F409726

General Info

Members Datasets Scaffolds Average Seq Length
329 167 658 113

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100191417|Ga0307408_1001914172
Length 127
Sequence MEPANRTATLHVRRGAPGEAVRFDDFQVPYEDGMSVLDALRWIRTHLDSSLAIRYSCINANACKTCMALVNGEVEYTCIAKLTAKLTTVEPLPKRPLIRDLVTDVIPDDEKAYPSDSVDSGRVTVRS

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
53 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
83 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
84 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
113 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
159 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
160 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
161 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
164 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
165 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 0
Rhizosphere 97.87
Stem 0
Stem Tuber 0
Unclassified 30.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100191417 3300031548 Bacteria 1648
2 JGI25405J52794_10055278 3300003911 Unclassified 854
3 Ga0065715_10202649 3300005293 Bacteria 1353
4 Ga0065715_10330126 3300005293 Unclassified 985
5 Ga0065707_10216147 3300005295 Unclassified 1244
6 Ga0065707_10303899 3300005295 Bacteria 989
7 Ga0070690_100792370 3300005330 Bacteria 734
8 Ga0070670_101416606 3300005331 Unclassified 637
9 Ga0068869_100151229 3300005334 Bacteria 1801
10 Ga0070689_100506129 3300005340 Bacteria 1035
11 Ga0070689_100544354 3300005340 Unclassified 999
12 Ga0070691_10215325 3300005341 Unclassified 1015
13 Ga0070691_10452617 3300005341 Bacteria 733
14 Ga0070692_10455763 3300005345 Bacteria 819
15 Ga0070668_100364127 3300005347 Bacteria 1227
16 Ga0070669_102033686 3300005353 Unclassified 502
17 Ga0070659_100184484 3300005366 Unclassified 1713
18 Ga0070703_10053250 3300005406 Bacteria 1301
19 Ga0070711_101590661 3300005439 Bacteria 571
20 Ga0070705_100632064 3300005440 Unclassified 832
21 Ga0070694_100440116 3300005444 Bacteria 1027
22 Ga0070694_101123380 3300005444 Unclassified 656
23 Ga0070681_10005942 3300005458 Bacteria 11814
24 Ga0070706_100059305 3300005467 Bacteria 3531
25 Ga0070706_100319031 3300005467 Unclassified 1449
26 Ga0070706_100356959 3300005467 Bacteria 1362
27 Ga0070707_100256518 3300005468 Bacteria 1701
28 Ga0070707_101033533 3300005468 Unclassified 787
29 Ga0070698_100000549 3300005471 Bacteria 40084
30 Ga0070698_100139284 3300005471 Unclassified 2379
31 Ga0070698_100425904 3300005471 Bacteria 1262
32 Ga0070698_101071265 3300005471 Unclassified 754
33 Ga0070698_101194389 3300005471 Bacteria 710
34 Ga0070699_100005284 3300005518 Bacteria 11329
35 Ga0070679_100398326 3300005530 Bacteria 1322
36 Ga0070697_100220027 3300005536 Unclassified 1618
37 Ga0070697_100393157 3300005536 Unclassified 1202
38 Ga0070686_101267947 3300005544 Unclassified 614
39 Ga0070695_100008019 3300005545 Bacteria 6257
40 Ga0070695_100052482 3300005545 Bacteria 2620
41 Ga0070695_101312611 3300005545 Unclassified 598
42 Ga0070696_100022850 3300005546 Bacteria 4252
43 Ga0070696_100460594 3300005546 Unclassified 1005
44 Ga0070696_100681391 3300005546 Bacteria 836
45 Ga0070696_101200237 3300005546 Unclassified 641
46 Ga0070704_100139314 3300005549 Bacteria 1892
47 Ga0070704_100275447 3300005549 Unclassified 1392
