F408879

General Info

Members Datasets Scaffolds Average Seq Length
327 208 327 148

Family's Representative Sequence

Representative Sequence 3300038742|Ga0400486_23548|Ga0400486_23548_1989_2507
Length 172
Sequence MLEQEASNAQLEIRCDPVTKKECREIQMGEKYILLVEDNPDDEILMLRSLKKNKIMNEIVVVRDGSEALEHLFCTGAYANRDPSILPQVVLLDLKLPKLDGFEVLAEIRSDERTKFLPVVILTSSKEEKDLFNSYKLGANSYVRKPIDFLQFSEAIKQLGLYWMILNEKPLL

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
96 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
109 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
110 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
111 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
122 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
123 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
124 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
127 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
149 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
150 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
151 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
154 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
177 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
183 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
201 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.12
Nodule 0.31
Rhizoplane 0.61
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 5.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1000223 3300002155 Bacteria 6649
2 JGI25153J46596_10000081 3300003215 Bacteria 113081
3 rootH1_10027991 3300003316 Bacteria 2463
4 rootH2_10050515 3300003320 Bacteria 5663
5 rootL2_10002696 3300003322 Bacteria 25570
6 rootL2_10006076 3300003322 Bacteria 16979
7 rootL2_10072798 3300003322 Bacteria 11928
8 Ga0065707_10082227 3300005295 Bacteria 18733
9 Ga0070676_11236431 3300005328 Bacteria 569
10 Ga0068869_100362377 3300005334 Bacteria 1184
11 Ga0070682_100118877 3300005337 Bacteria 1771
12 Ga0070660_100429185 3300005339 Bacteria 1095
13 Ga0070661_100001092 3300005344 Bacteria 19171
14 Ga0070661_100068707 3300005344 Bacteria 2604
15 Ga0070674_100037067 3300005356 Bacteria 3278
16 Ga0070688_101289399 3300005365 Unclassified 589
17 Ga0070659_100003230 3300005366 Bacteria 11602
18 Ga0070705_100011818 3300005440 Bacteria 4419
19 Ga0070678_100019921 3300005456 Bacteria 4389
20 Ga0070681_10032102 3300005458 Bacteria 5270
21 Ga0070681_10543176 3300005458 Unclassified 1076
22 Ga0070681_10707389 3300005458 Bacteria 923
23 Ga0070706_100000597 3300005467 Bacteria 41802
24 Ga0070706_100003764 3300005467 Bacteria 14807
25 Ga0070706_101258789 3300005467 Bacteria 679
26 Ga0070707_100019444 3300005468 Bacteria 6398
27 Ga0070707_100942492 3300005468 Bacteria 828
28 Ga0070698_100113689 3300005471 Bacteria 2672
29 Ga0070698_100155760 3300005471 Bacteria 2230
30 Ga0070699_100012162 3300005518 Bacteria 7427
31 Ga0070699_100209151 3300005518 Bacteria 1736
32 Ga0070699_100357509 3300005518 Bacteria 1316
33 Ga0070699_100777815 3300005518 Bacteria 876
34 Ga0070699_101540611 3300005518 Unclassified 609
35 Ga0070679_100106945 3300005530 Bacteria 2783
36 Ga0070697_100001945 3300005536 Bacteria 15810
37 Ga0070696_100472228 3300005546 Bacteria 993
38 Ga0070693_100122638 3300005547 Bacteria 1614
39 Ga0070665_102209634 3300005548 Unclassified 554
40 Ga0070704_100011477 3300005549 Bacteria 5430
41 Ga0070704_100372350 3300005549 Bacteria 1211
42 Ga0068856_102579174 3300005614 Unclassified 514
43 Ga0070702_100322748 3300005615 Bacteria 1077
44 Ga0068852_100007020 3300005616 Bacteria 8197
45 Ga0068852_100269724 3300005616 Bacteria 1637
46 Ga0068852_100849721 3300005616 Bacteria 928
47 Ga0068859_100731587 3300005617 Archaea 1079
48 Ga0068866_10501225 3300005718 Bacteria 803
49 Ga0068861_100010260 3300005719 Bacteria 6502
50 Ga0068861_100053882 3300005719 Bacteria 3062
51 Ga0068863_101336408 3300005841 Bacteria 724
52 Ga0068862_100049861 3300005844 Bacteria 3577
53 Ga0068862_100128289 3300005844 Bacteria 2241
54 Ga0081455_10146028 3300005937 Bacteria 1830
55 Ga0081455_10327520 3300005937 Bacteria 1088
56 Ga0070717_10004749 3300006028 Bacteria 9879
57 Ga0075367_10152491 3300006178 Bacteria 1435
58 Ga0075370_10318589 3300006353 Bacteria 926
59 Ga0075428_100094431 3300006844 Bacteria 3261
60 Ga0075428_100268502 3300006844 Bacteria 1836
61 Ga0075430_100311803 3300006846 Bacteria 1301
62 Ga0075434_100019131 3300006871 Bacteria 6622
63 Ga0075429_100011216 3300006880 Bacteria 7757
64 Ga0075429_100199540 3300006880 Bacteria 1753
65 Ga0075436_100007243 3300006914 Bacteria 7593
66 Ga0097620_100731567 3300006931 Archaea 1079
67 Ga0099826_10315403 3300006948 Bacteria 792
68 Ga0075435_100000282 3300007076 Bacteria 31568
69 Ga0075435_100160606 3300007076 Bacteria 1893
70 Ga0099794_10807331 3300007265 Bacteria 502
71 Ga0114129_10687661 3300009147 Bacteria 1316
