207690_10061755 | Ga0207690_100617552 | 154 |
| 158 | 3300025932 | Ga0207690_10085177 | Ga0207690_100851772 | 154 |
| 159 | 3300025933 | Ga0207706_10004122 | Ga0207706_100041226 | 154 |
| 160 | 3300025933 | Ga0207706_10285666 | Ga0207706_102856662 | 154 |
| 161 | 3300025933 | Ga0207706_10327590 | Ga0207706_103275902 | 154 |
| 162 | 3300025933 | Ga0207706_10554199 | Ga0207706_105541991 | 154 |
| 163 | 3300025939 | Ga0207665_10100121 | Ga0207665_101001211 | 154 |
| 164 | 3300025940 | Ga0207691_10014418 | Ga0207691_100144182 | 154 |
| 165 | 3300025940 | Ga0207691_10059566 | Ga0207691_100595662 | 154 |
| 166 | 3300025941 | Ga0207711_10000122 | Ga0207711_1000012233 | 154 |
| 167 | 3300025941 | Ga0207711_10006525 | Ga0207711_100065252 | 154 |
| 168 | 3300025941 | Ga0207711_10095874 | Ga0207711_100958742 | 154 |
| 169 | 3300025944 | Ga0207661_11432287 | Ga0207661_114322871 | 154 |
| 170 | 3300025945 | Ga0207679_10195849 | Ga0207679_101958492 | 154 |
| 171 | 3300025945 | Ga0207679_10314767 | Ga0207679_103147671 | 154 |
| 172 | 3300025960 | Ga0207651_10086827 | Ga0207651_100868272 | 154 |
| 173 | 3300025986 | Ga0207658_10127849 | Ga0207658_101278492 | 154 |
| 174 | 3300025986 | Ga0207658_10547499 | Ga0207658_105474991 | 154 |
| 175 | 3300026035 | Ga0207703_10030405 | Ga0207703_100304055 | 154 |
| 176 | 3300026035 | Ga0207703_11467172 | Ga0207703_114671721 | 154 |
| 177 | 3300026067 | Ga0207678_10081544 | Ga0207678_100815442 | 154 |
| 178 | 3300026088 | Ga0207641_10026291 | Ga0207641_100262912 | 154 |
| 179 | 3300026088 | Ga0207641_10123568 | Ga0207641_101235682 | 154 |
| 180 | 3300026089 | Ga0207648_10324898 | Ga0207648_103248982 | 154 |
| 181 | 3300026095 | Ga0207676_10008045 | Ga0207676_100080452 | 154 |
| 182 | 3300026095 | Ga0207676_10019364 | Ga0207676_100193647 | 154 |
| 183 | 3300026095 | Ga0207676_10021889 | Ga0207676_100218893 | 154 |
| 184 | 3300026095 | Ga0207676_10099060 | Ga0207676_100990602 | 154 |
| 185 | 3300026095 | Ga0207676_10815577 | Ga0207676_108155772 | 154 |
| 186 | 3300026116 | Ga0207674_10035202 | Ga0207674_100352025 | 154 |
| 187 | 3300026121 | Ga0207683_10009993 | Ga0207683_100099935 | 154 |
| 188 | 3300026121 | Ga0207683_10425391 | Ga0207683_104253912 | 154 |
| 189 | 3300026142 | Ga0207698_10104924 | Ga0207698_101049242 | 154 |
| 190 | 3300028381 | Ga0268264_10931191 | Ga0268264_109311911 | 154 |
| 191 | 3300031731 | Ga0307405_10225059 | Ga0307405_102250592 | 154 |
| 192 | 3300031731 | Ga0307405_10256627 | Ga0307405_102566272 | 154 |
| 193 | 3300031824 | Ga0307413_10080438 | Ga0307413_100804382 | 154 |
| 194 | 3300031911 | Ga0307412_10167979 | Ga0307412_101679792 | 154 |
| 195 | 3300031995 | Ga0307409_100058613 | Ga0307409_1000586131 | 154 |
| 196 | 3300031995 | Ga0307409_100296773 | Ga0307409_1002967734 | 154 |
| 197 | 3300031995 | Ga0307409_100984264 | Ga0307409_1009842642 | 154 |
