F406335

General Info

Members Datasets Scaffolds Average Seq Length
322 231 322 106

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_101541374|Ga0068867_1015413741
Length 117
Sequence MAHVRKGDLVVVTSGAYKGKRGKILRVVGNRVVVEKVAMIKRHSRATQKNPQGGIIEKEGTIHISNVALWDDKREWVDGTGTKHTGRGTRTKIVVDGDHKVRVGVKTGTKFPSPGMG

Samples

Sample ID Description Type Environment
1 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
174 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
185 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
188 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
189 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
190 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
191 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
192 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
205 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
206 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
207 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
210 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
211 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
212 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
213 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
216 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
217 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
218 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
223 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
224 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
225 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
226 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
227 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.68
Metatranscriptomes 9.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.04
Nodule 0
Rhizoplane 1.55
Rhizosphere 77.95
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006767J43181_103125 3300002868 Bacteria 8971
2 Ga0006763J43179_104103 3300002870 Bacteria 8906
3 Ga0006762J43184_103419 3300002872 Bacteria 7285
4 Ga0006760J45825_103550 3300003158 Bacteria 2322
5 Ga0006765J45826_111518 3300003161 Bacteria 3818
6 Ga0006778J45830_1106924 3300003162 Bacteria 1011
7 Ga0006759J45824_1006649 3300003163 Bacteria 16605
8 Ga0006759J45824_1061226 3300003163 Bacteria 730
9 Ga0006759J45824_1141419 3300003163 Bacteria 646
10 Ga0006758J48902_1008419 3300003300 Bacteria 4745
11 Ga0006770J48903_1028711 3300003305 Bacteria 578
12 Ga0007417J51691_1036907 3300003544 Bacteria 959
13 Ga0032354_1009872 3300003693 Bacteria 14763
14 Ga0058859_10057719 3300004798 Bacteria 1332
15 Ga0058859_10061516 3300004798 Bacteria 814
16 Ga0058859_11762135 3300004798 Bacteria 949
17 Ga0058859_11768326 3300004798 Bacteria 677
18 Ga0058859_11775024 3300004798 Bacteria 541
19 Ga0058861_10047495 3300004800 Bacteria 975
20 Ga0058861_12076589 3300004800 Bacteria 979
21 Ga0058860_12084468 3300004801 Bacteria 1180
22 Ga0058860_12197989 3300004801 Bacteria 657
23 Ga0058862_10061662 3300004803 Bacteria 1198
24 Ga0058862_10069386 3300004803 Bacteria 5735
25 Ga0058862_12705038 3300004803 Bacteria 759
26 Ga0070658_11818814 3300005327 Unclassified 527
27 Ga0070683_100248182 3300005329 Bacteria 1693
28 Ga0070683_100249041 3300005329 Bacteria 1690
29 Ga0070690_100041813 3300005330 Bacteria 2902
30 Ga0070690_100295616 3300005330 Bacteria 1160
31 Ga0070670_100287184 3300005331 Bacteria 1437
32 Ga0068869_100489240 3300005334 Bacteria 1025
33 Ga0068869_100580727 3300005334 Bacteria 945
34 Ga0070680_100041035 3300005336 Bacteria 3752
35 Ga0070682_100862813 3300005337 Bacteria 741
36 Ga0070682_101499511 3300005337 Unclassified 580
37 Ga0070689_100060968 3300005340 Bacteria 2933
38 Ga0070689_100068670 3300005340 Bacteria 2764
39 Ga0070689_100744439 3300005340 Bacteria 859
40 Ga0070687_100398734 3300005343 Bacteria 902
41 Ga0070668_100399802 3300005347 Bacteria 1173
42 Ga0070668_100435383 3300005347 Bacteria 1125
43 Ga0070668_102059709 3300005347 Bacteria 527
44 Ga0070688_100761064 3300005365 Bacteria 755
45 Ga0070688_100958114 3300005365 Bacteria 678
46 Ga0070688_101032309 3300005365 Bacteria 654
47 Ga0070701_10176233 3300005438 Bacteria 1248
48 Ga0070711_101888347 3300005439 Bacteria 525
49 Ga0070700_100480548 3300005441 Bacteria 951
50 Ga0070708_100353046 3300005445 Bacteria 1386
51 Ga0070681_11312304 3300005458 Bacteria 646
52 Ga0068867_100739566 3300005459 Bacteria 872
53 Ga0068867_101541374 3300005459 Bacteria 620
54 Ga0070685_10029362 3300005466 Bacteria 3054
55 Ga0070685_10146006 3300005466 Bacteria 1494
56 Ga0070685_10876279 3300005466 Bacteria 667
57 Ga0070685_11440014 3300005466 Bacteria 530
58 Ga0070706_100043559 3300005467 Bacteria 4148
59 Ga0070707_102054869 3300005468 Unclassified 539
60 Ga0070698_100023294 3300005471 Bacteria 6474
61 Ga0070699_100248513 3300005518 Bacteria 1589