72 Ga0114129_10979759 3300009147 Bacteria 1066
73 Ga0114129_11400476 3300009147 Unclassified 863
74 Ga0105243_10441283 3300009148 Bacteria 1219
75 Ga0105242_11333961 3300009176 Bacteria 742
76 Ga0105242_11605185 3300009176 Bacteria 684
77 Ga0105238_11133673 3300009551 Bacteria 805
78 Ga0105238_12190736 3300009551 Unclassified 587
79 Ga0105249_11604033 3300009553 Bacteria 723
80 Ga0157370_10063961 3300013104 Bacteria 3484
81 Ga0157370_10243495 3300013104 Bacteria 1664
82 Ga0157374_10004210 3300013296 Bacteria 12090
83 Ga0157378_10011139 3300013297 Bacteria 7871
84 Ga0157378_10109994 3300013297 Bacteria 2525
85 Ga0157378_10113618 3300013297 Unclassified 2486
86 Ga0157375_10547262 3300013308 Bacteria 1319
87 Ga0157375_11239141 3300013308 Unclassified 876
88 Ga0157380_10000366 3300014326 Bacteria 27213
89 Ga0157380_10005186 3300014326 Bacteria 9106
90 Ga0157380_10009778 3300014326 Bacteria 6884
91 Ga0213872_10020903 3300021361 Bacteria 3015
92 Ga0228598_1004488 3300024227 Bacteria 2953
93 Ga0209758_1000061 3300025297 Bacteria 320172
94 Ga0207653_10001609 3300025885 Bacteria 7274
95 Ga0207685_10185022 3300025905 Unclassified 968
96 Ga0207684_10000125 3300025910 Bacteria 141210
97 Ga0207684_10039189 3300025910 Bacteria 4020
98 Ga0207707_10043049 3300025912 Unclassified 3939
99 Ga0207707_10085090 3300025912 Unclassified 2763
100 Ga0207707_10314209 3300025912 Unclassified 1353
101 Ga0207671_10000010 3300025914 Bacteria 568302
102 Ga0207660_10551156 3300025917 Bacteria 938
103 Ga0207657_11069496 3300025919 Unclassified 617
104 Ga0207649_10000100 3300025920 Bacteria 70839
105 Ga0207649_10068722 3300025920 Bacteria 2253
106 Ga0207646_10015655 3300025922 Bacteria 7149
107 Ga0207681_10390722 3300025923 Unclassified 1122
108 Ga0207694_10869813 3300025924 Bacteria 762
109 Ga0207659_10790807 3300025926 Bacteria 815
110 Ga0207644_10428745 3300025931 Bacteria 1084
111 Ga0207690_10001651 3300025932 Bacteria 13795
112 Ga0207670_10452164 3300025936 Bacteria 1036
113 Ga0207669_10049281 3300025937 Bacteria 2509
114 Ga0207708_11191190 3300026075 Bacteria 666
115 Ga0207641_11189201 3300026088 Bacteria 762
116 Ga0207675_100005127 3300026118 Bacteria 12612
117 Ga0207675_100014967 3300026118 Bacteria 7241
118 Ga0207683_10072834 3300026121 Bacteria 3038
119 Ga0207698_10063859 3300026142 Bacteria 2884
120 Ga0268265_10127151 3300028380 Bacteria 2111
121 Ga0268265_10473266 3300028380 Bacteria 1175
122 Ga0268265_11535080 3300028380 Bacteria 670
123 Ga0265323_10001253 3300028653 Bacteria 12762
124 Ga0265323_10002172 3300028653 Bacteria 9150
125 Ga0265323_10028659 3300028653 Unclassified 2087
126 Ga0265322_10000719 3300028654 Bacteria 12096
127 Ga0307517_10096297 3300028786 Bacteria 2372
128 Ga0265338_10460635 3300028800 Bacteria 899
129 Ga0265339_10019379 3300031249 Bacteria 3996
130 Ga0265331_10000738 3300031250 Bacteria 27485
131 Ga0265316_10047615 3300031344 Bacteria 3390
132 Ga0265316_10061857 3300031344 Bacteria 2906
133 Ga0265316_10105778 3300031344 Bacteria 2135
134 Ga0265316_10191373 3300031344 Bacteria 1520
135 Ga0265316_10543742 3300031344 Bacteria 827
136 Ga0307513_10001137 3300031456 Bacteria 38670
137 Ga0307509_10001575 3300031507 Bacteria 38357
138 Ga0307509_10094522 3300031507 Bacteria 3048
139 Ga0307509_10409586 3300031507 Bacteria 1060
140 Ga0307408_100014019 3300031548 Bacteria 5325
141 Ga0307408_100466696 3300031548 Unclassified 1098
142 Ga0307408_101369739 3300031548 Bacteria 665
143 Ga0265313_10000692 3300031595 Bacteria 34755
144 Ga0307508_10011619 3300031616 Bacteria 8047
145 Ga0316575_10005919 3300031665 Bacteria 4377
146 Ga0316579_10011177 3300031691 Bacteria 3810
147 Ga0316579_10048283 3300031691 Bacteria 1988
148 Ga0316579_10132398 3300031691 Bacteria 1201
149 Ga0265314_10057455 3300031711 Bacteria 2671
150 Ga0265314_10233050 3300031711 Bacteria 1067
151 Ga0265342_10006112 3300031712 Bacteria 9022
152 Ga0316576_10215746 3300031727 Bacteria 1444
153 Ga0316576_10292398 3300031727 Bacteria 1218
154 Ga0316578_10128279 3300031728 Bacteria 1525
155 Ga0316578_10271536 3300031728 Bacteria 1016
156 Ga0307516_10639732 3300031730 Bacteria 718
157 Ga0316577_10006104 3300031733 Bacteria 6351
158 Ga0316577_10058418 3300031733 Bacteria 2153
159 Ga0307406_10249502 3300031901 Bacteria 1336
160 Ga0307414_11959773 3300032004 Bacteria 547
161 Ga0307411_10172225 3300032005 Unclassified 1634
162 Ga0307415_101061968 3300032126 Bacteria 756
163 Ga0316583_10014083 3300032133 Bacteria 2885
164 Ga0316585_10000860 3300032137 Bacteria 7738
165 Ga0316580_10001012 3300032139 Bacteria 7025
166 Ga0316215_1001494 3300033544 Bacteria 2243
167 Ga0373936_0000008 3300035113 Bacteria 268505
168 Ga0373955_0841325 3300035172 Bacteria 564
169 Ga0316574_0002667 3300035398 Bacteria 9012
170 Ga0373927_0028492 3300035695 Bacteria 3643
171 Ga0316582_0011027 3300036647 Unclassified 4983
172 Ga0316582_0069718 3300036647 Bacteria 2273
173 Ga0316582_0481250 3300036647 Bacteria 855
174 Ga0316584_0011946 3300036712 Bacteria 6116
175 Ga0316584_0082148 3300036712 Bacteria 2413
176 Ga0316584_0082273 3300036712 Bacteria 2412
177 Ga0316584_0244102 3300036712 Bacteria 1314
178 Ga0316584_0558971 3300036712 Bacteria 798
179 Ga0373925_0006420 3300037068 Bacteria 8654
180 Ga0395900_0145459 3300037418 Bacteria 2424
181 Ga0395905_0000369 3300037471 Bacteria 64030
182 Ga0395905_0026185 3300037471 Bacteria 5500
183 Ga0395905_0075601 3300037471 Bacteria 3157
184 Ga0395905_0617898 3300037471 Unclassified 986
185 Ga0316581_0006382 3300037588 Bacteria 3119
186 Ga0400485_05201 3300038735 Bacteria 2328
187 Ga0400485_22000 3300038735 Bacteria 1699
188 Ga0400486_22165 3300038742 Bacteria 31542
189 Ga0400486_23548 3300038742 Bacteria 2675
190 Ga0400489_64852 3300039093 Bacteria 3686
191 Ga0436361_0483154 3300039447 Bacteria 10928
192 Ga0439455_0144624 3300042012 Bacteria 675
193 Ga0450894_080827 3300042131 Bacteria 506
194 Ga0439464_0043317 3300042439 Bacteria 1287
195 Ga0451577_0052043 3300042876 Bacteria 3656
196 Ga0451577_0125467 3300042876 Bacteria 2300
197 Ga0451577_0629135 3300042876 Bacteria 973
198 Ga0466972_0545424 3300044658 Bacteria 547
199 Ga0453683_0316481 3300044673 Bacteria 1000
200 Ga0453683_0338979 3300044673 Bacteria 965
201 Ga0453683_0517166 3300044673 Bacteria 775
202 Ga0466963_0466902 3300044694 Bacteria 891
203 Ga0453684_0000226 3300044712 Bacteria 244912
204 Ga0453684_0067263 3300044712 Bacteria 4557
205 Ga0453684_0071108 3300044712 Bacteria 4401
206 Ga0453684_0084756 3300044712 Bacteria 3940
207 Ga0453684_0100826 3300044712 Unclassified 3533
208 Ga0453684_0276034 3300044712 Bacteria 1918
209 Ga0453684_0323018 3300044712 Bacteria 1747
210 Ga0453684_0505459 3300044712 Unclassified 1338
211 Ga0453684_0658520 3300044712 Bacteria 1142
212 Ga0453684_1586420 3300044712 Bacteria 672
213 Ga0466968_0012971 3300044735 Bacteria 3270
214 Ga0466959_0077868 3300045049 Bacteria 2392
215 Ga0451576_0021368 3300045051 Bacteria 7033
216 Ga0451576_0059358 3300045051 Bacteria 3993
217 Ga0451576_0135088 3300045051 Bacteria 2572
218 Ga0451576_0179772 3300045051 Bacteria 2209
219 Ga0466958_0197786 3300045836 Bacteria 1279
220 Ga0466967_0892228 3300045976 Bacteria 884
221 Ga0466967_1961538 3300045976 Unclassified 582
222 Ga0495617_031593 3300046452 Unclassified 1778
223 Ga0495638_0017412 3300046460 Bacteria 4790
224 Ga0495645_0548493 3300046543 Bacteria 717
225 Ga0495668_0378194 3300046616 Bacteria 778
226 Ga0495611_0401973 3300046648 Unclassified 626
227 Ga0495625_0004093 3300046660 Bacteria 13924
228 Ga0495659_0082655 3300046664 Bacteria 1222
229 Ga0495672_0013013 3300047320 Bacteria 5762
230 Ga0495672_0186610 3300047320 Bacteria 1046
231 Ga0496109_0791626 3300048912 Bacteria 886
232 Ga0496114_0611221 3300048917 Bacteria 961
233 Ga0496121_0051442 3300048924 Bacteria 3469
234 Ga0501295_069886 3300049518 Bacteria 783
235 Ga0501297_009054 3300049520 Bacteria 1107
236 Ga0501298_146184 3300049521 Unclassified 575
237 Ga0501299_007443 3300049522 Bacteria 1749
238 Ga0501303_014116 3300049526 Bacteria 786
239 Ga0501031_0057692 3300049568 Unclassified 2530
240 Ga0501031_0755361 3300049568 Bacteria 624
241 Ga0501032_0000034 3300049569 Bacteria 119560
242 Ga0501033_0000003 3300049570 Bacteria 586973
243 Ga0501033_0915918 3300049570 Bacteria 589
244 Ga0501036_0289095 3300049572 Bacteria 1372
245 Ga0501036_0321943 3300049572 Bacteria 1292
246 Ga0501038_0324867 3300049574 Bacteria 1203
247 Ga0501038_0364645 3300049574 Bacteria 1123
248 Ga0501039_0142794 3300049575 Unclassified 1881
249 Ga0501039_0253264 3300049575 Unclassified 1384
250 Ga0501040_0248687 3300049576 Bacteria 1268
251 Ga0501041_0535031 3300049577 Bacteria 746
252 Ga0501043_0527177 3300049579 Bacteria 880
253 Ga0501046_0000003 3300049580 Bacteria 496142
254 Ga0501046_0065276 3300049580 Bacteria 2840
255 Ga0501046_0225366 3300049580 Bacteria 1387
256 Ga0501047_0080140 3300049581 Bacteria 3139
257 Ga0501068_0522381 3300049584 Bacteria 771
258 Ga0501069_0220963 3300049585 Bacteria 1101
259 Ga0501070_0100709 3300049586 Bacteria 2390
260 Ga0501070_0459257 3300049586 Bacteria 1026
261 Ga0501071_0100134 3300049587 Bacteria 2136
262 Ga0501072_0014998 3300049588 Bacteria 5941
263 Ga0501072_0471086 3300049588 Bacteria 994
264 Ga0501072_1073898 3300049588 Bacteria 627
265 Ga0501073_0023999 3300049589 Bacteria 4379
266 Ga0501074_0019665 3300049590 Bacteria 4902
267 Ga0501074_0055185 3300049590 Bacteria 2864
268 Ga0501074_0164449 3300049590 Unclassified 1584
269 Ga0501075_0204293 3300049591 Bacteria 1507
270 Ga0501075_1267317 3300049591 Bacteria 559
271 Ga0501076_0040387 3300049592 Bacteria 3667
272 Ga0501076_0173352 3300049592 Bacteria 1759
273 Ga0501076_0191336 3300049592 Bacteria 1670
274 Ga0501076_0282319 3300049592 Bacteria 1360
275 Ga0501077_0198185 3300049593 Bacteria 1275
276 Ga0501206_004192 3300049653 Bacteria 1832
277 Ga0501256_026553 3300049685 Unclassified 634
278 Ga0501079_0134162 3300049741 Unclassified 1927
279 Ga0501079_0524580 3300049741 Bacteria 931
280 Ga0501080_0052957 3300049742 Bacteria 3778
281 Ga0501080_0213424 3300049742 Bacteria 1768
282 Ga0501081_0131111 3300049743 Bacteria 1791
283 Ga0501081_0487184 3300049743 Unclassified 918
284 Ga0501083_0000443 3300049744 Bacteria 26661
285 Ga0501083_0086475 3300049744 Bacteria 2073
286 Ga0501262_003731 3300049759 Bacteria 1756
287 Ga0501265_003580 3300049762 Bacteria 1764
288 Ga0501044_0303035 3300049823 Bacteria 1526
289 nmdc:mga0k408_731151_c1 3300050493 Bacteria 579
290 nmdc:mga09592_242753_c1 3300050508 Bacteria 1561
291 nmdc:mga0qj67_1046107_c1 3300050509 Bacteria 639
292 nmdc:mga0rr50_22054_c1 3300050513 Bacteria 4363
293 nmdc:mga0rr50_418680_c1 3300050513 Bacteria 1133
294 nmdc:mga08x19_490606_c1 3300050514 Bacteria 867
295 nmdc:mga08x19_64867_c1 3300050514 Bacteria 2371
296 nmdc:mga0a205_1020_c1 3300050515 Bacteria 23290
297 Ga0500610_0207084 3300053079 Bacteria 940
298 Ga0500644_0009915 3300053088 Bacteria 2563
299 Ga0500583_0207628 3300053092 Bacteria 973
300 Ga0500583_0397139 3300053092 Bacteria 662
301 Ga0500650_0220702 3300053098 Bacteria 858
302 Ga0500617_237687 3300053124 Bacteria 630
303 Ga0500658_0277531 3300053134 Bacteria 770
304 Ga0500568_0133281 3300053139 Bacteria 923
305 Ga0500577_0001905 3300053142 Bacteria 5350
306 Ga0500577_0047264 3300053142 Bacteria 1599
307 Ga0500588_0004939 3300053146 Bacteria 2924
308 Ga0500588_0008509 3300053146 Bacteria 2400
309 Ga0500622_0002173 3300053156 Bacteria 14533
310 Ga0500622_0006855 3300053156 Bacteria 6544
311 Ga0500627_0327971 3300053158 Bacteria 664
312 Ga0501084_0020666 3300054114 Bacteria 5491
313 Ga0501084_0086541 3300054114 Bacteria 2631
314 Ga0501084_0148173 3300054114 Bacteria 1977
315 Ga0501084_0165052 3300054114 Bacteria 1869
316 Ga0501084_0336310 3300054114 Bacteria 1275
317 Ga0501084_0878095 3300054114 Bacteria 754
318 Ga0590071_000135 3300059421 Bacteria 20700
319 Ga0590071_022693 3300059421 Bacteria 1481
320 Ga0590074_000121 3300059423 Bacteria 9122
321 Ga0590075_000060 3300059424 Bacteria 27746
322 Ga0590075_049993 3300059424 Bacteria 1072
323 Ga0590077_000596 3300059426 Bacteria 9840
324 Ga0501082_0289808 3300060353 Bacteria 1425
325 Ga0501082_0519528 3300060353 Bacteria 1041
326 Ga0530510_0331115 3300061734 Bacteria 1142
327 Ga0530510_0542035 3300061734 Bacteria 883

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100357509 Ga0070699_1003575092 127
2 3300049581 Ga0501047_0080140 Ga0501047_0080140_73_522 133
3 3300009147 Ga0114129_10687661 Ga0114129_106876612 134
4 3300007076 Ga0075435_100160606 Ga0075435_1001606062 135
5 3300031344 Ga0265316_10191373 Ga0265316_101913731 135
6 3300042876 Ga0451577_0125467 Ga0451577_0125467_1132_1596 135
7 3300050513 nmdc:mga0rr50_418680_c1 nmdc:mga0rr50_418680_c1_275_733 135
8 3300005334 Ga0068869_100362377 Ga0068869_1003623772 136
9 3300003215 JGI25153J46596_10000081 JGI25153J46596_1000008179 137
10 3300005339 Ga0070660_100429185 Ga0070660_1004291851 137
11 3300005344 Ga0070661_100068707 Ga0070661_1000687072 137
12 3300005458 Ga0070681_10543176 Ga0070681_105431762 137
13 3300005530 Ga0070679_100106945 Ga0070679_1001069452 137
14 3300005614 Ga0068856_102579174 Ga0068856_1025791741 137
15 3300005616 Ga0068852_100269724 Ga0068852_1002697243 137
16 3300005937 Ga0081455_10327520 Ga0081455_103275202 137
17 3300006880 Ga0075429_100011216 Ga0075429_1000112168 137
18 3300009147 Ga0114129_10979759 Ga0114129_109797592 137
19 3300009551 Ga0105238_12190736 Ga0105238_121907361 137
20 3300013104 Ga0157370_10063961 Ga0157370_100639613 137
21 3300025297 Ga0209758_1000061 Ga0209758_1000061278 137
22 3300025912 Ga0207707_10314209 Ga0207707_103142092 137
23 3300025919 Ga0207657_11069496 Ga0207657_110694961 137
24 3300025920 Ga0207649_10068722 Ga0207649_100687222 137
25 3300049570 Ga0501033_0915918 Ga0501033_0915918_63_503 137
26 3300049574 Ga0501038_0364645 Ga0501038_0364645_209_649 137
27 3300049585 Ga0501069_0220963 Ga0501069_0220963_398_838 137
28 3300049586 Ga0501070_0459257 Ga0501070_0459257_85_525 137
29 3300049587 Ga0501071_0100134 Ga0501071_0100134_1599_2024 137
30 3300049588 Ga0501072_0014998 Ga0501072_0014998_4132_4572 137
31 3300049590 Ga0501074_0055185 Ga0501074_0055185_1643_2083 137
32 3300049590 Ga0501074_0164449 Ga0501074_0164449_815_1240 137
33 3300049591 Ga0501075_1267317 Ga0501075_1267317_39_479 137
34 3300049592 Ga0501076_0040387 Ga0501076_0040387_1847_2287 137
35 3300049593 Ga0501077_0198185 Ga0501077_0198185_145_585 137
36 3300049742 Ga0501080_0052957 Ga0501080_0052957_110_550 137
37 3300049743 Ga0501081_0131111 Ga0501081_0131111_1080_1520 137
38 3300053092 Ga0500583_0207628 Ga0500583_0207628_159_587 137
39 3300053142 Ga0500577_0001905 Ga0500577_0001905_2294_2722 137
40 3300053146 Ga0500588_0008509 Ga0500588_0008509_1174_1602 137
41 3300054114 Ga0501084_0020666 Ga0501084_0020666_3789_4229 137
42 3300054114 Ga0501084_0148173 Ga0501084_0148173_1120_1545 137
43 3300059421 Ga0590071_000135 Ga0590071_000135_18985_19425 137
44 3300059423 Ga0590074_000121 Ga0590074_000121_4035_4475 137
45 3300059424 Ga0590075_000060 Ga0590075_000060_11126_11566 137
46 3300059426 Ga0590077_000596 Ga0590077_000596_2525_2965 137
47 3300060353 Ga0501082_0289808 Ga0501082_0289808_840_1280 137
48 3300061734 Ga0530510_0542035 Ga0530510_0542035_210_635 137
49 3300045051 Ga0451576_0059358 Ga0451576_0059358_1700_2128 138
50 3300005467 Ga0070706_100000597 Ga0070706_10000059724 139
51 3300005468 Ga0070707_100019444 Ga0070707_1000194444 139
52 3300005471 Ga0070698_100155760 Ga0070698_1001557601 139
53 3300005536 Ga0070697_100001945 Ga0070697_10000194511 139
54 3300013297 Ga0157378_10109994 Ga0157378_101099942 139
55 3300025910 Ga0207684_10000125 Ga0207684_1000012524 139
56 3300025922 Ga0207646_10015655 Ga0207646_100156556 139
57 3300031507 Ga0307509_10094522 Ga0307509_100945223 139
58 3300044712 Ga0453684_0323018 Ga0453684_0323018_77_511 139
59 3300046664 Ga0495659_0082655 Ga0495659_0082655_169_588 139
60 3300005468 Ga0070707_100942492 Ga0070707_1009424922 140
61 3300005841 Ga0068863_101336408 Ga0068863_1013364082 140
62 3300009551 Ga0105238_11133673 Ga0105238_111336732 140
63 3300026088 Ga0207641_11189201 Ga0207641_111892011 140
64 3300031548 Ga0307408_100466696 Ga0307408_1004666962 140
65 3300032005 Ga0307411_10172225 Ga0307411_101722252 140
66 3300003316 rootH1_10027991 rootH1_100279912 141
67 3300003322 rootL2_10006076 rootL2_1000607620 141
68 3300005365 Ga0070688_101289399 Ga0070688_1012893991 141
69 3300005617 Ga0068859_100731587 Ga0068859_1007315872 141
70 3300005937 Ga0081455_10146028 Ga0081455_101460283 141
71 3300006353 Ga0075370_10318589 Ga0075370_103185892 141
72 3300006931 Ga0097620_100731567 Ga0097620_1007315672 141
73 3300021361 Ga0213872_10020903 Ga0213872_100209034 141
74 3300028800 Ga0265338_10460635 Ga0265338_104606352 141
75 3300031249 Ga0265339_10019379 Ga0265339_100193795 141
76 3300031250 Ga0265331_10000738 Ga0265331_100007386 141
77 3300031344 Ga0265316_10105778 Ga0265316_101057782 141
78 3300031595 Ga0265313_10000692 Ga0265313_1000069233 141
79 3300031711 Ga0265314_10057455 Ga0265314_100574553 141
80 3300031711 Ga0265314_10233050 Ga0265314_102330502 141
81 3300031712 Ga0265342_10006112 Ga0265342_100061127 141
82 3300035695 Ga0373927_0028492 Ga0373927_0028492_2568_3047 141
83 3300036647 Ga0316582_0011027 Ga0316582_0011027_897_1331 141
84 3300037068 Ga0373925_0006420 Ga0373925_0006420_7411_7890 141
85 3300037418 Ga0395900_0145459 Ga0395900_0145459_223_657 141
86 3300037471 Ga0395905_0026185 Ga0395905_0026185_1939_2373 141
87 3300038735 Ga0400485_05201 Ga0400485_05201_142_579 141
88 3300038735 Ga0400485_22000 Ga0400485_22000_675_1112 141
89 3300038742 Ga0400486_22165 Ga0400486_22165_6727_7164 141
90 3300038742 Ga0400486_23548 Ga0400486_23548_1989_2507 141
91 3300039447 Ga0436361_0483154 Ga0436361_0483154_238_669 141
92 3300044673 Ga0453683_0316481 Ga0453683_0316481_299_739 141
93 3300044694 Ga0466963_0466902 Ga0466963_0466902_47_481 141
94 3300044712 Ga0453684_0658520 Ga0453684_0658520_96_527 141
95 3300045049 Ga0466959_0077868 Ga0466959_0077868_251_685 141
96 3300045836 Ga0466958_0197786 Ga0466958_0197786_629_1063 141
97 3300045976 Ga0466967_0892228 Ga0466967_0892228_349_783 141
98 3300049568 Ga0501031_0057692 Ga0501031_0057692_1896_2336 141
99 3300049575 Ga0501039_0253264 Ga0501039_0253264_493_933 141
100 3300053088 Ga0500644_0009915 Ga0500644_0009915_1929_2372 141
101 3300053098 Ga0500650_0220702 Ga0500650_0220702_113_556 141
102 3300053142 Ga0500577_0047264 Ga0500577_0047264_481_927 141
103 3300003320 rootH2_10050515 rootH2_100505152 142
104 3300003322 rootL2_10072798 rootL2_100727986 142
105 3300028380 Ga0268265_11535080 Ga0268265_115350802 142
106 3300035113 Ga0373936_0000008 Ga0373936_0000008_255266_255712 142
107 3300037471 Ga0395905_0000369 Ga0395905_0000369_10979_11428 142
108 3300037471 Ga0395905_0617898 Ga0395905_0617898_124_600 142
109 3300044712 Ga0453684_0000226 Ga0453684_0000226_239772_240239 142
110 3300044712 Ga0453684_0084756 Ga0453684_0084756_1663_2121 142
111 3300044735 Ga0466968_0012971 Ga0466968_0012971_591_1028 142
112 3300045051 Ga0451576_0021368 Ga0451576_0021368_5961_6419 142
113 3300045051 Ga0451576_0179772 Ga0451576_0179772_73_510 142
114 3300048912 Ga0496109_0791626 Ga0496109_0791626_95_535 142
115 3300049580 Ga0501046_0000003 Ga0501046_0000003_364610_365044 142
116 3300005356 Ga0070674_100037067 Ga0070674_1000370672 143
117 3300005458 Ga0070681_10707389 Ga0070681_107073892 143
118 3300005518 Ga0070699_100209151 Ga0070699_1002091511 143
119 3300005718 Ga0068866_10501225 Ga0068866_105012252 143
120 3300005719 Ga0068861_100053882 Ga0068861_1000538822 143
121 3300005844 Ga0068862_100049861 Ga0068862_1000498612 143
122 3300005844 Ga0068862_100128289 Ga0068862_1001282892 143
123 3300006028 Ga0070717_10004749 Ga0070717_100047493 143
124 3300006844 Ga0075428_100094431 Ga0075428_1000944312 143
125 3300006844 Ga0075428_100268502 Ga0075428_1002685022 143
126 3300006880 Ga0075429_100199540 Ga0075429_1001995402 143
127 3300007265 Ga0099794_10807331 Ga0099794_108073311 143
128 3300009147 Ga0114129_11400476 Ga0114129_114004762 143
129 3300009176 Ga0105242_11605185 Ga0105242_116051852 143
130 3300009553 Ga0105249_11604033 Ga0105249_116040332 143
131 3300014326 Ga0157380_10009778 Ga0157380_100097788 143
132 3300025923 Ga0207681_10390722 Ga0207681_103907222 143
133 3300025936 Ga0207670_10452164 Ga0207670_104521642 143
134 3300025937 Ga0207669_10049281 Ga0207669_100492812 143
135 3300026118 Ga0207675_100014967 Ga0207675_1000149677 143
136 3300028380 Ga0268265_10127151 Ga0268265_101271512 143
137 3300028380 Ga0268265_10473266 Ga0268265_104732661 143
138 3300031665 Ga0316575_10005919 Ga0316575_100059192 143
139 3300031691 Ga0316579_10132398 Ga0316579_101323982 143
140 3300031727 Ga0316576_10215746 Ga0316576_102157462 143
141 3300031727 Ga0316576_10292398 Ga0316576_102923982 143
142 3300031728 Ga0316578_10128279 Ga0316578_101282791 143
143 3300031733 Ga0316577_10006104 Ga0316577_100061044 143
144 3300032133 Ga0316583_10014083 Ga0316583_100140832 143
145 3300032137 Ga0316585_10000860 Ga0316585_100008607 143
146 3300032139 Ga0316580_10001012 Ga0316580_100010127 143
147 3300033544 Ga0316215_1001494 Ga0316215_10014942 143
148 3300035398 Ga0316574_0002667 Ga0316574_0002667_1421_1870 143
149 3300036647 Ga0316582_0481250 Ga0316582_0481250_365_814 143
150 3300036712 Ga0316584_0082148 Ga0316584_0082148_726_1175 143
151 3300036712 Ga0316584_0244102 Ga0316584_0244102_689_1138 143
152 3300042876 Ga0451577_0052043 Ga0451577_0052043_2861_3298 143
153 3300044712 Ga0453684_0071108 Ga0453684_0071108_1445_1882 143
154 3300044712 Ga0453684_0100826 Ga0453684_0100826_3034_3474 143
155 3300044712 Ga0453684_0276034 Ga0453684_0276034_1444_1884 143
156 3300044712 Ga0453684_1586420 Ga0453684_1586420_204_644 143
157 3300045051 Ga0451576_0135088 Ga0451576_0135088_337_798 143
158 3300046543 Ga0495645_0548493 Ga0495645_0548493_97_534 143
159 3300049568 Ga0501031_0755361 Ga0501031_0755361_34_471 143
160 3300049572 Ga0501036_0289095 Ga0501036_0289095_206_643 143
161 3300049584 Ga0501068_0522381 Ga0501068_0522381_143_586 143
162 3300049588 Ga0501072_0471086 Ga0501072_0471086_189_632 143
163 3300049588 Ga0501072_1073898 Ga0501072_1073898_56_493 143
164 3300049589 Ga0501073_0023999 Ga0501073_0023999_2486_2929 143
165 3300049590 Ga0501074_0019665 Ga0501074_0019665_1924_2367 143
166 3300049592 Ga0501076_0173352 Ga0501076_0173352_784_1227 143
167 3300049592 Ga0501076_0191336 Ga0501076_0191336_244_681 143
168 3300049741 Ga0501079_0524580 Ga0501079_0524580_294_746 143
169 3300049742 Ga0501080_0213424 Ga0501080_0213424_672_1115 143
170 3300049744 Ga0501083_0086475 Ga0501083_0086475_444_887 143
171 3300050508 nmdc:mga09592_242753_c1 nmdc:mga09592_242753_c1_728_1165 143
172 3300054114 Ga0501084_0165052 Ga0501084_0165052_814_1257 143
173 3300054114 Ga0501084_0336310 Ga0501084_0336310_45_488 143
174 3300054114 Ga0501084_0878095 Ga0501084_0878095_100_543 143
175 3300059421 Ga0590071_022693 Ga0590071_022693_628_1065 143
176 3300059424 Ga0590075_049993 Ga0590075_049993_589_1026 143
177 3300060353 Ga0501082_0519528 Ga0501082_0519528_200_643 143
178 3300002155 JGI24033J26618_1000223 JGI24033J26618_10002232 144
179 3300003322 rootL2_10002696 rootL2_1000269621 144
180 3300005295 Ga0065707_10082227 Ga0065707_100822271 144
181 3300005328 Ga0070676_11236431 Ga0070676_112364311 144
182 3300005337 Ga0070682_100118877 Ga0070682_1001188772 144
183 3300005344 Ga0070661_100001092 Ga0070661_10000109216 144
184 3300005366 Ga0070659_100003230 Ga0070659_10000323010 144
185 3300005440 Ga0070705_100011818 Ga0070705_1000118182 144
186 3300005456 Ga0070678_100019921 Ga0070678_1000199212 144
187 3300005458 Ga0070681_10032102 Ga0070681_100321021 144
188 3300005467 Ga0070706_100003764 Ga0070706_1000037647 144
189 3300005467 Ga0070706_101258789 Ga0070706_1012587891 144
190 3300005471 Ga0070698_100113689 Ga0070698_1001136892 144
191 3300005518 Ga0070699_100012162 Ga0070699_1000121625 144
192 3300005518 Ga0070699_100777815 Ga0070699_1007778152 144
193 3300005518 Ga0070699_101540611 Ga0070699_1015406111 144
194 3300005546 Ga0070696_100472228 Ga0070696_1004722282 144
195 3300005547 Ga0070693_100122638 Ga0070693_1001226382 144
196 3300005548 Ga0070665_102209634 Ga0070665_1022096341 144
197 3300005549 Ga0070704_100011477 Ga0070704_1000114774 144
198 3300005549 Ga0070704_100372350 Ga0070704_1003723501 144
199 3300005615 Ga0070702_100322748 Ga0070702_1003227481 144
200 3300005616 Ga0068852_100007020 Ga0068852_1000070203 144
201 3300005616 Ga0068852_100849721 Ga0068852_1008497212 144
202 3300005719 Ga0068861_100010260 Ga0068861_1000102603 144
203 3300006178 Ga0075367_10152491 Ga0075367_101524912 144
204 3300006846 Ga0075430_100311803 Ga0075430_1003118032 144
205 3300006871 Ga0075434_100019131 Ga0075434_1000191313 144
206 3300006914 Ga0075436_100007243 Ga0075436_1000072432 144
207 3300006948 Ga0099826_10315403 Ga0099826_103154033 144
208 3300007076 Ga0075435_100000282 Ga0075435_10000028228 144
209 3300009148 Ga0105243_10441283 Ga0105243_104412832 144
210 3300009176 Ga0105242_11333961 Ga0105242_113339612 144
211 3300013104 Ga0157370_10243495 Ga0157370_102434952 144
212 3300013296 Ga0157374_10004210 Ga0157374_100042106 144
213 3300013297 Ga0157378_10011139 Ga0157378_100111392 144
214 3300013297 Ga0157378_10113618 Ga0157378_101136183 144
215 3300013308 Ga0157375_10547262 Ga0157375_105472622 144
216 3300013308 Ga0157375_11239141 Ga0157375_112391412 144
217 3300014326 Ga0157380_10000366 Ga0157380_1000036618 144
218 3300014326 Ga0157380_10005186 Ga0157380_100051868 144
219 3300024227 Ga0228598_1004488 Ga0228598_10044883 144
220 3300025885 Ga0207653_10001609 Ga0207653_100016096 144
221 3300025905 Ga0207685_10185022 Ga0207685_101850222 144
222 3300025910 Ga0207684_10039189 Ga0207684_100391893 144
223 3300025912 Ga0207707_10043049 Ga0207707_100430494 144
224 3300025912 Ga0207707_10085090 Ga0207707_100850902 144
225 3300025914 Ga0207671_10000010 Ga0207671_10000010295 144
226 3300025917 Ga0207660_10551156 Ga0207660_105511562 144
227 3300025920 Ga0207649_10000100 Ga0207649_1000010024 144
228 3300025924 Ga0207694_10869813 Ga0207694_108698132 144
229 3300025926 Ga0207659_10790807 Ga0207659_107908072 144
230 3300025931 Ga0207644_10428745 Ga0207644_104287452 144
231 3300025932 Ga0207690_10001651 Ga0207690_1000165110 144
232 3300026075 Ga0207708_11191190 Ga0207708_111911902 144
233 3300026118 Ga0207675_100005127 Ga0207675_1000051278 144
234 3300026121 Ga0207683_10072834 Ga0207683_100728342 144
235 3300026142 Ga0207698_10063859 Ga0207698_100638593 144
236 3300028653 Ga0265323_10001253 Ga0265323_100012533 144
237 3300028653 Ga0265323_10002172 Ga0265323_100021726 144
238 3300028653 Ga0265323_10028659 Ga0265323_100286593 144
239 3300028654 Ga0265322_10000719 Ga0265322_100007194 144
240 3300028786 Ga0307517_10096297 Ga0307517_100962972 144
241 3300031344 Ga0265316_10047615 Ga0265316_100476153 144
242 3300031344 Ga0265316_10061857 Ga0265316_100618572 144
243 3300031344 Ga0265316_10543742 Ga0265316_105437422 144
244 3300031456 Ga0307513_10001137 Ga0307513_100011379 144
245 3300031507 Ga0307509_10001575 Ga0307509_100015759 144
246 3300031507 Ga0307509_10409586 Ga0307509_104095861 144
247 3300031548 Ga0307408_100014019 Ga0307408_1000140195 144
248 3300031548 Ga0307408_101369739 Ga0307408_1013697391 144
249 3300031616 Ga0307508_10011619 Ga0307508_100116198 144
250 3300031691 Ga0316579_10011177 Ga0316579_100111772 144
251 3300031691 Ga0316579_10048283 Ga0316579_100482832 144
252 3300031728 Ga0316578_10271536 Ga0316578_102715362 144
253 3300031730 Ga0307516_10639732 Ga0307516_106397321 144
254 3300031733 Ga0316577_10058418 Ga0316577_100584182 144
255 3300031901 Ga0307406_10249502 Ga0307406_102495021 144
256 3300032004 Ga0307414_11959773 Ga0307414_119597731 144
257 3300032126 Ga0307415_101061968 Ga0307415_1010619681 144
258 3300035172 Ga0373955_0841325 Ga0373955_0841325_42_500 144
259 3300036647 Ga0316582_0069718 Ga0316582_0069718_727_1176 144
260 3300036712 Ga0316584_0011946 Ga0316584_0011946_4026_4475 144
261 3300036712 Ga0316584_0082273 Ga0316584_0082273_1033_1476 144
262 3300036712 Ga0316584_0558971 Ga0316584_0558971_97_546 144
263 3300037471 Ga0395905_0075601 Ga0395905_0075601_1377_1850 144
264 3300037588 Ga0316581_0006382 Ga0316581_0006382_1447_1896 144
265 3300039093 Ga0400489_64852 Ga0400489_64852_2098_2544 144
266 3300042012 Ga0439455_0144624 Ga0439455_0144624_95_541 144
267 3300042131 Ga0450894_080827 Ga0450894_080827_13_459 144
268 3300042439 Ga0439464_0043317 Ga0439464_0043317_415_861 144
269 3300042876 Ga0451577_0629135 Ga0451577_0629135_44_493 144
270 3300044658 Ga0466972_0545424 Ga0466972_0545424_21_467 144
271 3300044673 Ga0453683_0338979 Ga0453683_0338979_258_698 144
272 3300044673 Ga0453683_0517166 Ga0453683_0517166_249_698 144
273 3300044712 Ga0453684_0067263 Ga0453684_0067263_1589_2038 144
274 3300044712 Ga0453684_0505459 Ga0453684_0505459_461_952 144
275 3300045976 Ga0466967_1961538 Ga0466967_1961538_99_542 144
276 3300046452 Ga0495617_031593 Ga0495617_031593_968_1411 144
277 3300046460 Ga0495638_0017412 Ga0495638_0017412_2216_2662 144
278 3300046616 Ga0495668_0378194 Ga0495668_0378194_61_507 144
279 3300046648 Ga0495611_0401973 Ga0495611_0401973_88_534 144
280 3300046660 Ga0495625_0004093 Ga0495625_0004093_1871_2317 144
281 3300047320 Ga0495672_0013013 Ga0495672_0013013_4428_4877 144
282 3300047320 Ga0495672_0186610 Ga0495672_0186610_571_1017 144
283 3300048917 Ga0496114_0611221 Ga0496114_0611221_397_888 144
284 3300048924 Ga0496121_0051442 Ga0496121_0051442_1999_2445 144
285 3300049518 Ga0501295_069886 Ga0501295_069886_302_745 144
286 3300049520 Ga0501297_009054 Ga0501297_009054_53_496 144
287 3300049521 Ga0501298_146184 Ga0501298_146184_18_461 144
288 3300049522 Ga0501299_007443 Ga0501299_007443_1255_1704 144
289 3300049526 Ga0501303_014116 Ga0501303_014116_112_555 144
290 3300049569 Ga0501032_0000034 Ga0501032_0000034_110617_111051 144
291 3300049570 Ga0501033_0000003 Ga0501033_0000003_332832_333266 144
292 3300049572 Ga0501036_0321943 Ga0501036_0321943_391_840 144
293 3300049574 Ga0501038_0324867 Ga0501038_0324867_303_752 144
294 3300049575 Ga0501039_0142794 Ga0501039_0142794_1357_1806 144
295 3300049576 Ga0501040_0248687 Ga0501040_0248687_298_747 144
296 3300049577 Ga0501041_0535031 Ga0501041_0535031_47_496 144
297 3300049579 Ga0501043_0527177 Ga0501043_0527177_66_515 144
298 3300049580 Ga0501046_0065276 Ga0501046_0065276_120_566 144
299 3300049580 Ga0501046_0225366 Ga0501046_0225366_804_1253 144
300 3300049586 Ga0501070_0100709 Ga0501070_0100709_393_839 144
301 3300049591 Ga0501075_0204293 Ga0501075_0204293_414_863 144
302 3300049592 Ga0501076_0282319 Ga0501076_0282319_792_1241 144
303 3300049653 Ga0501206_004192 Ga0501206_004192_425_868 144
304 3300049685 Ga0501256_026553 Ga0501256_026553_141_584 144
305 3300049741 Ga0501079_0134162 Ga0501079_0134162_1461_1910 144
306 3300049743 Ga0501081_0487184 Ga0501081_0487184_430_879 144
307 3300049744 Ga0501083_0000443 Ga0501083_0000443_16453_16896 144
308 3300049759 Ga0501262_003731 Ga0501262_003731_45_488 144
309 3300049762 Ga0501265_003580 Ga0501265_003580_284_727 144
310 3300049823 Ga0501044_0303035 Ga0501044_0303035_67_513 144
311 3300050493 nmdc:mga0k408_731151_c1 nmdc:mga0k408_731151_c1_71_526 144
312 3300050509 nmdc:mga0qj67_1046107_c1 nmdc:mga0qj67_1046107_c1_109_558 144
313 3300050513 nmdc:mga0rr50_22054_c1 nmdc:mga0rr50_22054_c1_2834_3295 144
314 3300050514 nmdc:mga08x19_490606_c1 nmdc:mga08x19_490606_c1_71_523 144
315 3300050514 nmdc:mga08x19_64867_c1 nmdc:mga08x19_64867_c1_512_973 144
316 3300050515 nmdc:mga0a205_1020_c1 nmdc:mga0a205_1020_c1_12855_13316 144
317 3300053079 Ga0500610_0207084 Ga0500610_0207084_484_930 144
318 3300053092 Ga0500583_0397139 Ga0500583_0397139_166_612 144
319 3300053124 Ga0500617_237687 Ga0500617_237687_46_492 144
320 3300053134 Ga0500658_0277531 Ga0500658_0277531_117_563 144
321 3300053139 Ga0500568_0133281 Ga0500568_0133281_86_532 144
322 3300053146 Ga0500588_0004939 Ga0500588_0004939_1820_2266 144
323 3300053156 Ga0500622_0002173 Ga0500622_0002173_2337_2783 144
324 3300053156 Ga0500622_0006855 Ga0500622_0006855_1737_2183 144
325 3300053158 Ga0500627_0327971 Ga0500627_0327971_67_513 144
326 3300054114 Ga0501084_0086541 Ga0501084_0086541_1538_1981 144
327 3300061734 Ga0530510_0331115 Ga0530510_0331115_475_924 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

33

157

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3olx-assembly2.cif.gz_B structural and functional effects of substitution at position t+1 in chey: cheya88s-bef3-mn complex 0.906 2 125
4jav-assembly1.cif.gz_D structural basis of a rationally rewired protein-protein interface (hk853wt and rr468mutant v13p, l14i, i17m and n21v) 0.9024 1 130
3h1f-assembly1.cif.gz_A crystal structure of chey mutant d53a of helicobacter pylori 0.8951 1 130
1nat-assembly1.cif.gz_A crystal structure of spoof from bacillus subtilis 0.8891 1 136
7lcm-assembly1.cif.gz_A receiver domain of rssb bound to beryllofluoride 0.8876 2 133
ID Description Score Start End Superfamily
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9301 2 94 3.40.50.2300
af_P08368_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8879 2 94 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8877 2 94 3.40.50.2300
af_Q54SP4_555_700_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8867 2 130 3.40.50.2300
3h1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8831 1 133 3.40.50.2300
ID Description Score Start End GO Terms
AF-O28799-F1-model_v4 Response regulator 0.954 1 142 GO:0000160
AF-O28799-F1-model_v4 Response regulator 0.9403 1 142 GO:0000160
AF-A0A318SBS0-F1-model_v4 Two-component system response regulator 0.9391 1 141 GO:0000160
AF-A0A1P8FMT0-F1-model_v4 Response regulatory domain-containing protein 0.9312 1 142 GO:0000160
AF-A0A7C6UJW7-F1-model_v4 Stage 0 sporulation protein A homolog 0.9308 6 141 GO:0000160

Feature Viewer

pLDDT pTM Quality
89.15 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map