| 198 | 3300032002 | Ga0307416_100116452 | Ga0307416_1001164522 | 154 |
| 199 | 3300036401 | Ga0373937_1157962 | Ga0373937_1157962_19_501 | 154 |
| 200 | 3300037312 | Ga0395899_0130536 | Ga0395899_0130536_852_1334 | 154 |
| 201 | 3300037312 | Ga0395899_0302520 | Ga0395899_0302520_190_672 | 154 |
| 202 | 3300037418 | Ga0395900_0215996 | Ga0395900_0215996_792_1274 | 154 |
| 203 | 3300037418 | Ga0395900_0514742 | Ga0395900_0514742_310_786 | 154 |
| 204 | 3300037471 | Ga0395905_0026518 | Ga0395905_0026518_126_608 | 154 |
| 205 | 3300037471 | Ga0395905_0129228 | Ga0395905_0129228_945_1427 | 154 |
| 206 | 3300037471 | Ga0395905_0157589 | Ga0395905_0157589_497_979 | 154 |
| 207 | 3300037471 | Ga0395905_0161244 | Ga0395905_0161244_1059_1541 | 154 |
| 208 | 3300037471 | Ga0395905_0228872 | Ga0395905_0228872_808_1284 | 154 |
| 209 | 3300038443 | Ga0395901_0642177 | Ga0395901_0642177_521_1003 | 154 |
| 210 | 3300038443 | Ga0395901_0980151 | Ga0395901_0980151_115_597 | 154 |
| 211 | 3300038996 | Ga0242420_055040 | Ga0242420_055040_37_510 | 154 |
| 212 | 3300046459 | Ga0495629_0241506 | Ga0495629_0241506_295_777 | 154 |
| 213 | 3300046472 | Ga0495580_0120363 | Ga0495580_0120363_659_1141 | 154 |
| 214 | 3300046492 | Ga0495585_0076559 | Ga0495585_0076559_299_775 | 154 |
| 215 | 3300046523 | Ga0495644_0187836 | Ga0495644_0187836_270_746 | 154 |
| 216 | 3300046525 | Ga0495663_0001007 | Ga0495663_0001007_7911_8387 | 154 |
| 217 | 3300046525 | Ga0495663_0178682 | Ga0495663_0178682_237_719 | 154 |
| 218 | 3300046528 | Ga0495642_0373996 | Ga0495642_0373996_80_556 | 154 |
| 219 | 3300046537 | Ga0495598_0000300 | Ga0495598_0000300_3535_4011 | 154 |
| 220 | 3300046539 | Ga0495621_0005399 | Ga0495621_0005399_1884_2360 | 154 |
| 221 | 3300046558 | Ga0495633_0006030 | Ga0495633_0006030_5161_5637 | 154 |
| 222 | 3300046664 | Ga0495659_0299541 | Ga0495659_0299541_41_517 | 154 |
| 223 | 3300046665 | Ga0495661_0028885 | Ga0495661_0028885_2879_3355 | 154 |
| 224 | 3300046691 | Ga0495670_0002214 | Ga0495670_0002214_7607_8083 | 154 |
| 225 | 3300047445 | Ga0495677_0010062 | Ga0495677_0010062_865_1341 | 154 |
| 226 | 3300047445 | Ga0495677_0090768 | Ga0495677_0090768_222_704 | 154 |
| 227 | 3300048903 | Ga0496100_0025228 | Ga0496100_0025228_115_597 | 154 |
| 228 | 3300048904 | Ga0496101_0008590 | Ga0496101_0008590_5616_6098 | 154 |
| 229 | 3300048904 | Ga0496101_0411696 | Ga0496101_0411696_146_628 | 154 |
| 230 | 3300048905 | Ga0496102_0344749 | Ga0496102_0344749_464_946 | 154 |
| 231 | 3300048908 | Ga0496105_0419392 | Ga0496105_0419392_71_553 | 154 |
| 232 | 3300048909 | Ga0496106_0001364 | Ga0496106_0001364_17069_17551 | 154 |
| 233 | 3300048909 | Ga0496106_0284012 | Ga0496106_0284012_574_1056 | 154 |
| 234 | 3300048910 | Ga0496107_0001881 | Ga0496107_0001881_8212_8694 | 154 |