62 Ga0070679_100029856 3300005530 Bacteria 5379
63 Ga0070684_102235422 3300005535 Bacteria 516
64 Ga0068853_102130321 3300005539 Bacteria 544
65 Ga0070665_100003873 3300005548 Bacteria 15830
66 Ga0070665_100409315 3300005548 Bacteria 1364
67 Ga0070665_101132127 3300005548 Bacteria 794
68 Ga0068855_101505679 3300005563 Bacteria 691
69 Ga0068856_100045670 3300005614 Bacteria 4314
70 Ga0068856_100517206 3300005614 Bacteria 1215
71 Ga0068859_101022763 3300005617 Bacteria 908
72 Ga0068864_100975422 3300005618 Bacteria 840
73 Ga0068866_10224696 3300005718 Bacteria 1135
74 Ga0068861_100215285 3300005719 Bacteria 1620
75 Ga0068870_10752740 3300005840 Bacteria 677
76 Ga0068863_100175451 3300005841 Bacteria 2057
77 Ga0068863_100365290 3300005841 Bacteria 1408
78 Ga0068863_101508594 3300005841 Bacteria 681
79 Ga0068858_102111844 3300005842 Bacteria 557
80 Ga0068860_100388532 3300005843 Bacteria 1379
81 Ga0068860_100527141 3300005843 Bacteria 1182
82 Ga0068862_100857203 3300005844 Bacteria 891
83 Ga0070717_10012633 3300006028 Bacteria 6443
84 Ga0070717_10115739 3300006028 Bacteria 2292
85 Ga0070712_100319135 3300006175 Bacteria 1263
86 Ga0075362_10422712 3300006177 Bacteria 674
87 Ga0097621_101103887 3300006237 Bacteria 745
88 Ga0097621_101212366 3300006237 Bacteria 711
89 Ga0068871_100360417 3300006358 Bacteria 1288
90 Ga0068871_100652614 3300006358 Bacteria 961
91 Ga0075428_100831039 3300006844 Bacteria 981
92 Ga0075430_100140538 3300006846 Bacteria 2011
93 Ga0075431_100112823 3300006847 Bacteria 2805
94 Ga0075431_100514545 3300006847 Bacteria 1187
95 Ga0075434_100738358 3300006871 Bacteria 1002
96 Ga0075429_100050631 3300006880 Bacteria 3614
97 Ga0075429_100841942 3300006880 Bacteria 803
98 Ga0075436_100185884 3300006914 Bacteria 1469
99 Ga0097620_101022776 3300006931 Bacteria 908
100 Ga0075435_100092721 3300007076 Bacteria 2495
101 Ga0075435_100789486 3300007076 Bacteria 826
102 Ga0105251_10556443 3300009011 Bacteria 541
103 Ga0105240_10728977 3300009093 Bacteria 1079
104 Ga0105245_10006329 3300009098 Bacteria 10417
105 Ga0105245_10327480 3300009098 Bacteria 1511
106 Ga0105245_10432628 3300009098 Bacteria 1321
107 Ga0114129_13309755 3300009147 Unclassified 521
108 Ga0105243_10725280 3300009148 Bacteria 972
109 Ga0105241_10380845 3300009174 Bacteria 1233
110 Ga0105242_10602589 3300009176 Bacteria 1061
111 Ga0105248_10135723 3300009177 Bacteria 2776
112 Ga0105248_12022561 3300009177 Bacteria 655
113 Ga0105237_10105177 3300009545 Bacteria 2814
114 Ga0105237_10128302 3300009545 Bacteria 2530
115 Ga0105238_10478046 3300009551 Bacteria 1245
116 Ga0105249_10010014 3300009553 Bacteria 8319
117 Ga0105249_10027935 3300009553 Bacteria 5092
118 Ga0105239_10324018 3300010375 Bacteria 1738
119 Ga0105239_13518232 3300010375 Bacteria 509
120 Ga0157374_10608885 3300013296 Bacteria 1103
121 Ga0157374_10887791 3300013296 Bacteria 909
122 Ga0157378_10235874 3300013297 Bacteria 1745
123 Ga0157378_10628560 3300013297 Bacteria 1087
124 Ga0157372_12842451 3300013307 Bacteria 555
125 Ga0163163_12736164 3300014325 Bacteria 550
126 Ga0157376_10107887 3300014969 Bacteria 2445
127 Ga0157376_10109141 3300014969 Bacteria 2432
128 Ga0182007_10291028 3300015262 Bacteria 597
129 Ga0207653_10037853 3300025885 Bacteria 1574
130 Ga0207642_10177053 3300025899 Bacteria 1159
131 Ga0207699_11495463 3300025906 Bacteria 500
132 Ga0207684_10081694 3300025910 Bacteria 2750
133 Ga0207654_10336411 3300025911 Bacteria 1036
134 Ga0207654_10884081 3300025911 Bacteria 647
135 Ga0207671_10183473 3300025914 Bacteria 1629
136 Ga0207660_10049962 3300025917 Bacteria 2968
137 Ga0207662_10139585 3300025918 Bacteria 1534
138 Ga0207657_11281675 3300025919 Bacteria 554
139 Ga0207650_10072851 3300025925 Bacteria 2586
140 Ga0207650_10268393 3300025925 Bacteria 1386
141 Ga0207687_10002701 3300025927 Bacteria 11998
142 Ga0207687_10361691 3300025927 Bacteria 1184
143 Ga0207687_10475861 3300025927 Bacteria 1039
144 Ga0207686_10327713 3300025934 Bacteria 1146
145 Ga0207670_10040810 3300025936 Bacteria 3048
146 Ga0207711_10863818 3300025941 Bacteria 842
147 Ga0207689_10205480 3300025942 Bacteria 1626
148 Ga0207689_10440419 3300025942 Bacteria 1088
149 Ga0207661_10166853 3300025944 Bacteria 1914
150 Ga0207661_10576717 3300025944 Bacteria 1032
151 Ga0207712_10056246 3300025961 Bacteria 2771
152 Ga0207712_10458350 3300025961 Bacteria 1083
153 Ga0207668_10392897 3300025972 Bacteria 1171
154 Ga0207668_10629475 3300025972 Bacteria 937
155 Ga0207658_10109480 3300025986 Bacteria 2181
156 Ga0207677_11433060 3300026023 Bacteria 637
157 Ga0207703_12328289 3300026035 Bacteria 511
158 Ga0207708_10423259 3300026075 Bacteria 1105
159 Ga0207702_10051625 3300026078 Bacteria 3476
160 Ga0207641_11045044 3300026088 Bacteria 814
161 Ga0207641_11332549 3300026088 Bacteria 718
162 Ga0207648_10198167 3300026089 Bacteria 1781