48 Ga0070704_100673229 3300005549 Bacteria 915
49 Ga0070702_100002690 3300005615 Bacteria 7766
50 Ga0068859_100385028 3300005617 Unclassified 1498
51 Ga0068864_102384696 3300005618 Unclassified 535
52 Ga0068860_100683273 3300005843 Bacteria 1036
53 Ga0068862_100871202 3300005844 Bacteria 884
54 Ga0081455_10000510 3300005937 Bacteria 50312
55 Ga0081455_10098338 3300005937 Bacteria 2356
56 Ga0081538_10009479 3300005981 Bacteria 8122
57 Ga0070715_10105745 3300006163 Bacteria 1320
58 Ga0068871_101448626 3300006358 Bacteria 648
59 Ga0075430_100105598 3300006846 Unclassified 2350
60 Ga0075430_100590469 3300006846 Bacteria 916
61 Ga0075431_100004783 3300006847 Bacteria 13314
62 Ga0075431_100329673 3300006847 Unclassified 1537
63 Ga0075431_100430573 3300006847 Bacteria 1317
64 Ga0075433_10011497 3300006852 Bacteria 7128
65 Ga0075433_10168661 3300006852 Bacteria 1948
66 Ga0075433_10318759 3300006852 Bacteria 1375
67 Ga0075433_10761430 3300006852 Bacteria 847
68 Ga0075433_11387298 3300006852 Unclassified 608
69 Ga0075434_100016897 3300006871 Bacteria 7019
70 Ga0075434_100166165 3300006871 Bacteria 2227
71 Ga0075434_100257621 3300006871 Unclassified 1763
72 Ga0075434_100369443 3300006871 Bacteria 1455
73 Ga0075434_100512996 3300006871 Bacteria 1219
74 Ga0075429_100125002 3300006880 Bacteria 2249
75 Ga0075429_100364376 3300006880 Bacteria 1265
76 Ga0075429_100561342 3300006880 Bacteria 1000
77 Ga0075429_101084035 3300006880 Unclassified 700
78 Ga0075429_101154780 3300006880 Unclassified 676
79 Ga0075429_101694400 3300006880 Bacteria 549
80 Ga0075436_100138338 3300006914 Bacteria 1711
81 Ga0075436_100731191 3300006914 Bacteria 734
82 Ga0097620_100385069 3300006931 Unclassified 1498
83 Ga0075435_100058738 3300007076 Bacteria 3116
84 Ga0075435_100069781 3300007076 Bacteria 2867
85 Ga0075435_100157385 3300007076 Bacteria 1912
86 Ga0075435_100255686 3300007076 Bacteria 1492
87 Ga0075435_100754146 3300007076 Bacteria 847
88 Ga0075435_101603977 3300007076 Unclassified 571
89 Ga0111539_10067540 3300009094 Bacteria 4222
90 Ga0111539_10210719 3300009094 Bacteria 2264
91 Ga0111539_11168744 3300009094 Bacteria 894
92 Ga0105247_11287556 3300009101 Unclassified 586
93 Ga0114129_10031583 3300009147 Bacteria 7485
94 Ga0114129_10108309 3300009147 Bacteria 3836
95 Ga0114129_10251045 3300009147 Viruses 2375
96 Ga0114129_10562778 3300009147 Unclassified 1481
97 Ga0114129_10633584 3300009147 Bacteria 1382
98 Ga0114129_11011993 3300009147 Unclassified 1046
99 Ga0114129_11146729 3300009147 Bacteria 971
100 Ga0114129_11678937 3300009147 Bacteria 776
101 Ga0114129_12453631 3300009147 Unclassified 624
102 Ga0105243_10103371 3300009148 Bacteria 2369
103 Ga0105243_10577381 3300009148 Bacteria 1079
104 Ga0105249_10601454 3300009553 Bacteria 1154
105 Ga0105246_10932354 3300011119 Unclassified 781
106 Ga0157335_1045153 3300012492 Bacteria 510
107 Ga0157316_1003661 3300012510 Bacteria 1122
108 Ga0157378_10215019 3300013297 Bacteria 1825
109 Ga0157378_10235333 3300013297 Bacteria 1747
110 Ga0157375_10557235 3300013308 Bacteria 1307
111 Ga0157380_10210018 3300014326 Unclassified 1734
112 Ga0157380_11472921 3300014326 Unclassified 733
113 Ga0207684_10267372 3300025910 Bacteria 1475
114 Ga0207707_10976269 3300025912 Bacteria 696
115 Ga0207663_11174400 3300025916 Bacteria 618
116 Ga0207660_11050472 3300025917 Bacteria 664
117 Ga0207652_10346189 3300025921 Bacteria 1341
118 Ga0207686_10292698 3300025934 Bacteria 1206
119 Ga0207709_10026940 3300025935 Bacteria 3306
120 Ga0207670_10412770 3300025936 Bacteria 1082
121 Ga0207665_10054961 3300025939 Bacteria 2685
122 Ga0207712_11320886 3300025961 Bacteria 645
123 Ga0207668_10422043 3300025972 Bacteria 1132
124 Ga0207641_10855396 3300026088 Unclassified 902
125 Ga0209973_1003367 3300027252 Bacteria 1569
126 Ga0209984_1003624 3300027424 Unclassified 1777
127 Ga0209982_1009835 3300027552 Unclassified 1416
128 Ga0210002_1006393 3300027617 Unclassified 1777
129 Ga0209971_1006702 3300027682 Bacteria 2726
130 Ga0209971_1053569 3300027682 Bacteria 975
131 Ga0209998_10009872 3300027717 Unclassified 1979
132 Ga0209974_10009582 3300027876 Unclassified 3288
133 Ga0209974_10068895 3300027876 Bacteria 1205
134 Ga0207428_10203021 3300027907 Bacteria 1491
135 Ga0268264_10646775 3300028381 Bacteria 1046
136 Ga0307405_10011768 3300031731 Bacteria 4604
137 Ga0307410_10124370 3300031852 Bacteria 1886
138 Ga0307409_100570304 3300031995 Bacteria 1114
139 Ga0307415_100084121 3300032126 Bacteria 2282
140 Ga0373928_0024613 3300035084 Unclassified 1292
141 Ga0373929_0030413 3300035085 Unclassified 1151
142 Ga0373923_0419843 3300035111 Bacteria 646
143 Ga0373939_0360098 3300035114 Bacteria 594
144 Ga0373941_0225980 3300035115 Unclassified 721
145 Ga0373945_0532089 3300035116 Bacteria 526
146 Ga0373956_0412973 3300035119 Unclassified 644
147 Ga0373943_0070177 3300035170 Bacteria 1772
148 Ga0373942_0062918 3300035207 Unclassified 1067
149 Ga0373961_0055213 3300035241 Unclassified 1189
150 Ga0373931_0039743 3300035691 Bacteria 2465
151 Ga0373931_0263074 3300035691 Bacteria 1053
152 Ga0373927_0913594 3300035695 Bacteria 579
153 Ga0373925_1132583 3300037068 Bacteria 643
154 Ga0436365_0488004 3300039437 Bacteria 886
155 Ga0439441_077972 3300042001 Unclassified 718
156 Ga0439435_0073942 3300042436 Bacteria 1013
157 Ga0439464_0199475 3300042439 Unclassified 638
158 Ga0451577_0441706 3300042876 Bacteria 1181
159 Ga0453684_1993315 3300044712 Unclassified 585
160 Ga0451576_1323443 3300045051 Bacteria 751
161 Ga0451576_1390822 3300045051 Unclassified 730
162 Ga0451576_2666750 3300045051 Bacteria 509
163 Ga0495580_0151011 3300046472 Bacteria 1609
164 Ga0495580_0190407 3300046472 Bacteria 1415
165 Ga0495639_0244053 3300046475 Bacteria 887
166 Ga0495584_0012533 3300046491 Bacteria 4328
167 Ga0495630_0723300 3300046517 Bacteria 761
168 Ga0495642_0016202 3300046528 Bacteria 2903
169 Ga0495586_0332074 3300046535 Bacteria 872
170 Ga0495598_0011648 3300046537 Bacteria 2138
171 Ga0495656_0419131 3300046615 Unclassified 702
172 Ga0495659_0036998 3300046664 Bacteria 1727
173 Ga0495613_0421063 3300046689 Bacteria 909
174 Ga0495636_0003100 3300047318 Bacteria 6447
175 Ga0495677_0111507 3300047445 Bacteria 1040
176 Ga0496126_1020129 3300048929 Bacteria 620
177 Ga0501031_0271643 3300049568 Unclassified 1100
178 Ga0501031_0477430 3300049568 Bacteria 805
179 Ga0501032_0039421 3300049569 Bacteria 3213
180 Ga0501033_0046725 3300049570 Bacteria 3219
181 Ga0501033_0143686 3300049570 Unclassified 1724
182 Ga0501033_0977640 3300049570 Unclassified 566
183 Ga0501036_0011463 3300049572 Bacteria 7337
184 Ga0501036_0059103 3300049572 Bacteria 3248
185 Ga0501037_0012929 3300049573 Bacteria 6152
186 Ga0501037_0404757 3300049573 Unclassified 935
187 Ga0501038_0017147 3300049574 Bacteria 6548
188 Ga0501038_0203278 3300049574 Bacteria 1589
189 Ga0501038_0294929 3300049574 Unclassified 1273
190 Ga0501038_0433315 3300049574 Bacteria 1013
191 Ga0501039_0008505 3300049575 Bacteria 7825
192 Ga0501039_0540368 3300049575 Unclassified 914
193 Ga0501039_0934139 3300049575 Bacteria 675
194 Ga0501040_0000404 3300049576 Bacteria 25463
195 Ga0501040_0059238 3300049576 Bacteria 2631
196 Ga0501040_0498094 3300049576 Bacteria 878
197 Ga0501040_0665634 3300049576 Unclassified 752
198 Ga0501041_0009282 3300049577 Bacteria 5792
199 Ga0501041_0019446 3300049577 Bacteria 4056
200 Ga0501041_0078358 3300049577 Unclassified 2034
201 Ga0501041_0224508 3300049577 Bacteria 1179
202 Ga0501042_0000248 3300049578 Bacteria 26201
203 Ga0501042_0071808 3300049578 Bacteria 2476
204 Ga0501043_0066369 3300049579 Bacteria 2833
205 Ga0501043_0175554 3300049579 Bacteria 1670
206 Ga0501043_1220500 3300049579 Unclassified 527
207 Ga0501046_0003376 3300049580 Bacteria 14655
208 Ga0501046_0179912 3300049580 Bacteria 1582
209 Ga0501046_0288614 3300049580 Bacteria 1200
210 Ga0501046_0469560 3300049580 Unclassified 903
211 Ga0501047_1382798 3300049581 Bacteria 519
212 Ga0501048_0006932 3300049582 Bacteria 8610
213 Ga0501048_0168168 3300049582 Unclassified 1552
214 Ga0501048_1286023 3300049582 Bacteria 526
215 Ga0501068_0034298 3300049584 Bacteria 3027
216 Ga0501068_0107493 3300049584 Bacteria 1732
217 Ga0501068_1193420 3300049584 Bacteria 504
218 Ga0501069_0012547 3300049585 Bacteria 4506
219 Ga0501070_0030672 3300049586 Bacteria 4504
220 Ga0501071_0000052 3300049587 Bacteria 39159
221 Ga0501071_0062557 3300049587 Bacteria 2696
222 Ga0501071_1233529 3300049587 Unclassified 578
223 Ga0501072_0000713 3300049588 Bacteria 24156
224 Ga0501072_0380187 3300049588 Unclassified 1120
225 Ga0501073_0043136 3300049589 Bacteria 3181
226 Ga0501073_0073960 3300049589 Bacteria 2372
227 Ga0501074_0026623 3300049590 Bacteria 4193
228 Ga0501074_0030222 3300049590 Bacteria 3926
229 Ga0501074_0079067 3300049590 Bacteria 2360
230 Ga0501074_0550168 3300049590 Bacteria 817
231 Ga0501075_0000063 3300049591 Bacteria 46368
232 Ga0501075_0042586 3300049591 Unclassified 3404
233 Ga0501075_0069437 3300049591 Bacteria 2662
234 Ga0501075_0180440 3300049591 Unclassified 1611
235 Ga0501075_0442503 3300049591 Bacteria 991
236 Ga0501075_0884636 3300049591 Unclassified 679
237 Ga0501075_1185230 3300049591 Bacteria 579
238 Ga0501076_0001288 3300049592 Bacteria 16714
239 Ga0501076_0021244 3300049592 Bacteria 4978
240 Ga0501076_0549175 3300049592 Unclassified 952
241 Ga0501076_0836240 3300049592 Unclassified 759
242 Ga0501077_0002064 3300049593 Bacteria 12110
243 Ga0501077_0014046 3300049593 Bacteria 5024
244 Ga0501077_0038770 3300049593 Bacteria 3034
245 Ga0501236_097919 3300049670 Unclassified 572
246 Ga0501079_0000071 3300049741 Bacteria 46894
247 Ga0501079_0102201 3300049741 Unclassified 2223
248 Ga0501079_0124459 3300049741 Bacteria 2005
249 Ga0501079_1008419 3300049741 Unclassified 656
250 Ga0501080_0014070 3300049742 Bacteria 7364
251 Ga0501080_0174266 3300049742 Bacteria 1982
252 Ga0501080_0219590 3300049742 Unclassified 1740
253 Ga0501081_0000780 3300049743 Bacteria 18678
254 Ga0501081_0051566 3300049743 Unclassified 2837
255 Ga0501081_0255155 3300049743 Bacteria 1280
256 Ga0501081_0899486 3300049743 Unclassified 667
257 Ga0501083_0102390 3300049744 Bacteria 1888
258 Ga0501083_0243269 3300049744 Unclassified 1171
259 Ga0501283_073580 3300049779 Unclassified 633
260 Ga0501035_0082058 3300049822 Bacteria 2845
261 Ga0501035_0236180 3300049822 Unclassified 1556
262 Ga0501044_0169250 3300049823 Bacteria 2157
263 Ga0501045_0001409 3300049824 Bacteria 16046
264 Ga0501045_0135147 3300049824 Unclassified 1833
265 Ga0501045_1100083 3300049824 Bacteria 581
266 nmdc:mga05p37_1190770_c1 3300050507 Bacteria 788
267 nmdc:mga05p37_125805_c1 3300050507 Bacteria 3148
268 nmdc:mga05p37_157961_c1 3300050507 Viruses 2770
269 nmdc:mga05p37_1787899_c1 3300050507 Unclassified 594
270 nmdc:mga05p37_264899_c1 3300050507 Bacteria 2055
271 nmdc:mga05p37_299643_c1 3300050507 Unclassified 1911
272 nmdc:mga05p37_358556_c1 3300050507 Bacteria 1715
273 nmdc:mga05p37_41982_c1 3300050507 Bacteria 5619
274 nmdc:mga05p37_648618_c1 3300050507 Bacteria 1183
275 nmdc:mga05p37_82842_c1 3300050507 Bacteria 3953
276 nmdc:mga09592_1006546_c1 3300050508 Unclassified 696
277 nmdc:mga09592_1413415_c1 3300050508 Unclassified 569
278 nmdc:mga09592_1559589_c1 3300050508 Unclassified 536
279 nmdc:mga09592_185354_c1 3300050508 Bacteria 1801
280 nmdc:mga09592_720021_c1 3300050508 Bacteria 848
281 nmdc:mga0qj67_29816_c1 3300050509 Bacteria 4239
282 nmdc:mga0qj67_541771_c1 3300050509 Bacteria 934
283 nmdc:mga06r32_425703_c1 3300050510 Bacteria 1309
284 nmdc:mga06r32_863249_c1 3300050510 Unclassified 863
285 nmdc:mga06r32_91685_c1 3300050510 Unclassified 2970
286 nmdc:mga08y16_174588_c1 3300050511 Bacteria 2231
287 nmdc:mga08y16_1978546_c1 3300050511 Unclassified 532
288 nmdc:mga0n895_1690804_c1 3300050512 Unclassified 596
289 nmdc:mga0n895_238837_c1 3300050512 Bacteria 1844
290 nmdc:mga0n895_2787_c1 3300050512 Bacteria 13805
291 nmdc:mga0n895_823330_c1 3300050512 Bacteria 917
292 nmdc:mga0n895_90705_c1 3300050512 Bacteria 3058
293 nmdc:mga0rr50_127863_c1 3300050513 Bacteria 2031
294 nmdc:mga0rr50_166613_c1 3300050513 Unclassified 1792
295 nmdc:mga0rr50_333127_c1 3300050513 Bacteria 1274
296 nmdc:mga0rr50_4009_c1 3300050513 Bacteria 8587
297 nmdc:mga0rr50_564386_c1 3300050513 Bacteria 969
298 nmdc:mga0rr50_62977_c1 3300050513 Bacteria 2800
299 nmdc:mga08x19_117920_c1 3300050514 Bacteria 1776
300 nmdc:mga08x19_37485_c1 3300050514 Bacteria 3077
301 nmdc:mga0a205_188928_c1 3300050515 Unclassified 1953
302 nmdc:mga0a205_419968_c1 3300050515 Unclassified 1199
303 nmdc:mga0a205_71823_c1 3300050515 Bacteria 3343
304 nmdc:mga0a205_778621_c1 3300050515 Bacteria 805
305 nmdc:mga0a205_9015_c1 3300050515 Bacteria 9091
306 nmdc:mga0a205_92433_c1 3300050515 Bacteria 2923
307 nmdc:mga0a205_929433_c1 3300050515 Bacteria 717
308 Ga0500572_000124 3300053111 Bacteria 25923
309 Ga0500608_266702 3300053122 Bacteria 657
310 Ga0500559_0000614 3300053136 Bacteria 24153
311 Ga0500576_026605 3300053725 Bacteria 2639
312 Ga0500596_002185 3300053735 Bacteria 3875
313 Ga0501084_0000246 3300054114 Bacteria 40925
314 Ga0501084_0075830 3300054114 Bacteria 2817
315 Ga0501084_0585058 3300054114 Bacteria 943
316 Ga0501084_0732696 3300054114 Unclassified 833
317 Ga0501084_1398139 3300054114 Unclassified 586
318 Ga0590071_011394 3300059421 Bacteria 2081
319 Ga0590074_014352 3300059423 Bacteria 1340
320 Ga0590075_045347 3300059424 Bacteria 1126
321 Ga0501082_0020602 3300060353 Bacteria 5684
322 Ga0501082_0676281 3300060353 Unclassified 903
323 Ga0501082_1045116 3300060353 Unclassified 714
324 Ga0501082_1069076 3300060353 Unclassified 705
325 Ga0530510_0029728 3300061734 Bacteria 3922
326 Ga0530510_0043279 3300061734 Bacteria 3252
327 Ga0530510_0095699 3300061734 Bacteria 2170
328 Ga0530510_0222818 3300061734 Bacteria 1402
329 Ga0530510_0223557 3300061734 Unclassified 1399
330 Ga0307408_100191417
331 JGI25405J52794_10055278
332 Ga0065715_10202649
333 Ga0065715_10330126
334 Ga0065707_10216147
335 Ga0065707_10303899
336 Ga0070690_100792370
337 Ga0070670_101416606
338 Ga0068869_100151229
339 Ga0070689_100506129
340 Ga0070689_100544354
341 Ga0070691_10215325
342 Ga0070691_10452617
343 Ga0070692_10455763
344 Ga0070668_100364127
345 Ga0070669_102033686
346 Ga0070659_100184484
347 Ga0070703_10053250
348 Ga0070711_101590661
349 Ga0070705_100632064
350 Ga0070694_100440116
351 Ga0070694_101123380
352 Ga0070681_10005942
353 Ga0070706_100059305
354 Ga0070706_100319031
355 Ga0070706_100356959
356 Ga0070707_100256518
357 Ga0070707_101033533
358 Ga0070698_100000549
359 Ga0070698_100139284
360 Ga0070698_100425904
361 Ga0070698_101071265
362 Ga0070698_101194389
363 Ga0070699_100005284
364 Ga0070679_100398326
365 Ga0070697_100220027
366 Ga0070697_100393157
367 Ga0070686_101267947
368 Ga0070695_100008019
369 Ga0070695_100052482
370 Ga0070695_101312611
371 Ga0070696_100022850
372 Ga0070696_100460594
373 Ga0070696_100681391
374 Ga0070696_101200237
375 Ga0070704_100139314
376 Ga0070704_100275447
377 Ga0070704_100673229
378 Ga0070702_100002690
379 Ga0068859_100385028
380 Ga0068864_102384696
381 Ga0068860_100683273
382 Ga0068862_100871202
383 Ga0081455_10000510
384 Ga0081455_10098338
385 Ga0081538_10009479
386 Ga0070715_10105745
387 Ga0068871_101448626
388 Ga0075430_100105598
389 Ga0075430_100590469
390 Ga0075431_100004783
391 Ga0075431_100329673
392 Ga0075431_100430573
393 Ga0075433_10011497
394 Ga0075433_10168661
395 Ga0075433_10318759
396 Ga0075433_10761430
397 Ga0075433_11387298
398 Ga0075434_100016897
399 Ga0075434_100166165
400 Ga0075434_100257621
401 Ga0075434_100369443
402 Ga0075434_100512996
403 Ga0075429_100125002
404 Ga0075429_100364376
405 Ga0075429_100561342
406 Ga0075429_101084035
407 Ga0075429_101154780
408 Ga0075429_101694400
409 Ga0075436_100138338
410 Ga0075436_100731191
411 Ga0097620_100385069
412 Ga0075435_100058738
413 Ga0075435_100069781
414 Ga0075435_100157385
415 Ga0075435_100255686
416 Ga0075435_100754146
417 Ga0075435_101603977
418 Ga0111539_10067540
419 Ga0111539_10210719
420 Ga0111539_11168744
421 Ga0105247_11287556
422 Ga0114129_10031583
423 Ga0114129_10108309
424 Ga0114129_10251045
425 Ga0114129_10562778
426 Ga0114129_10633584
427 Ga0114129_11011993
428 Ga0114129_11146729
429 Ga0114129_11678937
430 Ga0114129_12453631
431 Ga0105243_10103371
432 Ga0105243_10577381
433 Ga0105249_10601454
434 Ga0105246_10932354
435 Ga0157335_1045153
436 Ga0157316_1003661
437 Ga0157378_10215019
438 Ga0157378_10235333
439 Ga0157375_10557235
440 Ga0157380_10210018
441 Ga0157380_11472921
442 Ga0207684_10267372
443 Ga0207707_10976269
444 Ga0207663_11174400
445 Ga0207660_11050472
446 Ga0207652_10346189
447 Ga0207686_10292698
448 Ga0207709_10026940
449 Ga0207670_10412770
450 Ga0207665_10054961
451 Ga0207712_11320886
452 Ga0207668_10422043
453 Ga0207641_10855396
454 Ga0209973_1003367
455 Ga0209984_1003624
456 Ga0209982_1009835
457 Ga0210002_1006393
458 Ga0209971_1006702
459 Ga0209971_1053569
460 Ga0209998_10009872
461 Ga0209974_10009582
462 Ga0209974_10068895
463 Ga0207428_10203021
464 Ga0268264_10646775
465 Ga0307405_10011768
466 Ga0307410_10124370
467 Ga0307409_100570304
468 Ga0307415_100084121
469 Ga0373928_0024613
470 Ga0373929_0030413
471 Ga0373923_0419843
472 Ga0373939_0360098
473 Ga0373941_0225980
474 Ga0373945_0532089
475 Ga0373956_0412973
476 Ga0373943_0070177
477 Ga0373942_0062918
478 Ga0373961_0055213
479 Ga0373931_0039743
480 Ga0373931_0263074
481 Ga0373927_0913594
482 Ga0373925_1132583
483 Ga0436365_0488004
484 Ga0439441_077972
485 Ga0439435_0073942
486 Ga0439464_0199475
487 Ga0451577_0441706
488 Ga0453684_1993315
489 Ga0451576_1323443
490 Ga0451576_1390822
491 Ga0451576_2666750
492 Ga0495580_0151011
493 Ga0495580_0190407
494 Ga0495639_0244053
495 Ga0495584_0012533
496 Ga0495630_0723300
497 Ga0495642_0016202
498 Ga0495586_0332074
499 Ga0495598_0011648
500 Ga0495656_0419131
501 Ga0495659_0036998
502 Ga0495613_0421063
503 Ga0495636_0003100
504 Ga0495677_0111507
505 Ga0496126_1020129
506 Ga0501031_0271643
507 Ga0501031_0477430
508 Ga0501032_0039421
509 Ga0501033_0046725
510 Ga0501033_0143686
511 Ga0501033_0977640
512 Ga0501036_0011463
513 Ga0501036_0059103
514 Ga0501037_0012929
515 Ga0501037_0404757
516 Ga0501038_0017147
517 Ga0501038_0203278
518 Ga0501038_0294929
519 Ga0501038_0433315
520 Ga0501039_0008505
521 Ga0501039_0540368
522 Ga0501039_0934139
523 Ga0501040_0000404
524 Ga0501040_0059238
525 Ga0501040_0498094
526 Ga0501040_0665634
527 Ga0501041_0009282
528 Ga0501041_0019446
529 Ga0501041_0078358
530 Ga0501041_0224508
531 Ga0501042_0000248
532 Ga0501042_0071808
533 Ga0501043_0066369
534 Ga0501043_0175554
535 Ga0501043_1220500
536 Ga0501046_0003376
537 Ga0501046_0179912
538 Ga0501046_0288614
539 Ga0501046_0469560
540 Ga0501047_1382798
541 Ga0501048_0006932
542 Ga0501048_0168168
543 Ga0501048_1286023
544 Ga0501068_0034298
545 Ga0501068_0107493
546 Ga0501068_1193420
547 Ga0501069_0012547
548 Ga0501070_0030672
549 Ga0501071_0000052
550 Ga0501071_0062557
551 Ga0501071_1233529
552 Ga0501072_0000713
553 Ga0501072_0380187
554 Ga0501073_0043136
555 Ga0501073_0073960
556 Ga0501074_0026623
557 Ga0501074_0030222
558 Ga0501074_0079067
559 Ga0501074_0550168
560 Ga0501075_0000063
561 Ga0501075_0042586
562 Ga0501075_0069437
563 Ga0501075_0180440
564 Ga0501075_0442503
565 Ga0501075_0884636
566 Ga0501075_1185230
567 Ga0501076_0001288
568 Ga0501076_0021244
569 Ga0501076_0549175
570 Ga0501076_0836240
571 Ga0501077_0002064
572 Ga0501077_0014046
573 Ga0501077_0038770
574 Ga0501236_097919
575 Ga0501079_0000071
576 Ga0501079_0102201
577 Ga0501079_0124459
578 Ga0501079_1008419
579 Ga0501080_0014070
580 Ga0501080_0174266
581 Ga0501080_0219590
582 Ga0501081_0000780
583 Ga0501081_0051566
584 Ga0501081_0255155
585 Ga0501081_0899486
586 Ga0501083_0102390
587 Ga0501083_0243269
588 Ga0501283_073580
589 Ga0501035_0082058
590 Ga0501035_0236180
591 Ga0501044_0169250
592 Ga0501045_0001409
593 Ga0501045_0135147
594 Ga0501045_1100083
595 nmdc:mga05p37_1190770_c1
596 nmdc:mga05p37_125805_c1
597 nmdc:mga05p37_157961_c1
598 nmdc:mga05p37_1787899_c1
599 nmdc:mga05p37_264899_c1
600 nmdc:mga05p37_299643_c1
601 nmdc:mga05p37_358556_c1
602 nmdc:mga05p37_41982_c1
603 nmdc:mga05p37_648618_c1
604 nmdc:mga05p37_82842_c1
605 nmdc:mga09592_1006546_c1
606 nmdc:mga09592_1413415_c1
607 nmdc:mga09592_1559589_c1
608 nmdc:mga09592_185354_c1
609 nmdc:mga09592_720021_c1
610 nmdc:mga0qj67_29816_c1
611 nmdc:mga0qj67_541771_c1
612 nmdc:mga06r32_425703_c1
613 nmdc:mga06r32_863249_c1
614 nmdc:mga06r32_91685_c1
615 nmdc:mga08y16_174588_c1
616 nmdc:mga08y16_1978546_c1
617 nmdc:mga0n895_1690804_c1
618 nmdc:mga0n895_238837_c1
619 nmdc:mga0n895_2787_c1
620 nmdc:mga0n895_823330_c1
621 nmdc:mga0n895_90705_c1
622 nmdc:mga0rr50_127863_c1
623 nmdc:mga0rr50_166613_c1
624 nmdc:mga0rr50_333127_c1
625 nmdc:mga0rr50_4009_c1
626 nmdc:mga0rr50_564386_c1
627 nmdc:mga0rr50_62977_c1
628 nmdc:mga08x19_117920_c1
629 nmdc:mga08x19_37485_c1
630 nmdc:mga0a205_188928_c1
631 nmdc:mga0a205_419968_c1
632 nmdc:mga0a205_71823_c1
633 nmdc:mga0a205_778621_c1
634 nmdc:mga0a205_9015_c1
635 nmdc:mga0a205_92433_c1
636 nmdc:mga0a205_929433_c1
637 Ga0500572_000124
638 Ga0500608_266702
639 Ga0500559_0000614
640 Ga0500576_026605
641 Ga0500596_002185
642 Ga0501084_0000246
643 Ga0501084_0075830
644 Ga0501084_0585058
645 Ga0501084_0732696
646 Ga0501084_1398139
647 Ga0590071_011394
648 Ga0590074_014352
649 Ga0590075_045347
650 Ga0501082_0020602
651 Ga0501082_0676281
652 Ga0501082_1045116
653 Ga0501082_1069076
654 Ga0530510_0029728
655 Ga0530510_0043279
656 Ga0530510_0095699
657 Ga0530510_0222818
658 Ga0530510_0223557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

9

109

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.8685 9 94
7d6x-assembly1.cif.gz_B mycobacterium smegmatis sdh1 complex in the apo form 0.8622 8 96
8gs8-assembly1.cif.gz_B cryo-em structure of the human respiratory complex ii 0.8503 9 97
1yq3-assembly1.cif.gz_B avian respiratory complex ii with oxaloacetate and ubiquinone 0.8456 7 97
5c3j-assembly1.cif.gz_B crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1 0.8438 10 97
ID Description Score Start End Superfamily
af_A0A0R4J5X9_38_147_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8449 4 98 3.10.20.30
af_A0A0R0FV32_13_111_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8259 11 102 3.10.20.30
af_Q57557_1_93_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8149 12 102 3.10.20.30
5xmjN01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8079 8 98 3.10.20.30
af_O53371_19_134_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8029 11 100 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7J4E6A4-F1-model_v4 Ferredoxin 0.889 9 96 GO:0003723
GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A535DTB7-F1-model_v4 Fumarate reductase iron-sulfur subunit (EC 1.3.5.1) 0.8883 11 96 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0046872
GO:0051537
GO:0051538
GO:0051539
AF-A0A848M6Y1-F1-model_v4 Succinate dehydogenase/fumarate reductase N-terminal domain-containing protein 0.8876 11 98 GO:0009055
GO:0009060
GO:0022904
GO:0051536
AF-A0A6L8A0E4-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit (EC 1.3.5.1) 0.886 9 84 GO:0009055
GO:0009060
GO:0022904
GO:0051537
AF-A0A1M6HVF0-F1-model_v4 Succinate dehydrogenase / fumarate reductase iron-sulfur subunit 0.8849 9 96 GO:0009055
GO:0009060
GO:0022904
GO:0051537

Map