| 235 | 3300048911 | Ga0496108_0014599 | Ga0496108_0014599_5506_5988 | 154 |
| 236 | 3300048911 | Ga0496108_0173091 | Ga0496108_0173091_379_861 | 154 |
| 237 | 3300048911 | Ga0496108_0198141 | Ga0496108_0198141_476_958 | 154 |
| 238 | 3300048912 | Ga0496109_0000659 | Ga0496109_0000659_24750_25232 | 154 |
| 239 | 3300048912 | Ga0496109_0017334 | Ga0496109_0017334_468_950 | 154 |
| 240 | 3300048912 | Ga0496109_0049271 | Ga0496109_0049271_3018_3500 | 154 |
| 241 | 3300048913 | Ga0496110_0194536 | Ga0496110_0194536_445_927 | 154 |
| 242 | 3300048914 | Ga0496111_0025865 | Ga0496111_0025865_3171_3653 | 154 |
| 243 | 3300048914 | Ga0496111_0092584 | Ga0496111_0092584_525_1007 | 154 |
| 244 | 3300048914 | Ga0496111_0134440 | Ga0496111_0134440_1076_1558 | 154 |
| 245 | 3300048915 | Ga0496112_0001821 | Ga0496112_0001821_11153_11635 | 154 |
| 246 | 3300048915 | Ga0496112_0010868 | Ga0496112_0010868_4857_5339 | 154 |
| 247 | 3300048915 | Ga0496112_0043472 | Ga0496112_0043472_1460_1942 | 154 |
| 248 | 3300048916 | Ga0496113_0029770 | Ga0496113_0029770_2543_3025 | 154 |
| 249 | 3300048916 | Ga0496113_0102681 | Ga0496113_0102681_1226_1708 | 154 |
| 250 | 3300048916 | Ga0496113_0112213 | Ga0496113_0112213_1161_1643 | 154 |
| 251 | 3300049582 | Ga0501048_0383878 | Ga0501048_0383878_423_896 | 154 |
| 252 | 3300049583 | Ga0501067_0064644 | Ga0501067_0064644_1424_1897 | 154 |
| 253 | 3300049585 | Ga0501069_0105140 | Ga0501069_0105140_1013_1486 | 154 |
| 254 | 3300049587 | Ga0501071_0693786 | Ga0501071_0693786_299_772 | 154 |
| 255 | 3300049592 | Ga0501076_0233970 | Ga0501076_0233970_642_1196 | 154 |
| 256 | 3300049679 | Ga0501249_046757 | Ga0501249_046757_405_881 | 154 |
| 257 | 3300049743 | Ga0501081_0564661 | Ga0501081_0564661_33_506 | 154 |
| 258 | 3300050507 | nmdc:mga05p37_70842_c1 | nmdc:mga05p37_70842_c1_2081_2554 | 154 |
| 259 | 3300054114 | Ga0501084_0093200 | Ga0501084_0093200_1207_1761 | 154 |
| 260 | 3300054114 | Ga0501084_0442295 | Ga0501084_0442295_321_794 | 154 |
| 261 | 3300060353 | Ga0501082_0463046 | Ga0501082_0463046_261_755 | 154 |
| 262 | 3300022467 | Ga0224712_10329793 | Ga0224712_103297932 | 155 |
| 263 | 3300031903 | Ga0307407_11069437 | Ga0307407_110694371 | 155 |
| 264 | 3300042006 | Ga0439432_065292 | Ga0439432_065292_214_705 | 155 |
| 265 | 3300049581 | Ga0501047_0134146 | Ga0501047_0134146_1769_2245 | 155 |
| 266 | 3300049742 | Ga0501080_0151806 | Ga0501080_0151806_612_1088 | 155 |
| 267 | 3300049823 | Ga0501044_0478124 | Ga0501044_0478124_363_839 | 155 |
| 268 | 3300053119 | Ga0500595_011705 | Ga0500595_011705_735_1211 | 155 |
| 269 | 3300005434 | Ga0070709_10446408 | Ga0070709_104464081 | 156 |
| 270 | 3300005435 | Ga0070714_101055813 | Ga0070714_1010558131 | 156 |
| 271 | 3300005445 | Ga0070708_100091700 | Ga0070708_1000917002 | 156 |