163 Ga0207676_10114479 3300026095 Bacteria 2263
164 Ga0207676_10295599 3300026095 Bacteria 1477
165 Ga0207676_10526305 3300026095 Bacteria 1126
166 Ga0207675_100297839 3300026118 Bacteria 1570
167 Ga0207675_100523290 3300026118 Bacteria 1183
168 Ga0207698_12361853 3300026142 Bacteria 543
169 Ga0268266_10004072 3300028379 Bacteria 14133
170 Ga0268265_10530697 3300028380 Bacteria 1114
171 Ga0268264_10574254 3300028381 Bacteria 1108
172 Ga0268264_10625254 3300028381 Bacteria 1063
173 Ga0265326_10171477 3300028558 Bacteria 621
174 Ga0265334_10022855 3300028573 Bacteria 2545
175 Ga0265323_10007828 3300028653 Bacteria 4418
176 Ga0307517_10161792 3300028786 Bacteria 1499
177 Ga0307515_10050803 3300028794 Bacteria 6200
178 Ga0265338_10010133 3300028800 Bacteria 11121
179 Ga0265330_10000541 3300031235 Bacteria 24732
180 Ga0265330_10347259 3300031235 Bacteria 626
181 Ga0265332_10025924 3300031238 Bacteria 2572
182 Ga0265339_10469311 3300031249 Bacteria 583
183 Ga0265316_10018769 3300031344 Bacteria 5936
184 Ga0265316_10028493 3300031344 Bacteria 4607
185 Ga0307513_10011625 3300031456 Bacteria 10928
186 Ga0307513_10244826 3300031456 Bacteria 1595
187 Ga0307509_10000112 3300031507 Bacteria 117028
188 Ga0307509_10009750 3300031507 Bacteria 11917
189 Ga0307509_10011836 3300031507 Bacteria 10500
190 Ga0307509_10278309 3300031507 Bacteria 1436
191 Ga0307408_100902794 3300031548 Bacteria 809
192 Ga0307508_10019824 3300031616 Bacteria 6113
193 Ga0307508_10178586 3300031616 Bacteria 1726
194 Ga0265314_10053770 3300031711 Bacteria 2791
195 Ga0265342_10036131 3300031712 Bacteria 3019
196 Ga0265342_10642434 3300031712 Bacteria 533
197 Ga0307516_10029367 3300031730 Bacteria 5559
198 Ga0307516_10147898 3300031730 Bacteria 2113
199 Ga0307413_11752391 3300031824 Bacteria 555
200 Ga0307406_10000446 3300031901 Bacteria 24118
201 Ga0307416_100551347 3300032002 Bacteria 1226
202 Ga0307411_10904822 3300032005 Bacteria 784
203 Ga0307415_100530047 3300032126 Bacteria 1035
204 Ga0307507_10458494 3300033179 Bacteria 701
205 Ga0373958_0156940 3300034819 Bacteria 573
206 Ga0373958_0200049 3300034819 Bacteria 523
207 Ga0373944_0041153 3300035089 Bacteria 1429
208 Ga0373949_0000042 3300035090 Bacteria 46169
209 Ga0373936_0000006 3300035113 Bacteria 318697
210 Ga0373941_0080996 3300035115 Bacteria 1096
211 Ga0373941_0088978 3300035115 Bacteria 1056
212 Ga0373954_0109998 3300035118 Bacteria 1333
213 Ga0373960_0264030 3300035121 Bacteria 629
214 Ga0373942_0094574 3300035207 Bacteria 905
215 Ga0373961_0000015 3300035241 Bacteria 111392
216 Ga0373937_1148167 3300036401 Bacteria 725
217 Ga0395900_0553878 3300037418 Bacteria 1094
218 Ga0395898_1127700 3300037466 Bacteria 717
219 Ga0395905_0810246 3300037471 Bacteria 839
220 Ga0436364_0242647 3300037853 Bacteria 566
221 Ga0395901_0331873 3300038443 Bacteria 1572
222 Ga0436365_0619620 3300039437 Bacteria 994
223 Ga0436363_1053820 3300039450 Bacteria 703
224 Ga0451791_1457931 3300041451 Bacteria 563
225 Ga0451802_0411475 3300041460 Unclassified 625
226 Ga0451807_0681225 3300041486 Bacteria 743
227 Ga0451841_0121833 3300041498 Bacteria 766
228 Ga0451577_0951239 3300042876 Bacteria 772
229 Ga0453684_0200919 3300044712 Bacteria 2324
230 Ga0495603_0453843 3300046455 Bacteria 734
231 Ga0495629_0727212 3300046459 Bacteria 658
232 Ga0495650_0125713 3300046471 Bacteria 940
233 Ga0495594_0665782 3300046499 Bacteria 589
234 Ga0495596_0139463 3300046500 Bacteria 941
235 Ga0495630_0425604 3300046517 Bacteria 1017
236 Ga0495649_0368650 3300046694 Bacteria 724
237 Ga0495686_0016492 3300047472 Bacteria 5009
238 Ga0496106_0770939 3300048909 Bacteria 764
239 Ga0496114_0656053 3300048917 Bacteria 922
240 Ga0501310_031507 3300049130 Bacteria 706
241 Ga0501307_016144 3300049162 Bacteria 928
242 Ga0501292_004796 3300049515 Bacteria 1864
243 Ga0501292_091603 3300049515 Bacteria 591
244 Ga0501317_048074 3300049533 Bacteria 670
245 Ga0501037_0333893 3300049573 Bacteria 1048
246 Ga0501048_0309374 3300049582 Bacteria 1125
247 Ga0501067_0003984 3300049583 Bacteria 8152
248 Ga0501068_1133733 3300049584 Bacteria 517
249 Ga0501068_1193662 3300049584 Bacteria 504
250 Ga0501069_0048002 3300049585 Bacteria 2370
251 Ga0501069_0830797 3300049585 Unclassified 561
252 Ga0501070_0185214 3300049586 Bacteria 1712
253 Ga0501071_0077582 3300049587 Bacteria 2427
254 Ga0501073_0257915 3300049589 Bacteria 1203
255 Ga0501073_0449367 3300049589 Bacteria 891
256 Ga0501074_0399241 3300049590 Bacteria 975
257 Ga0501209_037372 3300049656 Bacteria 1267
258 Ga0501216_058018 3300049660 Bacteria 775
259 Ga0501217_004662 3300049661 Bacteria 2827
260 Ga0501227_000308 3300049665 Bacteria 10150
261 Ga0501230_000278 3300049667 Bacteria 4734
262 Ga0501230_046117 3300049667 Bacteria 856
263 Ga0501233_005149 3300049668 Bacteria 2420
264 Ga0501235_088420 3300049669 Bacteria 746
265 Ga0501236_070905 3300049670 Bacteria 636
266 Ga0501249_051164 3300049679 Bacteria 948
267 Ga0501080_0461111 3300049742 Bacteria 1138
268 Ga0501081_0157176 3300049743 Bacteria 1636
269 nmdc:mga09592_30246_c1 3300050508 Bacteria 4506
270 nmdc:mga09592_517094_c1 3300050508 Bacteria 1027
271 nmdc:mga0qj67_246643_c1 3300050509 Bacteria 1449
272 nmdc:mga06r32_63289_c1 3300050510 Bacteria 3565
273 nmdc:mga06r32_939011_c1 3300050510 Bacteria 820
274 nmdc:mga08y16_300293_c1 3300050511 Bacteria 1655
275 nmdc:mga0n895_611848_c1 3300050512 Bacteria 1091
276 nmdc:mga0rr50_151927_c1 3300050513 Bacteria 1872
277 nmdc:mga0rr50_425226_c1 3300050513 Bacteria 1124
278 Ga0495601_1013446 3300053077 Unclassified 522
279 Ga0500578_0031166 3300053086 Bacteria 3427
280 Ga0500578_0509688 3300053086 Bacteria 675
281 Ga0500644_0557622 3300053088 Bacteria 506
282 Ga0500646_0001595 3300053090 Bacteria 5980
283 Ga0500647_0228636 3300053091 Bacteria 829
284 Ga0500566_0019815 3300053094 Bacteria 3950
285 Ga0500566_0144033 3300053094 Bacteria 1261
286 Ga0500566_0370280 3300053094 Bacteria 650
287 Ga0500566_0415293 3300053094 Bacteria 598
288 Ga0500640_001894 3300053095 Bacteria 6655
289 Ga0500554_001759 3300053102 Bacteria 4175
290 Ga0500554_095900 3300053102 Bacteria 989
291 Ga0500554_102536 3300053102 Bacteria 958
292 Ga0500555_168785 3300053103 Bacteria 532
293 Ga0500557_187082 3300053105 Bacteria 671
294 Ga0500562_008730 3300053108 Bacteria 2560
295 Ga0500572_001298 3300053111 Bacteria 6986
296 Ga0500594_0229677 3300053118 Bacteria 615
297 Ga0500595_001095 3300053119 Bacteria 15031
298 Ga0500595_060116 3300053119 Bacteria 1151
299 Ga0500597_016056 3300053120 Bacteria 2846
300 Ga0500597_273927 3300053120 Bacteria 682
301 Ga0500614_001697 3300053123 Bacteria 5142
302 Ga0500614_002285 3300053123 Bacteria 4308
303 Ga0500642_0010056 3300053130 Bacteria 3319
304 Ga0500642_0044621 3300053130 Bacteria 1932
305 Ga0500655_032010 3300053133 Bacteria 1015
306 Ga0500559_0337053 3300053136 Bacteria 706
307 Ga0500564_119192 3300053138 Bacteria 1152
308 Ga0500577_0114586 3300053142 Bacteria 1116
309 Ga0500585_047104 3300053144 Bacteria 1534
310 Ga0500603_005211 3300053150 Bacteria 2790
311 Ga0500603_043564 3300053150 Bacteria 1206
312 Ga0500619_064664 3300053154 Bacteria 1209
313 Ga0500622_0018027 3300053156 Bacteria 3754
314 Ga0500630_282662 3300053159 Bacteria 554
315 Ga0500639_284134 3300053163 Bacteria 635
316 Ga0500636_0073495 3300053177 Bacteria 1980
317 Ga0500636_0254559 3300053177 Bacteria 893
318 Ga0500636_0272648 3300053177 Bacteria 849
319 Ga0500637_0229987 3300053178 Bacteria 1045
320 Ga0587072_061517 3300059643 Bacteria 774
321 Ga0587072_166589 3300059643 Bacteria 542
322 Ga0501082_1359332 3300060353 Bacteria 620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046471 Ga0495650_0125713 Ga0495650_0125713_628_915 93
2 3300006846 Ga0075430_100140538 Ga0075430_1001405382 94
3 3300006847 Ga0075431_100112823 Ga0075431_1001128237 94
4 3300006880 Ga0075429_100050631 Ga0075429_1000506317 94
5 3300050508 nmdc:mga09592_30246_c1 nmdc:mga09592_30246_c1_2925_3242 94
6 3300050509 nmdc:mga0qj67_246643_c1 nmdc:mga0qj67_246643_c1_364_681 94
7 3300050510 nmdc:mga06r32_63289_c1 nmdc:mga06r32_63289_c1_3162_3479 94
8 3300053105 Ga0500557_187082 Ga0500557_187082_373_660 94
9 3300006177 Ga0075362_10422712 Ga0075362_104227121 95
10 3300026035 Ga0207703_12328289 Ga0207703_123282892 98
11 3300005329 Ga0070683_100248182 Ga0070683_1002481822 101
12 3300005614 Ga0068856_100517206 Ga0068856_1005172062 101
13 3300053177 Ga0500636_0254559 Ga0500636_0254559_326_700 101
14 3300003163 Ga0006759J45824_1061226 Ga0006759J45824_10612262 102
15 3300003305 Ga0006770J48903_1028711 Ga0006770J48903_10287112 102
16 3300003544 Ga0007417J51691_1036907 Ga0007417J51691_10369071 102
17 3300004798 Ga0058859_10057719 Ga0058859_100577193 102
18 3300004798 Ga0058859_10061516 Ga0058859_100615162 102
19 3300004798 Ga0058859_11762135 Ga0058859_117621352 102
20 3300004798 Ga0058859_11768326 Ga0058859_117683262 102
21 3300004798 Ga0058859_11775024 Ga0058859_117750241 102
22 3300004800 Ga0058861_10047495 Ga0058861_100474951 102
23 3300004800 Ga0058861_12076589 Ga0058861_120765891 102
24 3300004801 Ga0058860_12084468 Ga0058860_120844683 102
25 3300004801 Ga0058860_12197989 Ga0058860_121979892 102
26 3300004803 Ga0058862_10061662 Ga0058862_100616622 102
27 3300004803 Ga0058862_10069386 Ga0058862_100693866 102
28 3300004803 Ga0058862_12705038 Ga0058862_127050382 102
29 3300005327 Ga0070658_11818814 Ga0070658_118188141 102
30 3300005329 Ga0070683_100249041 Ga0070683_1002490412 102
31 3300005330 Ga0070690_100041813 Ga0070690_1000418133 102
32 3300005330 Ga0070690_100295616 Ga0070690_1002956162 102
33 3300005331 Ga0070670_100287184 Ga0070670_1002871843 102
34 3300005334 Ga0068869_100489240 Ga0068869_1004892402 102
35 3300005334 Ga0068869_100580727 Ga0068869_1005807272 102
36 3300005336 Ga0070680_100041035 Ga0070680_1000410355 102
37 3300005337 Ga0070682_100862813 Ga0070682_1008628132 102
38 3300005337 Ga0070682_101499511 Ga0070682_1014995111 102
39 3300005340 Ga0070689_100060968 Ga0070689_1000609686 102
40 3300005340 Ga0070689_100068670 Ga0070689_1000686705 102
41 3300005340 Ga0070689_100744439 Ga0070689_1007444392 102
42 3300005343 Ga0070687_100398734 Ga0070687_1003987342 102
43 3300005347 Ga0070668_100399802 Ga0070668_1003998021 102
44 3300005347 Ga0070668_100435383 Ga0070668_1004353833 102
45 3300005347 Ga0070668_102059709 Ga0070668_1020597091 102
46 3300005365 Ga0070688_100761064 Ga0070688_1007610642 102
47 3300005365 Ga0070688_100958114 Ga0070688_1009581141 102
48 3300005365 Ga0070688_101032309 Ga0070688_1010323091 102
49 3300005438 Ga0070701_10176233 Ga0070701_101762332 102
50 3300005439 Ga0070711_101888347 Ga0070711_1018883472 102
51 3300005441 Ga0070700_100480548 Ga0070700_1004805483 102
52 3300005445 Ga0070708_100353046 Ga0070708_1003530464 102
53 3300005458 Ga0070681_11312304 Ga0070681_113123042 102
54 3300005459 Ga0068867_100739566 Ga0068867_1007395662 102
55 3300005459 Ga0068867_101541374 Ga0068867_1015413741 102
56 3300005466 Ga0070685_10029362 Ga0070685_100293623 102
57 3300005466 Ga0070685_10146006 Ga0070685_101460062 102
58 3300005466 Ga0070685_10876279 Ga0070685_108762792 102
59 3300005466 Ga0070685_11440014 Ga0070685_114400142 102
60 3300005467 Ga0070706_100043559 Ga0070706_1000435599 102
61 3300005468 Ga0070707_102054869 Ga0070707_1020548692 102
62 3300005471 Ga0070698_100023294 Ga0070698_10002329412 102
63 3300005518 Ga0070699_100248513 Ga0070699_1002485131 102
64 3300005530 Ga0070679_100029856 Ga0070679_1000298565 102
65 3300005535 Ga0070684_102235422 Ga0070684_1022354221 102
66 3300005539 Ga0068853_102130321 Ga0068853_1021303212 102
67 3300005548 Ga0070665_100003873 Ga0070665_10000387319 102
68 3300005548 Ga0070665_100409315 Ga0070665_1004093152 102
69 3300005548 Ga0070665_101132127 Ga0070665_1011321271 102
70 3300005563 Ga0068855_101505679 Ga0068855_1015056792 102
71 3300005614 Ga0068856_100045670 Ga0068856_1000456706 102
72 3300005617 Ga0068859_101022763 Ga0068859_1010227632 102
73 3300005618 Ga0068864_100975422 Ga0068864_1009754221 102
74 3300005718 Ga0068866_10224696 Ga0068866_102246961 102
75 3300005719 Ga0068861_100215285 Ga0068861_1002152852 102
76 3300005840 Ga0068870_10752740 Ga0068870_107527401 102
77 3300005841 Ga0068863_100175451 Ga0068863_1001754512 102
78 3300005841 Ga0068863_100365290 Ga0068863_1003652903 102
79 3300005841 Ga0068863_101508594 Ga0068863_1015085941 102
80 3300005842 Ga0068858_102111844 Ga0068858_1021118442 102
81 3300005843 Ga0068860_100388532 Ga0068860_1003885323 102
82 3300005843 Ga0068860_100527141 Ga0068860_1005271412 102
83 3300005844 Ga0068862_100857203 Ga0068862_1008572032 102
84 3300006028 Ga0070717_10012633 Ga0070717_100126339 102
85 3300006028 Ga0070717_10115739 Ga0070717_101157396 102
86 3300006175 Ga0070712_100319135 Ga0070712_1003191353 102
87 3300006237 Ga0097621_101103887 Ga0097621_1011038872 102
88 3300006237 Ga0097621_101212366 Ga0097621_1012123662 102
89 3300006358 Ga0068871_100360417 Ga0068871_1003604173 102
90 3300006358 Ga0068871_100652614 Ga0068871_1006526142 102
91 3300006847 Ga0075431_100514545 Ga0075431_1005145452 102
92 3300006871 Ga0075434_100738358 Ga0075434_1007383582 102
93 3300006914 Ga0075436_100185884 Ga0075436_1001858841 102
94 3300006931 Ga0097620_101022776 Ga0097620_1010227762 102
95 3300007076 Ga0075435_100092721 Ga0075435_1000927214 102
96 3300007076 Ga0075435_100789486 Ga0075435_1007894862 102
97 3300009011 Ga0105251_10556443 Ga0105251_105564432 102
98 3300009093 Ga0105240_10728977 Ga0105240_107289771 102
99 3300009098 Ga0105245_10006329 Ga0105245_100063296 102
100 3300009098 Ga0105245_10327480 Ga0105245_103274805 102
101 3300009098 Ga0105245_10432628 Ga0105245_104326282 102
102 3300009147 Ga0114129_13309755 Ga0114129_133097552 102
103 3300009148 Ga0105243_10725280 Ga0105243_107252801 102
104 3300009174 Ga0105241_10380845 Ga0105241_103808453 102
105 3300009176 Ga0105242_10602589 Ga0105242_106025893 102
106 3300009177 Ga0105248_10135723 Ga0105248_101357236 102
107 3300009177 Ga0105248_12022561 Ga0105248_120225612 102
108 3300009545 Ga0105237_10105177 Ga0105237_101051773 102
109 3300009551 Ga0105238_10478046 Ga0105238_104780462 102
110 3300009553 Ga0105249_10010014 Ga0105249_1001001410 102
111 3300009553 Ga0105249_10027935 Ga0105249_1002793510 102
112 3300010375 Ga0105239_10324018 Ga0105239_103240184 102
113 3300010375 Ga0105239_13518232 Ga0105239_135182321 102
114 3300013296 Ga0157374_10608885 Ga0157374_106088852 102
115 3300013296 Ga0157374_10887791 Ga0157374_108877913 102
116 3300013297 Ga0157378_10235874 Ga0157378_102358745 102
117 3300013297 Ga0157378_10628560 Ga0157378_106285602 102
118 3300013307 Ga0157372_12842451 Ga0157372_128424512 102
119 3300014325 Ga0163163_12736164 Ga0163163_127361642 102
120 3300014969 Ga0157376_10107887 Ga0157376_101078876 102
121 3300014969 Ga0157376_10109141 Ga0157376_101091414 102
122 3300015262 Ga0182007_10291028 Ga0182007_102910281 102
123 3300025885 Ga0207653_10037853 Ga0207653_100378532 102
124 3300025899 Ga0207642_10177053 Ga0207642_101770533 102
125 3300025906 Ga0207699_11495463 Ga0207699_114954632 102
126 3300025910 Ga0207684_10081694 Ga0207684_100816945 102
127 3300025911 Ga0207654_10336411 Ga0207654_103364112 102
128 3300025911 Ga0207654_10884081 Ga0207654_108840812 102
129 3300025917 Ga0207660_10049962 Ga0207660_100499626 102
130 3300025918 Ga0207662_10139585 Ga0207662_101395852 102
131 3300025919 Ga0207657_11281675 Ga0207657_112816752 102
132 3300025925 Ga0207650_10072851 Ga0207650_100728516 102
133 3300025925 Ga0207650_10268393 Ga0207650_102683932 102
134 3300025927 Ga0207687_10002701 Ga0207687_1000270113 102
135 3300025927 Ga0207687_10361691 Ga0207687_103616912 102
136 3300025927 Ga0207687_10475861 Ga0207687_104758612 102
137 3300025934 Ga0207686_10327713 Ga0207686_103277132 102
138 3300025936 Ga0207670_10040810 Ga0207670_100408106 102
139 3300025941 Ga0207711_10863818 Ga0207711_108638183 102
140 3300025942 Ga0207689_10205480 Ga0207689_102054802 102
141 3300025942 Ga0207689_10440419 Ga0207689_104404192 102
142 3300025944 Ga0207661_10166853 Ga0207661_101668532 102
143 3300025944 Ga0207661_10576717 Ga0207661_105767172 102
144 3300025961 Ga0207712_10056246 Ga0207712_100562465 102
145 3300025961 Ga0207712_10458350 Ga0207712_104583502 102
146 3300025972 Ga0207668_10392897 Ga0207668_103928972 102
147 3300025972 Ga0207668_10629475 Ga0207668_106294752 102
148 3300025986 Ga0207658_10109480 Ga0207658_101094802 102
149 3300026023 Ga0207677_11433060 Ga0207677_114330602 102
150 3300026075 Ga0207708_10423259 Ga0207708_104232592 102
151 3300026078 Ga0207702_10051625 Ga0207702_100516254 102
152 3300026088 Ga0207641_11045044 Ga0207641_110450442 102
153 3300026088 Ga0207641_11332549 Ga0207641_113325491 102
154 3300026089 Ga0207648_10198167 Ga0207648_101981672 102
155 3300026095 Ga0207676_10114479 Ga0207676_101144792 102
156 3300026095 Ga0207676_10526305 Ga0207676_105263052 102
157 3300026118 Ga0207675_100297839 Ga0207675_1002978393 102
158 3300026118 Ga0207675_100523290 Ga0207675_1005232902 102
159 3300026142 Ga0207698_12361853 Ga0207698_123618532 102
160 3300028379 Ga0268266_10004072 Ga0268266_100040729 102
161 3300028380 Ga0268265_10530697 Ga0268265_105306972 102
162 3300028381 Ga0268264_10574254 Ga0268264_105742542 102
163 3300028381 Ga0268264_10625254 Ga0268264_106252542 102
164 3300028786 Ga0307517_10161792 Ga0307517_101617922 102
165 3300028794 Ga0307515_10050803 Ga0307515_100508039 102
166 3300028800 Ga0265338_10010133 Ga0265338_100101335 102
167 3300031238 Ga0265332_10025924 Ga0265332_100259245 102
168 3300031249 Ga0265339_10469311 Ga0265339_104693111 102
169 3300031456 Ga0307513_10011625 Ga0307513_100116254 102
170 3300031456 Ga0307513_10244826 Ga0307513_102448263 102
171 3300031507 Ga0307509_10000112 Ga0307509_1000011295 102
172 3300031507 Ga0307509_10009750 Ga0307509_1000975015 102
173 3300031507 Ga0307509_10011836 Ga0307509_100118369 102
174 3300031507 Ga0307509_10278309 Ga0307509_102783092 102
175 3300031548 Ga0307408_100902794 Ga0307408_1009027942 102
176 3300031616 Ga0307508_10019824 Ga0307508_1001982411 102
177 3300031616 Ga0307508_10178586 Ga0307508_101785862 102
178 3300031711 Ga0265314_10053770 Ga0265314_100537705 102
179 3300031730 Ga0307516_10029367 Ga0307516_1002936711 102
180 3300031730 Ga0307516_10147898 Ga0307516_101478983 102
181 3300031824 Ga0307413_11752391 Ga0307413_117523912 102
182 3300031901 Ga0307406_10000446 Ga0307406_1000044618 102
183 3300032002 Ga0307416_100551347 Ga0307416_1005513474 102
184 3300032005 Ga0307411_10904822 Ga0307411_109048222 102
185 3300032126 Ga0307415_100530047 Ga0307415_1005300472 102
186 3300033179 Ga0307507_10458494 Ga0307507_104584942 102
187 3300034819 Ga0373958_0156940 Ga0373958_0156940_167_487 102
188 3300034819 Ga0373958_0200049 Ga0373958_0200049_86_406 102
189 3300035089 Ga0373944_0041153 Ga0373944_0041153_850_1170 102
190 3300035090 Ga0373949_0000042 Ga0373949_0000042_2634_2954 102
191 3300035113 Ga0373936_0000006 Ga0373936_0000006_125419_125736 102
192 3300035115 Ga0373941_0080996 Ga0373941_0080996_618_938 102
193 3300035115 Ga0373941_0088978 Ga0373941_0088978_584_904 102
194 3300035118 Ga0373954_0109998 Ga0373954_0109998_128_454 102
195 3300035121 Ga0373960_0264030 Ga0373960_0264030_121_441 102
196 3300035207 Ga0373942_0094574 Ga0373942_0094574_420_746 102
197 3300035241 Ga0373961_0000015 Ga0373961_0000015_105898_106227 102
198 3300037418 Ga0395900_0553878 Ga0395900_0553878_235_552 102
199 3300037466 Ga0395898_1127700 Ga0395898_1127700_70_387 102
200 3300037471 Ga0395905_0810246 Ga0395905_0810246_33_350 102
201 3300037853 Ga0436364_0242647 Ga0436364_0242647_219_536 102
202 3300038443 Ga0395901_0331873 Ga0395901_0331873_1064_1381 102
203 3300039437 Ga0436365_0619620 Ga0436365_0619620_256_585 102
204 3300039450 Ga0436363_1053820 Ga0436363_1053820_186_503 102
205 3300041451 Ga0451791_1457931 Ga0451791_1457931_135_464 102
206 3300041460 Ga0451802_0411475 Ga0451802_0411475_269_598 102
207 3300041498 Ga0451841_0121833 Ga0451841_0121833_223_549 102
208 3300042876 Ga0451577_0951239 Ga0451577_0951239_309_638 102
209 3300044712 Ga0453684_0200919 Ga0453684_0200919_614_943 102
210 3300046455 Ga0495603_0453843 Ga0495603_0453843_80_400 102
211 3300046459 Ga0495629_0727212 Ga0495629_0727212_110_430 102
212 3300046499 Ga0495594_0665782 Ga0495594_0665782_164_484 102
213 3300046500 Ga0495596_0139463 Ga0495596_0139463_10_336 102
214 3300046517 Ga0495630_0425604 Ga0495630_0425604_46_366 102
215 3300046694 Ga0495649_0368650 Ga0495649_0368650_276_596 102
216 3300047472 Ga0495686_0016492 Ga0495686_0016492_1406_1735 102
217 3300048909 Ga0496106_0770939 Ga0496106_0770939_27_353 102
218 3300048917 Ga0496114_0656053 Ga0496114_0656053_325_651 102
219 3300049130 Ga0501310_031507 Ga0501310_031507_190_507 102
220 3300049162 Ga0501307_016144 Ga0501307_016144_114_431 102
221 3300049515 Ga0501292_004796 Ga0501292_004796_397_717 102
222 3300049515 Ga0501292_091603 Ga0501292_091603_144_461 102
223 3300049533 Ga0501317_048074 Ga0501317_048074_116_433 102
224 3300049573 Ga0501037_0333893 Ga0501037_0333893_358_675 102
225 3300049582 Ga0501048_0309374 Ga0501048_0309374_199_516 102
226 3300049584 Ga0501068_1133733 Ga0501068_1133733_19_348 102
227 3300049585 Ga0501069_0048002 Ga0501069_0048002_1032_1361 102
228 3300049585 Ga0501069_0830797 Ga0501069_0830797_41_358 102
229 3300049586 Ga0501070_0185214 Ga0501070_0185214_645_974 102
230 3300049587 Ga0501071_0077582 Ga0501071_0077582_406_735 102
231 3300049589 Ga0501073_0257915 Ga0501073_0257915_429_746 102
232 3300049589 Ga0501073_0449367 Ga0501073_0449367_390_719 102
233 3300049590 Ga0501074_0399241 Ga0501074_0399241_544_873 102
234 3300049656 Ga0501209_037372 Ga0501209_037372_136_456 102
235 3300049660 Ga0501216_058018 Ga0501216_058018_112_432 102
236 3300049661 Ga0501217_004662 Ga0501217_004662_2364_2684 102
237 3300049665 Ga0501227_000308 Ga0501227_000308_2561_2881 102
238 3300049667 Ga0501230_000278 Ga0501230_000278_2348_2671 102
239 3300049667 Ga0501230_046117 Ga0501230_046117_347_664 102
240 3300049668 Ga0501233_005149 Ga0501233_005149_352_672 102
241 3300049669 Ga0501235_088420 Ga0501235_088420_329_646 102
242 3300049670 Ga0501236_070905 Ga0501236_070905_109_426 102
243 3300049679 Ga0501249_051164 Ga0501249_051164_616_933 102
244 3300049742 Ga0501080_0461111 Ga0501080_0461111_506_823 102
245 3300049743 Ga0501081_0157176 Ga0501081_0157176_372_701 102
246 3300050510 nmdc:mga06r32_939011_c1 nmdc:mga06r32_939011_c1_96_434 102
247 3300050512 nmdc:mga0n895_611848_c1 nmdc:mga0n895_611848_c1_625_945 102
248 3300050513 nmdc:mga0rr50_151927_c1 nmdc:mga0rr50_151927_c1_716_1045 102
249 3300050513 nmdc:mga0rr50_425226_c1 nmdc:mga0rr50_425226_c1_170_490 102
250 3300053077 Ga0495601_1013446 Ga0495601_1013446_166_483 102
251 3300053086 Ga0500578_0031166 Ga0500578_0031166_2288_2608 102
252 3300053086 Ga0500578_0509688 Ga0500578_0509688_344_664 102
253 3300053088 Ga0500644_0557622 Ga0500644_0557622_41_361 102
254 3300053090 Ga0500646_0001595 Ga0500646_0001595_4742_5062 102
255 3300053091 Ga0500647_0228636 Ga0500647_0228636_321_641 102
256 3300053094 Ga0500566_0019815 Ga0500566_0019815_1700_2020 102
257 3300053094 Ga0500566_0144033 Ga0500566_0144033_515_868 102
258 3300053094 Ga0500566_0370280 Ga0500566_0370280_233_553 102
259 3300053094 Ga0500566_0415293 Ga0500566_0415293_192_512 102
260 3300053095 Ga0500640_001894 Ga0500640_001894_1795_2115 102
261 3300053102 Ga0500554_001759 Ga0500554_001759_618_938 102
262 3300053102 Ga0500554_095900 Ga0500554_095900_211_531 102
263 3300053102 Ga0500554_102536 Ga0500554_102536_123_443 102
264 3300053103 Ga0500555_168785 Ga0500555_168785_186_506 102
265 3300053108 Ga0500562_008730 Ga0500562_008730_564_884 102
266 3300053111 Ga0500572_001298 Ga0500572_001298_1738_2058 102
267 3300053118 Ga0500594_0229677 Ga0500594_0229677_192_512 102
268 3300053119 Ga0500595_001095 Ga0500595_001095_8589_8909 102
269 3300053119 Ga0500595_060116 Ga0500595_060116_357_677 102
270 3300053120 Ga0500597_016056 Ga0500597_016056_901_1221 102
271 3300053120 Ga0500597_273927 Ga0500597_273927_218_538 102
272 3300053123 Ga0500614_001697 Ga0500614_001697_484_804 102
273 3300053123 Ga0500614_002285 Ga0500614_002285_1700_2020 102
274 3300053130 Ga0500642_0010056 Ga0500642_0010056_2036_2356 102
275 3300053130 Ga0500642_0044621 Ga0500642_0044621_819_1139 102
276 3300053133 Ga0500655_032010 Ga0500655_032010_669_989 102
277 3300053136 Ga0500559_0337053 Ga0500559_0337053_136_456 102
278 3300053138 Ga0500564_119192 Ga0500564_119192_785_1105 102
279 3300053142 Ga0500577_0114586 Ga0500577_0114586_443_763 102
280 3300053144 Ga0500585_047104 Ga0500585_047104_783_1103 102
281 3300053150 Ga0500603_005211 Ga0500603_005211_1577_1897 102
282 3300053150 Ga0500603_043564 Ga0500603_043564_448_768 102
283 3300053154 Ga0500619_064664 Ga0500619_064664_807_1127 102
284 3300053156 Ga0500622_0018027 Ga0500622_0018027_3118_3438 102
285 3300053159 Ga0500630_282662 Ga0500630_282662_131_451 102
286 3300053163 Ga0500639_284134 Ga0500639_284134_243_563 102
287 3300053177 Ga0500636_0073495 Ga0500636_0073495_1065_1385 102
288 3300053177 Ga0500636_0272648 Ga0500636_0272648_291_611 102
289 3300053178 Ga0500637_0229987 Ga0500637_0229987_403_723 102
290 3300059643 Ga0587072_061517 Ga0587072_061517_192_512 102
291 3300059643 Ga0587072_166589 Ga0587072_166589_163_480 102
292 3300060353 Ga0501082_1359332 Ga0501082_1359332_36_365 102
293 3300036401 Ga0373937_1148167 Ga0373937_1148167_272_589 103
294 3300002868 Ga0006767J43181_103125 Ga0006767J43181_10312511 104
295 3300002870 Ga0006763J43179_104103 Ga0006763J43179_10410311 104
296 3300002872 Ga0006762J43184_103419 Ga0006762J43184_10341910 104
297 3300003158 Ga0006760J45825_103550 Ga0006760J45825_1035502 104
298 3300003161 Ga0006765J45826_111518 Ga0006765J45826_1115189 104
299 3300003162 Ga0006778J45830_1106924 Ga0006778J45830_11069242 104
300 3300003163 Ga0006759J45824_1006649 Ga0006759J45824_100664913 104
301 3300003163 Ga0006759J45824_1141419 Ga0006759J45824_11414191 104
302 3300003300 Ga0006758J48902_1008419 Ga0006758J48902_100841911 104
303 3300003693 Ga0032354_1009872 Ga0032354_100987212 104
304 3300006844 Ga0075428_100831039 Ga0075428_1008310392 104
305 3300006880 Ga0075429_100841942 Ga0075429_1008419422 104
306 3300009545 Ga0105237_10128302 Ga0105237_101283022 104
307 3300025914 Ga0207671_10183473 Ga0207671_101834734 104
308 3300026095 Ga0207676_10295599 Ga0207676_102955993 104
309 3300028558 Ga0265326_10171477 Ga0265326_101714771 104
310 3300028573 Ga0265334_10022855 Ga0265334_100228551 104
311 3300028653 Ga0265323_10007828 Ga0265323_100078282 104
312 3300031235 Ga0265330_10000541 Ga0265330_1000054122 104
313 3300031235 Ga0265330_10347259 Ga0265330_103472592 104
314 3300031344 Ga0265316_10018769 Ga0265316_1001876910 104
315 3300031344 Ga0265316_10028493 Ga0265316_100284936 104
316 3300031712 Ga0265342_10036131 Ga0265342_100361314 104
317 3300031712 Ga0265342_10642434 Ga0265342_106424341 104
318 3300041486 Ga0451807_0681225 Ga0451807_0681225_222_554 104
319 3300049583 Ga0501067_0003984 Ga0501067_0003984_6846_7160 104
320 3300049584 Ga0501068_1193662 Ga0501068_1193662_74_388 104
321 3300050508 nmdc:mga09592_517094_c1 nmdc:mga09592_517094_c1_195_518 104
322 3300050511 nmdc:mga08y16_300293_c1 nmdc:mga08y16_300293_c1_879_1205 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

6

35

0.94

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

37

111

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zq6-assembly1.cif.gz_u 70s e. coli ribosome with truncated ul23 and ul24 loops and a stalled filamin domain 5 nascent chain 0.9485 2 101
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9438 1 70
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9407 1 101
8cgd-assembly1.cif.gz_t clindamycin bound to the 50s subunit 0.9392 1 101
6ddg-assembly1.cif.gz_G structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.9388 2 98
ID Description Score Start End Superfamily
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.947 3 99 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9368 1 99 2.30.30.30
af_Q8I5H8_47_152_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9239 3 98 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9072 1 99 2.30.30.30
af_P54038_1_120_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8987 3 70 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2A2RUX7-F1-model_v4 Large ribosomal subunit protein uL24 0.9675 2 70 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-B9L6M2-F1-model_v4 Large ribosomal subunit protein uL24 0.9589 1 73 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A099TZG7-F1-model_v4 Large ribosomal subunit protein uL24 0.9528 3 70 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G2B7Z4-F1-model_v4 Large ribosomal subunit protein uL24 0.9521 3 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A6DEY5-F1-model_v4 deleted 0.9501 1 73

Feature Viewer

pLDDT pTM Quality
88.99 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map