| 272 | 3300005467 | Ga0070706_100087106 | Ga0070706_1000871062 | 156 |
| 273 | 3300005467 | Ga0070706_100273138 | Ga0070706_1002731382 | 156 |
| 274 | 3300005468 | Ga0070707_100193096 | Ga0070707_1001930962 | 156 |
| 275 | 3300005471 | Ga0070698_100071801 | Ga0070698_1000718014 | 156 |
| 276 | 3300005518 | Ga0070699_100070745 | Ga0070699_1000707455 | 156 |
| 277 | 3300005536 | Ga0070697_100089836 | Ga0070697_1000898364 | 156 |
| 278 | 3300005985 | Ga0081539_10009382 | Ga0081539_100093825 | 156 |
| 279 | 3300005985 | Ga0081539_10456073 | Ga0081539_104560731 | 156 |
| 280 | 3300006028 | Ga0070717_10034545 | Ga0070717_100345454 | 156 |
| 281 | 3300020080 | Ga0206350_11540781 | Ga0206350_115407811 | 156 |
| 282 | 3300025910 | Ga0207684_10135407 | Ga0207684_101354073 | 156 |
| 283 | 3300025910 | Ga0207684_10231008 | Ga0207684_102310083 | 156 |
| 284 | 3300025922 | Ga0207646_10120539 | Ga0207646_101205393 | 156 |
| 285 | 3300025922 | Ga0207646_10390034 | Ga0207646_103900341 | 156 |
| 286 | 3300025939 | Ga0207665_10371038 | Ga0207665_103710381 | 156 |
| 287 | 3300049581 | Ga0501047_0221795 | Ga0501047_0221795_745_1224 | 156 |
| 288 | 3300049583 | Ga0501067_0071261 | Ga0501067_0071261_14_493 | 156 |
| 289 | 3300049589 | Ga0501073_0133713 | Ga0501073_0133713_1048_1527 | 156 |
| 290 | 3300049742 | Ga0501080_0403801 | Ga0501080_0403801_103_582 | 156 |
| 291 | 3300049744 | Ga0501083_0028997 | Ga0501083_0028997_657_1136 | 156 |
| 292 | 3300060353 | Ga0501082_0764786 | Ga0501082_0764786_14_493 | 156 |
| 293 | 3300005327 | Ga0070658_10206480 | Ga0070658_102064803 | 157 |
| 294 | 3300005339 | Ga0070660_100591016 | Ga0070660_1005910162 | 157 |
| 295 | 3300009177 | Ga0105248_10028157 | Ga0105248_100281572 | 157 |
| 296 | 3300013306 | Ga0163162_10910008 | Ga0163162_109100082 | 157 |
| 297 | 3300013308 | Ga0157375_10174430 | Ga0157375_101744304 | 157 |
| 298 | 3300037418 | Ga0395900_0121363 | Ga0395900_0121363_1870_2370 | 157 |
| 299 | 3300037471 | Ga0395905_0005799 | Ga0395905_0005799_6157_6657 | 157 |
| 300 | 3300044706 | Ga0466964_0437062 | Ga0466964_0437062_64_588 | 157 |
| 301 | 3300045976 | Ga0466967_0008200 | Ga0466967_0008200_467_991 | 157 |
| 302 | 3300048910 | Ga0496107_0338072 | Ga0496107_0338072_339_875 | 157 |
| 303 | 3300048911 | Ga0496108_0271548 | Ga0496108_0271548_196_732 | 157 |
| 304 | 3300048913 | Ga0496110_0003992 | Ga0496110_0003992_9354_9890 | 157 |
| 305 | 3300048914 | Ga0496111_0041989 | Ga0496111_0041989_359_895 | 157 |
| 306 | 3300049522 | Ga0501299_134645 | Ga0501299_134645_27_539 | 157 |
| 307 | 3300005293 | Ga0065715_10090986 | Ga0065715_100909868 | 159 |
| 308 | 3300005441 | Ga0070700_100552578 | Ga0070700_1005525781 | 159 |
| 309 | 3300005459 | Ga0068867_100577831 | Ga0068867_1005778312 | 159 |
| 310 | 3300005471 | Ga0070698_100110045 | Ga0070698_1001100455 | 159 |
| 311 | 3300005471 | Ga0070698_100820213 | Ga0070698_1008202132 | 159 |
| 312 | 3300005518 | Ga0070699_101042521 | Ga0070699_1010425211 | 159 |
| 313 | 3300005536 | Ga0070697_101325308 | Ga0070697_1013253081 | 159 |
| 314 | 3300006358 | Ga0068871_101048852 | Ga0068871_1010488521 | 159 |
| 315 | 3300009176 | Ga0105242_10085135 | Ga0105242_100851352 | 159 |
| 316 | 3300009176 | Ga0105242_10664543 | Ga0105242_106645431 | 159 |
| 317 | 3300011119 | Ga0105246_10200844 | Ga0105246_102008442 | 159 |
| 318 | 3300013297 | Ga0157378_10244620 | Ga0157378_102446202 | 159 |
| 319 | 3300013306 | Ga0163162_10806952 | Ga0163162_108069522 | 159 |
| 320 | 3300013308 | Ga0157375_11103236 | Ga0157375_111032361 | 159 |
| 321 | 3300014325 | Ga0163163_11381464 | Ga0163163_113814641 | 159 |
| 322 | 3300025904 | Ga0207647_10435725 | Ga0207647_104357251 | 159 |
| 323 | 3300026121 | Ga0207683_10564861 | Ga0207683_105648611 | 159 |
| 324 | 3300032126 | Ga0307415_100320119 | Ga0307415_1003201191 | 159 |
| 325 | 3300035241 | Ga0373961_0001266 | Ga0373961_0001266_4977_5468 | 159 |
| 326 | 3300035692 | Ga0373935_0823706 | Ga0373935_0823706_34_528 | 159 |
| 327 | 3300048909 | Ga0496106_0439237 | Ga0496106_0439237_229_735 | 159 |
| 328 | 3300009094 | Ga0111539_10998646 | Ga0111539_109986462 | 164 |
| 329 | 3300005289 | Ga0065704_10485128 | Ga0065704_104851281 | 165 |
| 330 | 3300005295 | Ga0065707_10130117 | Ga0065707_101301172 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3itw-assembly1.cif.gz_B-2 | crystal structure of tiox from micromonospora sp. ml1 | 0.7943 | 13 | 143 |
| 1xy7-assembly1.cif.gz_B | x-ray structure of gene product from arabidopsis thaliana at5g48480 | 0.7891 | 12 | 136 |
| 3itw-assembly1.cif.gz_B-2 | crystal structure of tiox from micromonospora sp. ml1 | 0.7884 | 13 | 143 |
| 3itw-assembly1.cif.gz_A-2 | crystal structure of tiox from micromonospora sp. ml1 | 0.7876 | 12 | 138 |
| 1xy7-assembly1.cif.gz_A | x-ray structure of gene product from arabidopsis thaliana at5g48480 | 0.7804 | 12 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9359 | 81 | 151 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9101 | 81 | 151 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8577 | 83 | 138 | 3.30.720.110 |
| 2zw4A02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8044 | 13 | 137 | 3.10.180.10 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8027 | 83 | 144 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E6PKE6-F1-model_v4 | Glyoxalase | 0.954 | 19 | 156 |
|
| AF-A0A4R5K6X6-F1-model_v4 | VOC family protein | 0.9501 | 19 | 140 |
|
| AF-A0A2E9T231-F1-model_v4 | Glyoxalase | 0.9493 | 69 | 161 |
|
| AF-A0A523KTB3-F1-model_v4 | deleted | 0.9484 | 6 | 143 |
|
| AF-A0A1I3F6H9-F1-model_v4 | PhnB protein | 0.9446 | 13 | 156 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar