F405918

General Info

Members Datasets Scaffolds Average Seq Length
321 224 291 159

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100021725|Ga0075428_1000217255
Length 183
Sequence MAGTDPQSVATRAVEPRMHHYEVAVTWTGNLGEGTRTYRSYRRDNEVTAEGPPVIPGSSEPAFRGDPARWNPEQLLVASLSQCHMLWFLHLAVQDGLVVTGYRDEADGHMAEDEDGGGRFTEVTLRPEVVLADDPADRTERIARLHHRAHELCFIANSVNFPVRCEPRDPAQQEQSDQSAPTP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
3 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2643221721 Oerskovia sp. Root918 Isolate Unclassified
6 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
7 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
8 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
9 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
10 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
11 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
12 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
13 2808606394 Promicromonospora sp. C35 Isolate Unclassified
14 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
15 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
16 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
17 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
18 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
19 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
20 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
21 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
22 2904504865 Serratia marcescens 1822 Isolate Unclassified
23 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
24 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
25 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
26 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
27 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
28 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
91 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
92 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
93 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
138 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
141 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
223 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
224 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.41
Metatranscriptomes 1.25
Isolates 9.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 7.48
Rhizosphere 69.78
Stem 0
Stem Tuber 0
Unclassified 19.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2365995 2162886007 Bacteria 2757
2 SwRhRL2b_contig_297057 2162886007 Bacteria 982
3 Ga0055540_1000053 3300003792 Bacteria 142520
4 Ga0065704_10004445 3300005289 Bacteria 3374
5 Ga0065704_10254268 3300005289 Bacteria 981
6 Ga0065712_10067782 3300005290 Bacteria 36753
7 Ga0065715_10166022 3300005293 Bacteria 1586
8 Ga0070658_10345619 3300005327 Bacteria 1273
9 Ga0070683_100064691 3300005329 Bacteria 3405
10 Ga0070683_100068037 3300005329 Bacteria 3318
11 Ga0070683_101208156 3300005329 Bacteria 726
12 Ga0068869_100399454 3300005334 Bacteria 1130
13 Ga0070666_10045428 3300005335 Bacteria 2944
14 Ga0070682_100000406 3300005337 Bacteria 28207
15 Ga0070682_100684953 3300005337 Bacteria 820
16 Ga0068868_100684585 3300005338 Bacteria 916
17 Ga0068868_100733961 3300005338 Bacteria 886
18 Ga0070660_100088070 3300005339 Bacteria 2444
19 Ga0070689_100031034 3300005340 Bacteria 4060
20 Ga0070692_10286967 3300005345 Bacteria 1000
21 Ga0070675_100163281 3300005354 Bacteria 1917
22 Ga0070671_100869181 3300005355 Bacteria 787
23 Ga0070688_100027441 3300005365 Bacteria 3393
24 Ga0070667_100003016 3300005367 Bacteria 14468
25 Ga0070714_100029249 3300005435 Bacteria 4580
26 Ga0070714_100630571 3300005435 Bacteria 1031
27 Ga0070714_101153203 3300005435 Bacteria 756
28 Ga0070713_100251115 3300005436 Bacteria 1613
29 Ga0070713_100333999 3300005436 Bacteria 1403
30 Ga0070700_100403887 3300005441 Bacteria 1028
31 Ga0070663_100057809 3300005455 Bacteria 2784
32 Ga0070663_100677055 3300005455 Bacteria 875
33 Ga0070681_10007383 3300005458 Bacteria 10743
34 Ga0070698_100000874 3300005471 Bacteria 33107
35 Ga0070698_100627138 3300005471 Bacteria 1016
36 Ga0070699_100478014 3300005518 Bacteria 1131
37 Ga0070679_100006465 3300005530 Bacteria 10920
38 Ga0070684_100450428 3300005535 Bacteria 1190
39 Ga0070684_100476755 3300005535 Bacteria 1155
40 Ga0070695_100435897 3300005545 Bacteria 1001
41 Ga0070696_100033838 3300005546 Unclassified 3514
42 Ga0070664_100268700 3300005564 Bacteria 1536
43 Ga0068859_100050279 3300005617 Unclassified 4188
44 Ga0068859_100700606 3300005617 Bacteria 1103
45 Ga0068864_100401238 3300005618 Bacteria 1303
46 Ga0068864_100570082 3300005618 Bacteria 1096
47 Ga0068870_10033934 3300005840 Bacteria 2608
48 Ga0068863_100147694 3300005841 Bacteria 2249
49 Ga0068858_100755914 3300005842 Bacteria 947
50 Ga0081540_1104570 3300005983 Bacteria 1211
51 Ga0075364_10031687 3300006051 Bacteria 3396
52 Ga0075369_10341601 3300006186 Bacteria 702
53 Ga0068871_101342816 3300006358 Bacteria 673
54 Ga0075428_100021725 3300006844 Bacteria 7104
55 Ga0075428_100578578 3300006844 Bacteria 1200
56 Ga0075430_100054892 3300006846 Bacteria 3352
57 Ga0075430_100579892 3300006846 Bacteria 925
58 Ga0075431_100129912 3300006847 Bacteria 2599
59 Ga0075433_10347966 3300006852 Bacteria 1310
60 Ga0075434_100030121 3300006871 Bacteria 5343
61 Ga0075429_100016364 3300006880 Bacteria 6427
62 Ga0075429_100120119 3300006880 Unclassified 2297
63 Ga0075429_100199912 3300006880 Bacteria 1751
64 Ga0075429_100606284 3300006880 Bacteria 959
65 Ga0097620_100050279 3300006931 Unclassified 4188
66 Ga0097620_100700741 3300006931 Bacteria 1103
67 Ga0105250_10000017 3300009092 Bacteria 255998
68 Ga0111539_10010705 3300009094 Bacteria 11546
69 Ga0114129_10000363 3300009147 Bacteria 52419
70 Ga0114129_10009583 3300009147 Bacteria 13815
71 Ga0105243_10089742 3300009148 Bacteria 2528
72 Ga0105243_11867718 3300009148 Bacteria 633
73 Ga0105241_10403231 3300009174 Bacteria 1200
74 Ga0105241_10977415 3300009174 Bacteria 791
75 Ga0105237_10003778 3300009545 Bacteria 17810
76 Ga0105237_11250067 3300009545 Bacteria 749
77 Ga0105238_11097198 3300009551 Bacteria 818
78 Ga0105239_10007883 3300010375 Bacteria 12174
79 Ga0105239_10058134 3300010375 Bacteria 4243
80 Ga0105246_10127518 3300011119 Bacteria 1895
81 Ga0157370_10228184 3300013104 Bacteria 1724
82 Ga0157369_10160016 3300013105 Bacteria 2377
83 Ga0157369_10224409 3300013105 Bacteria 1966
84 Ga0157374_11520643 3300013296 Bacteria 693
85 Ga0157372_10000303 3300013307 Bacteria 54864
86 Ga0157372_10644864 3300013307 Bacteria 1233
87 Ga0157372_11190935 3300013307 Bacteria 880
88 Ga0163163_10461953 3300014325 Bacteria 1330
89 Ga0182008_10064223 3300014497 Bacteria 1807
90 Ga0157377_10009729 3300014745 Bacteria 4730
91 Ga0157377_10530841 3300014745 Bacteria 828
92 Ga0183366_1001 3300015679 Bacteria 2743932
93 Ga0183370_1001 3300015680 Bacteria 2743932
94 Ga0183369_1001 3300015685 Bacteria 2743932
95 Ga0183368_1001 3300015687 Bacteria 2743932
96 Ga0206356_10007965 3300020070 Bacteria 957
97 Ga0206353_10233672 3300020082 Bacteria 2141
98 Ga0213873_10023981 3300021358 Bacteria 1460
99 Ga0213872_10023748 3300021361 Bacteria 2820
100 Ga0213875_10203709 3300021388 Bacteria 931
101 Ga0224712_10161496 3300022467 Bacteria 1000
102 Ga0209437_112496 3300025233 Bacteria 1237
103 Ga0209051_1000021 3300025303 Bacteria 507633
104 Ga0209051_1002347 3300025303 Bacteria 13695
105 Ga0207696_1000015 3300025711 Bacteria 507848
106 Ga0207655_1017241 3300025728 Bacteria 3903
107 Ga0207680_10102385 3300025903 Bacteria 1842
108 Ga0207643_10110579 3300025908 Bacteria 1619
109 Ga0207707_10055008 3300025912 Bacteria 3463
110 Ga0207671_10280847 3300025914 Bacteria 1313
111 Ga0207660_11255178 3300025917 Bacteria 602
112 Ga0207652_10002307 3300025921 Bacteria 16169
113 Ga0207659_10095749 3300025926 Bacteria 2227
114 Ga0207664_10005678 3300025929 Bacteria 8529
115 Ga0207644_10374938 3300025931 Bacteria 1160
116 Ga0207709_10163432 3300025935 Bacteria 1555
117 Ga0207670_10045615 3300025936 Bacteria 2907
118 Ga0207670_10481805 3300025936 Bacteria 1005
119 Ga0207661_10052834 3300025944 Bacteria 3248
120 Ga0207661_10283014 3300025944 Bacteria 1482
121 Ga0207679_10087520 3300025945 Bacteria 2399
122 Ga0207679_10261686 3300025945 Bacteria 1476
123 Ga0207658_10001953 3300025986 Bacteria 15401
124 Ga0207677_10736099 3300026023 Bacteria 878
125 Ga0207678_10174880 3300026067 Bacteria 1833
126 Ga0207678_10481448 3300026067 Bacteria 1081
127 Ga0207641_10063525 3300026088 Bacteria 3154
128 Ga0207648_10667587 3300026089 Unclassified 961
129 Ga0207676_10293164 3300026095 Bacteria 1482
130 Ga0207676_10375691 3300026095 Bacteria 1322
131 Ga0207428_10093627 3300027907 Bacteria 2330
132 Ga0314311_1096892 3300030733 Bacteria 1915
133 Ga0314311_1213235 3300030733 Bacteria 1058
134 Ga0265327_10002365 3300031251 Bacteria 20094
135 Ga0265327_10310213 3300031251 Bacteria 693
136 Ga0307513_10001973 3300031456 Bacteria 29050
137 Ga0307513_10424318 3300031456 Bacteria 1059
138 Ga0307410_10305988 3300031852 Bacteria 1256
139 Ga0307409_100462217 3300031995 Bacteria 1227
140 Ga0307409_101268880 3300031995 Bacteria 761
141 Ga0307416_100241150 3300032002 Bacteria 1752
142 Ga0307416_100675735 3300032002 Bacteria 1120
143 Ga0372808_048671 3300036459 Bacteria 607
144 Ga0395905_0003536 3300037471 Bacteria 16647
145 Ga0436364_0880783 3300037853 Bacteria 1439
146 Ga0436364_0996174 3300037853 Bacteria 2512
147 Ga0436364_1136906 3300037853 Bacteria 931
148 Ga0436365_1589230 3300039437 Bacteria 1108
149 Ga0436360_0226348 3300039438 Unclassified 3732
150 Ga0436361_0200270 3300039447 Bacteria 32952
151 Ga0436361_1149602 3300039447 Unclassified 2862
152 Ga0436362_0577533 3300039453 Unclassified 3968
153 Ga0439461_0001633 3300041410 Bacteria 3481
154 Ga0439466_0016174 3300041411 Bacteria 2700
155 Ga0439431_0001607 3300041997 Bacteria 5012
156 Ga0439432_014512 3300042006 Bacteria 2665
157 Ga0450907_071428 3300042146 Bacteria 601
158 Ga0439434_0001186 3300042435 Bacteria 7506
159 Ga0466972_0027078 3300044658 Bacteria 2838
160 Ga0466972_0067352 3300044658 Bacteria 1711
161 Ga0466972_0463503 3300044658 Bacteria 595
162 Ga0466965_0001648 3300044683 Bacteria 9145
163 Ga0466965_0004165 3300044683 Bacteria 6427
164 Ga0466965_0344845 3300044683 Bacteria 815
165 Ga0466966_0030851 3300044684 Bacteria 3477
166 Ga0466966_0305262 3300044684 Bacteria 956
167 Ga0466961_0052827 3300044693 Bacteria 2594
168 Ga0466961_0630768 3300044693 Unclassified 644
169 Ga0466963_0010496 3300044694 Bacteria 5608
170 Ga0453684_0107627 3300044712 Unclassified 3394
171 Ga0466971_0107150 3300044719 Bacteria 1288
172 Ga0466971_0238681 3300044719 Bacteria 864
173 Ga0466968_0078812 3300044735 Bacteria 1444
174 Ga0466970_0258524 3300044765 Bacteria 977
175 Ga0466957_0002459 3300044842 Bacteria 9948
176 Ga0466960_0000219 3300044901 Bacteria 19833
177 Ga0466959_0012778 3300045049 Bacteria 6076
178 Ga0466959_0472246 3300045049 Bacteria 849
179 Ga0466958_0004692 3300045836 Bacteria 7254
180 Ga0466958_0811432 3300045836 Unclassified 610
181 Ga0466967_0019525 3300045976 Bacteria 5452
182 Ga0466967_0041373 3300045976 Bacteria 3973
183 Ga0495627_053359 3300046453 Bacteria 1210
184 Ga0495592_0007946 3300046454 Bacteria 7957
185 Ga0495629_0215613 3300046459 Bacteria 1325
186 Ga0495651_0006431 3300046462 Bacteria 8987
187 Ga0495653_0034029 3300046463 Bacteria 4033
188 Ga0495628_0002367 3300046516 Bacteria 17016
189 Ga0495652_0032660 3300046529 Bacteria 4550
190 Ga0495654_0001021 3300046530 Bacteria 20493
191 Ga0495665_0003574 3300046531 Bacteria 8439
192 Ga0495640_0097943 3300046533 Bacteria 1928
193 Ga0495587_0001445 3300046536 Bacteria 15834
194 Ga0495635_0101177 3300046663 Bacteria 1969
195 Ga0495646_0022724 3300046680 Bacteria 3952
196 Ga0495613_0003206 3300046689 Bacteria 12243
197 Ga0495600_0024294 3300046809 Bacteria 3900
198 Ga0495581_0033515 3300047315 Bacteria 2972
199 Ga0495604_0000225 3300047317 Bacteria 51285
200 Ga0495675_0011554 3300047444 Bacteria 5543
201 Ga0495679_007128 3300047446 Bacteria 4705
202 Ga0495684_0025406 3300047471 Bacteria 4552
203 Ga0495602_0046993 3300048088 Bacteria 3893
204 Ga0496100_0000074 3300048903 Bacteria 55196
205 Ga0496100_1126941 3300048903 Bacteria 618
206 Ga0496101_0000017 3300048904 Bacteria 239153
207 Ga0496101_0106527 3300048904 Bacteria 2105
208 Ga0496102_0221298 3300048905 Bacteria 1784
209 Ga0496102_0605612 3300048905 Bacteria 1018
210 Ga0496102_0904950 3300048905 Bacteria 804
211 Ga0496103_0002372 3300048906 Bacteria 11879
212 Ga0496106_0003417 3300048909 Bacteria 11828
213 Ga0496107_0000570 3300048910 Bacteria 20542
214 Ga0496109_0002454 3300048912 Bacteria 15541
215 Ga0496109_0011341 3300048912 Bacteria 7657
216 Ga0496109_0761417 3300048912 Bacteria 906
217 Ga0496110_0004528 3300048913 Bacteria 10785
218 Ga0496110_0201881 3300048913 Bacteria 1807
219 Ga0496110_0327563 3300048913 Bacteria 1395
220 Ga0496111_0002248 3300048914 Bacteria 11602
221 Ga0496111_0574595 3300048914 Bacteria 826
222 Ga0496113_0001800 3300048916 Bacteria 12155
223 Ga0496113_0375559 3300048916 Bacteria 1141
224 Ga0496114_0003459 3300048917 Bacteria 12112
225 Ga0496114_0503796 3300048917 Bacteria 1071
226 Ga0496115_0185248 3300048918 Bacteria 1720
227 Ga0496116_0020066 3300048919 Bacteria 5089
228 Ga0496116_0179921 3300048919 Bacteria 1133
229 Ga0496116_0221956 3300048919 Bacteria 967
230 Ga0496117_0137620 3300048920 Bacteria 1468
231 Ga0496117_0183766 3300048920 Bacteria 1198
232 Ga0496117_0316493 3300048920 Bacteria 819
233 Ga0496118_0051116 3300048921 Bacteria 3164
234 Ga0496118_0051570 3300048921 Bacteria 3146
235 Ga0496118_0074915 3300048921 Bacteria 2416
236 Ga0496119_0001654 3300048922 Bacteria 26212
237 Ga0496119_0538440 3300048922 Bacteria 538
238 Ga0496120_0060205 3300048923 Bacteria 2125
239 Ga0496120_0114221 3300048923 Bacteria 1406
240 Ga0496120_0190831 3300048923 Bacteria 999
241 Ga0496121_0000014 3300048924 Bacteria 609379
242 Ga0496121_0000816 3300048924 Bacteria 56863
243 Ga0496122_0000097 3300048925 Bacteria 199223
244 Ga0496122_0003253 3300048925 Bacteria 21559
245 Ga0496122_0062137 3300048925 Bacteria 2736
246 Ga0496122_0313390 3300048925 Bacteria 838
247 Ga0496123_0003143 3300048926 Bacteria 18934
248 Ga0496123_0032551 3300048926 Bacteria 3772
249 Ga0496123_0033490 3300048926 Bacteria 3696
250 Ga0496123_0087897 3300048926 Bacteria 1857
251 Ga0496123_0099136 3300048926 Bacteria 1701
252 Ga0496124_0000019 3300048927 Bacteria 436995
253 Ga0496124_0148029 3300048927 Bacteria 1845
254 Ga0496125_0000014 3300048928 Bacteria 610124
255 Ga0496125_0000610 3300048928 Bacteria 60637
256 Ga0496125_0002824 3300048928 Bacteria 21899
257 Ga0496125_0185903 3300048928 Bacteria 1378
258 Ga0496126_0000017 3300048929 Bacteria 610676
259 Ga0496126_0000063 3300048929 Bacteria 256841
260 Ga0496126_0035524 3300048929 Bacteria 4671
261 Ga0496126_0145092 3300048929 Bacteria 2039
262 Ga0496126_0155898 3300048929 Bacteria 1954
263 Ga0501031_0425774 3300049568 Bacteria 858
264 Ga0501032_0029509 3300049569 Bacteria 3763
265 Ga0501036_0739543 3300049572 Bacteria 812
266 Ga0501036_1612662 3300049572 Bacteria 524
267 Ga0501038_0356147 3300049574 Bacteria 1139
268 Ga0501039_1259396 3300049575 Bacteria 571
269 Ga0501040_0241016 3300049576 Bacteria 1289
270 Ga0501040_0878579 3300049576 Bacteria 649
271 Ga0501041_0349141 3300049577 Bacteria 935
272 Ga0501069_0382186 3300049585 Bacteria 832
273 Ga0501071_0711529 3300049587 Bacteria 773
274 Ga0501071_1071788 3300049587 Bacteria 623
275 Ga0501072_0001679 3300049588 Bacteria 16481
276 Ga0501075_0634249 3300049591 Bacteria 815
277 nmdc:mga00v17_161417_c1 3300050491 Bacteria 1443
278 nmdc:mga00v17_35381_c1 3300050491 Bacteria 2971
279 nmdc:mga05p37_33202_c1 3300050507 Bacteria 6320
280 nmdc:mga05p37_68707_c1 3300050507 Bacteria 4357
281 nmdc:mga05p37_85691_c1 3300050507 Bacteria 3882
282 nmdc:mga09592_195283_c1 3300050508 Bacteria 1752
283 nmdc:mga09592_35637_c1 3300050508 Bacteria 4166
284 nmdc:mga09592_544498_c1 3300050508 Bacteria 997
285 nmdc:mga06r32_209599_c1 3300050510 Bacteria 1937
286 nmdc:mga08y16_103779_c1 3300050511 Bacteria 2960
287 nmdc:mga0a205_333273_c1 3300050515 Bacteria 1387
288 Ga0495601_0007575 3300053077 Bacteria 6374
289 Ga0495612_0165862 3300053078 Bacteria 966
290 Ga0500641_0141540 3300053096 Bacteria 1039
291 Ga0466962_0007610 3300061719 Bacteria 5195

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044683 Ga0466965_0344845 Ga0466965_0344845_21_449 139
2 3300013104 Ga0157370_10228184 Ga0157370_102281841 140
3 3300021361 Ga0213872_10023748 Ga0213872_100237482 140
4 3300039447 Ga0436361_0200270 Ga0436361_0200270_14886_15359 140
5 3300005327 Ga0070658_10345619 Ga0070658_103456192 142
6 3300005435 Ga0070714_101153203 Ga0070714_1011532031 145
7 3300005337 Ga0070682_100000406 Ga0070682_10000040626 146
8 3300005339 Ga0070660_100088070 Ga0070660_1000880704 146
9 3300005455 Ga0070663_100677055 Ga0070663_1006770551 146
10 3300026067 Ga0207678_10481448 Ga0207678_104814482 146
11 3300044693 Ga0466961_0052827 Ga0466961_0052827_92_541 146
12 3300044719 Ga0466971_0238681 Ga0466971_0238681_231_680 146
13 3300044765 Ga0466970_0258524 Ga0466970_0258524_132_581 146
14 3300037853 Ga0436364_0880783 Ga0436364_0880783_197_646 147
15 iso_pu_bacteria 2837268691 2837270313 149
16 iso_pu_bacteria 2887443736 2887444185 149
17 3300005329 Ga0070683_100064691 Ga0070683_1000646914 150
18 3300005345 Ga0070692_10286967 Ga0070692_102869671 150
19 3300005435 Ga0070714_100029249 Ga0070714_1000292496 150
20 3300005436 Ga0070713_100333999 Ga0070713_1003339992 150
21 3300005455 Ga0070663_100057809 Ga0070663_1000578091 150
22 3300005458 Ga0070681_10007383 Ga0070681_100073833 150
23 3300005530 Ga0070679_100006465 Ga0070679_1000064652 150
24 3300005617 Ga0068859_100700606 Ga0068859_1007006061 150
25 3300005618 Ga0068864_100570082 Ga0068864_1005700823 150
26 3300006931 Ga0097620_100700741 Ga0097620_1007007412 150
27 3300009551 Ga0105238_11097198 Ga0105238_110971982 150
28 3300013105 Ga0157369_10224409 Ga0157369_102244092 150
29 3300013307 Ga0157372_10644864 Ga0157372_106448642 150
30 3300014745 Ga0157377_10530841 Ga0157377_105308412 150
31 3300020070 Ga0206356_10007965 Ga0206356_100079652 150
32 3300020082 Ga0206353_10233672 Ga0206353_102336721 150
33 3300022467 Ga0224712_10161496 Ga0224712_101614962 150
34 3300025912 Ga0207707_10055008 Ga0207707_100550081 150
35 3300025921 Ga0207652_10002307 Ga0207652_1000230715 150
36 3300025929 Ga0207664_10005678 Ga0207664_100056786 150
37 3300025945 Ga0207679_10261686 Ga0207679_102616862 150
38 3300026067 Ga0207678_10174880 Ga0207678_101748802 150
39 3300026095 Ga0207676_10375691 Ga0207676_103756912 150
40 3300048929 Ga0496126_0155898 Ga0496126_0155898_473_931 150
41 3300050507 nmdc:mga05p37_68707_c1 nmdc:mga05p37_68707_c1_1140_1694 150
42 3300050510 nmdc:mga06r32_209599_c1 nmdc:mga06r32_209599_c1_483_1037 150
43 iso_pu_bacteria 2558860112 2558908103 150
44 3300021358 Ga0213873_10023981 Ga0213873_100239812 151
45 3300037853 Ga0436364_0996174 Ga0436364_0996174_635_1096 151
46 3300039438 Ga0436360_0226348 Ga0436360_0226348_2402_2863 151
47 3300039447 Ga0436361_1149602 Ga0436361_1149602_477_938 151
48 3300039453 Ga0436362_0577533 Ga0436362_0577533_628_1089 151
49 iso_pu_bacteria 2816332139 2816505776 151
50 iso_pu_bacteria 2870782633 2870789406 151
51 3300005471 Ga0070698_100627138 Ga0070698_1006271382 152
52 3300009148 Ga0105243_10089742 Ga0105243_100897422 152
53 3300025935 Ga0207709_10163432 Ga0207709_101634322 152
54 3300031995 Ga0307409_100462217 Ga0307409_1004622172 152
55 3300032002 Ga0307416_100675735 Ga0307416_1006757352 152
56 3300036459 Ga0372808_048671 Ga0372808_048671_80_544 152
57 3300044658 Ga0466972_0463503 Ga0466972_0463503_109_573 152
58 iso_pu_bacteria 2643221721 2644666202 152
59 iso_pu_bacteria 2738541272 2738695975 152
60 iso_pu_bacteria 2738543027 2739324798 152
61 iso_pu_bacteria 2758568621 2760623911 152
62 iso_pu_bacteria 2902810491 2902811289 152
63 iso_pu_bacteria 2904776348 2904777327 152
64 iso_pu_bacteria 2928142448 2928144502 152
65 iso_pu_bacteria 2932431166 2932431774 152
66 iso_pu_bacteria 2935890801 2935891176 152
67 iso_pu_bacteria 8056579771 8056585134 152
68 iso_pu_bacteria 8057160832 8057161081 152
69 3300013307 Ga0157372_11190935 Ga0157372_111909352 153
70 3300014497 Ga0182008_10064223 Ga0182008_100642232 153
71 3300021388 Ga0213875_10203709 Ga0213875_102037092 153
72 3300037853 Ga0436364_1136906 Ga0436364_1136906_115_627 153
73 3300046530 Ga0495654_0001021 Ga0495654_0001021_11677_12144 153
74 3300049568 Ga0501031_0425774 Ga0501031_0425774_11_478 153
75 3300049572 Ga0501036_0739543 Ga0501036_0739543_205_672 153
76 3300049572 Ga0501036_1612662 Ga0501036_1612662_39_506 153
77 3300049576 Ga0501040_0878579 Ga0501040_0878579_35_502 153
78 3300049585 Ga0501069_0382186 Ga0501069_0382186_17_484 153
79 3300049587 Ga0501071_1071788 Ga0501071_1071788_143_610 153
80 3300049591 Ga0501075_0634249 Ga0501075_0634249_246_713 153
81 iso_pu_bacteria 2738541264 2738665450 153
82 iso_pu_bacteria 2738541356 2739144584 153
83 iso_pu_bacteria 2739367654 2739605597 153
84 iso_pu_bacteria 2808606394 2809028826 153
85 iso_pu_bacteria 2904504865 2904508399 153
86 iso_pu_bacteria 2946003308 2946004916 153
87 3300005471 Ga0070698_100000874 Ga0070698_10000087418 154
88 3300005518 Ga0070699_100478014 Ga0070699_1004780141 154
89 3300006844 Ga0075428_100578578 Ga0075428_1005785782 154
90 3300006880 Ga0075429_100606284 Ga0075429_1006062841 154
91 3300009147 Ga0114129_10000363 Ga0114129_1000036323 154
92 3300013307 Ga0157372_10000303 Ga0157372_1000030333 154
93 3300044712 Ga0453684_0107627 Ga0453684_0107627_1781_2254 154
94 3300044719 Ga0466971_0107150 Ga0466971_0107150_638_1111 154
95 3300050507 nmdc:mga05p37_33202_c1 nmdc:mga05p37_33202_c1_4183_4653 154
96 3300050508 nmdc:mga09592_544498_c1 nmdc:mga09592_544498_c1_492_962 154
97 3300053096 Ga0500641_0141540 Ga0500641_0141540_54_533 154
98 iso_pu_bacteria 2602042047 2603642438 154
99 iso_pu_bacteria 2939582691 2939584257 154
100 3300005329 Ga0070683_100068037 Ga0070683_1000680372 155
101 3300005329 Ga0070683_101208156 Ga0070683_1012081561 155
102 3300005337 Ga0070682_100684953 Ga0070682_1006849532 155
103 3300005338 Ga0068868_100733961 Ga0068868_1007339612 155
104 3300005355 Ga0070671_100869181 Ga0070671_1008691811 155
105 3300005535 Ga0070684_100450428 Ga0070684_1004504282 155
106 3300005535 Ga0070684_100476755 Ga0070684_1004767552 155
107 3300005564 Ga0070664_100268700 Ga0070664_1002687002 155
108 3300005983 Ga0081540_1104570 Ga0081540_11045702 155
109 3300006358 Ga0068871_101342816 Ga0068871_1013428161 155
110 3300009174 Ga0105241_10403231 Ga0105241_104032312 155
111 3300009174 Ga0105241_10977415 Ga0105241_109774151 155
112 3300013105 Ga0157369_10160016 Ga0157369_101600162 155
113 3300013296 Ga0157374_11520643 Ga0157374_115206432 155
114 3300014325 Ga0163163_10461953 Ga0163163_104619531 155
115 3300025931 Ga0207644_10374938 Ga0207644_103749381 155
116 3300025944 Ga0207661_10052834 Ga0207661_100528343 155
117 3300025944 Ga0207661_10283014 Ga0207661_102830141 155
118 3300025945 Ga0207679_10087520 Ga0207679_100875203 155
119 3300037471 Ga0395905_0003536 Ga0395905_0003536_3047_3538 155
120 3300039437 Ga0436365_1589230 Ga0436365_1589230_174_647 155
121 3300044683 Ga0466965_0004165 Ga0466965_0004165_5434_5907 155
122 3300044684 Ga0466966_0030851 Ga0466966_0030851_1953_2426 155
123 3300044694 Ga0466963_0010496 Ga0466963_0010496_651_1124 155
124 3300044735 Ga0466968_0078812 Ga0466968_0078812_657_1130 155
125 3300044842 Ga0466957_0002459 Ga0466957_0002459_9306_9779 155
126 3300045049 Ga0466959_0012778 Ga0466959_0012778_2198_2671 155
127 3300045836 Ga0466958_0004692 Ga0466958_0004692_3163_3636 155
128 3300045976 Ga0466967_0019525 Ga0466967_0019525_2342_2815 155
129 3300046533 Ga0495640_0097943 Ga0495640_0097943_669_1151 155
130 3300048905 Ga0496102_0904950 Ga0496102_0904950_213_686 155
131 3300048913 Ga0496110_0201881 Ga0496110_0201881_914_1387 155
132 3300048914 Ga0496111_0574595 Ga0496111_0574595_201_674 155
133 3300048917 Ga0496114_0503796 Ga0496114_0503796_160_633 155
134 3300049569 Ga0501032_0029509 Ga0501032_0029509_3114_3635 155
135 3300049588 Ga0501072_0001679 Ga0501072_0001679_1669_2142 155
136 3300053077 Ga0495601_0007575 Ga0495601_0007575_174_647 155
137 3300053078 Ga0495612_0165862 Ga0495612_0165862_37_510 155
138 3300061719 Ga0466962_0007610 Ga0466962_0007610_3857_4330 155
139 iso_pu_bacteria 2758568522 2760307569 155
140 iso_pu_bacteria 2831935698 2831936944 155
141 3300006051 Ga0075364_10031687 Ga0075364_100316872 156
142 3300006186 Ga0075369_10341601 Ga0075369_103416012 156
143 3300006846 Ga0075430_100579892 Ga0075430_1005798921 156
144 3300006847 Ga0075431_100129912 Ga0075431_1001299123 156
145 3300006880 Ga0075429_100199912 Ga0075429_1001999122 156
146 3300009094 Ga0111539_10010705 Ga0111539_1001070510 156
147 3300009147 Ga0114129_10009583 Ga0114129_100095839 156
148 3300011119 Ga0105246_10127518 Ga0105246_101275182 156
149 3300025303 Ga0209051_1002347 Ga0209051_10023475 156
150 3300025728 Ga0207655_1017241 Ga0207655_10172412 156
151 3300030733 Ga0314311_1096892 Ga0314311_10968921 156
152 3300030733 Ga0314311_1213235 Ga0314311_12132352 156
153 3300031852 Ga0307410_10305988 Ga0307410_103059882 156
154 3300031995 Ga0307409_101268880 Ga0307409_1012688801 156
155 3300032002 Ga0307416_100241150 Ga0307416_1002411502 156
156 3300041410 Ga0439461_0001633 Ga0439461_0001633_1608_2090 156
157 3300041411 Ga0439466_0016174 Ga0439466_0016174_920_1402 156
158 3300041997 Ga0439431_0001607 Ga0439431_0001607_1758_2240 156
159 3300042146 Ga0450907_071428 Ga0450907_071428_63_548 156
160 3300042435 Ga0439434_0001186 Ga0439434_0001186_5234_5710 156
161 3300046453 Ga0495627_053359 Ga0495627_053359_351_836 156
162 3300048903 Ga0496100_1126941 Ga0496100_1126941_97_573 156
163 3300048904 Ga0496101_0106527 Ga0496101_0106527_1357_1833 156
164 3300048916 Ga0496113_0001800 Ga0496113_0001800_1250_1726 156
165 3300048923 Ga0496120_0114221 Ga0496120_0114221_275_751 156
166 3300048926 Ga0496123_0033490 Ga0496123_0033490_431_907 156
167 3300048928 Ga0496125_0185903 Ga0496125_0185903_138_614 156
168 3300048929 Ga0496126_0035524 Ga0496126_0035524_2199_2675 156
169 3300049574 Ga0501038_0356147 Ga0501038_0356147_251_730 156
170 3300049575 Ga0501039_1259396 Ga0501039_1259396_56_532 156
171 3300049587 Ga0501071_0711529 Ga0501071_0711529_266_745 156
172 3300050491 nmdc:mga00v17_161417_c1 nmdc:mga00v17_161417_c1_565_1041 156
173 3300050491 nmdc:mga00v17_35381_c1 nmdc:mga00v17_35381_c1_1829_2305 156
174 3300050507 nmdc:mga05p37_85691_c1 nmdc:mga05p37_85691_c1_883_1359 156
175 3300050508 nmdc:mga09592_195283_c1 nmdc:mga09592_195283_c1_151_627 156
176 3300050511 nmdc:mga08y16_103779_c1 nmdc:mga08y16_103779_c1_267_743 156
177 iso_pu_bacteria 2643221715 2644634623 156
178 iso_pu_bacteria 2863067949 2863071757 156
179 iso_pu_bacteria 2866552031 2866553756 156
180 iso_pu_bacteria 8056207758 8056211121 156
181 3300003792 Ga0055540_1000053 Ga0055540_10000539 157
182 3300005335 Ga0070666_10045428 Ga0070666_100454282 157
183 3300005367 Ga0070667_100003016 Ga0070667_10000301612 157
184 3300005435 Ga0070714_100630571 Ga0070714_1006305712 157
185 3300005436 Ga0070713_100251115 Ga0070713_1002511152 157
186 3300005842 Ga0068858_100755914 Ga0068858_1007559141 157
187 3300009092 Ga0105250_10000017 Ga0105250_1000001743 157
188 3300009545 Ga0105237_10003778 Ga0105237_1000377812 157
189 3300009545 Ga0105237_11250067 Ga0105237_112500671 157
190 3300010375 Ga0105239_10007883 Ga0105239_100078839 157
191 3300010375 Ga0105239_10058134 Ga0105239_100581344 157
192 3300025233 Ga0209437_112496 Ga0209437_1124963 157
193 3300025303 Ga0209051_1000021 Ga0209051_1000021216 157
194 3300025711 Ga0207696_1000015 Ga0207696_1000015135 157
195 3300025903 Ga0207680_10102385 Ga0207680_101023853 157
196 3300025914 Ga0207671_10280847 Ga0207671_102808472 157
197 3300025986 Ga0207658_10001953 Ga0207658_1000195314 157
198 3300031251 Ga0265327_10002365 Ga0265327_100023653 157
199 3300031251 Ga0265327_10310213 Ga0265327_103102131 157
200 3300031456 Ga0307513_10424318 Ga0307513_104243181 157
201 3300044658 Ga0466972_0067352 Ga0466972_0067352_1038_1517 157
202 3300044684 Ga0466966_0305262 Ga0466966_0305262_224_742 157
203 3300044693 Ga0466961_0630768 Ga0466961_0630768_17_499 157
204 3300045049 Ga0466959_0472246 Ga0466959_0472246_334_816 157
205 3300045836 Ga0466958_0811432 Ga0466958_0811432_94_576 157
206 3300045976 Ga0466967_0041373 Ga0466967_0041373_2443_2922 157
207 3300046454 Ga0495592_0007946 Ga0495592_0007946_3364_3843 157
208 3300046459 Ga0495629_0215613 Ga0495629_0215613_636_1115 157
209 3300046462 Ga0495651_0006431 Ga0495651_0006431_559_1038 157
210 3300046463 Ga0495653_0034029 Ga0495653_0034029_2694_3173 157
211 3300046516 Ga0495628_0002367 Ga0495628_0002367_3386_3865 157
212 3300046529 Ga0495652_0032660 Ga0495652_0032660_3386_3865 157
213 3300046531 Ga0495665_0003574 Ga0495665_0003574_4207_4686 157
214 3300046536 Ga0495587_0001445 Ga0495587_0001445_14792_15271 157
215 3300046663 Ga0495635_0101177 Ga0495635_0101177_564_1043 157
216 3300046680 Ga0495646_0022724 Ga0495646_0022724_2532_3011 157
217 3300046689 Ga0495613_0003206 Ga0495613_0003206_6774_7253 157
218 3300046809 Ga0495600_0024294 Ga0495600_0024294_2734_3213 157
219 3300047315 Ga0495581_0033515 Ga0495581_0033515_2283_2762 157
220 3300047317 Ga0495604_0000225 Ga0495604_0000225_17524_18003 157
221 3300047444 Ga0495675_0011554 Ga0495675_0011554_2406_2885 157
222 3300047471 Ga0495684_0025406 Ga0495684_0025406_688_1167 157
223 3300048088 Ga0495602_0046993 Ga0495602_0046993_687_1166 157
224 3300048903 Ga0496100_0000074 Ga0496100_0000074_10378_10857 157
225 3300048904 Ga0496101_0000017 Ga0496101_0000017_6918_7397 157
226 3300048905 Ga0496102_0221298 Ga0496102_0221298_1117_1596 157
227 3300048905 Ga0496102_0605612 Ga0496102_0605612_262_741 157
228 3300048906 Ga0496103_0002372 Ga0496103_0002372_1038_1517 157
229 3300048909 Ga0496106_0003417 Ga0496106_0003417_8300_8779 157
230 3300048910 Ga0496107_0000570 Ga0496107_0000570_9695_10174 157
231 3300048912 Ga0496109_0002454 Ga0496109_0002454_4710_5189 157
232 3300048913 Ga0496110_0004528 Ga0496110_0004528_10189_10668 157
233 3300048914 Ga0496111_0002248 Ga0496111_0002248_10559_11038 157
234 3300048916 Ga0496113_0375559 Ga0496113_0375559_235_714 157
235 3300048917 Ga0496114_0003459 Ga0496114_0003459_1092_1571 157
236 3300048918 Ga0496115_0185248 Ga0496115_0185248_697_1176 157
237 3300048919 Ga0496116_0020066 Ga0496116_0020066_4516_4995 157
238 3300048919 Ga0496116_0221956 Ga0496116_0221956_394_873 157
239 3300048920 Ga0496117_0183766 Ga0496117_0183766_625_1104 157
240 3300048920 Ga0496117_0316493 Ga0496117_0316493_246_725 157
241 3300048921 Ga0496118_0051116 Ga0496118_0051116_2591_3070 157
242 3300048921 Ga0496118_0051570 Ga0496118_0051570_2573_3052 157
243 3300048922 Ga0496119_0538440 Ga0496119_0538440_19_498 157
244 3300048923 Ga0496120_0060205 Ga0496120_0060205_1227_1706 157
245 3300048923 Ga0496120_0190831 Ga0496120_0190831_137_634 157
246 3300048924 Ga0496121_0000014 Ga0496121_0000014_159399_159878 157
247 3300048925 Ga0496122_0000097 Ga0496122_0000097_159392_159871 157
248 3300048926 Ga0496123_0003143 Ga0496123_0003143_8111_8590 157
249 3300048927 Ga0496124_0000019 Ga0496124_0000019_159399_159878 157
250 3300048928 Ga0496125_0000014 Ga0496125_0000014_159399_159878 157
251 3300048929 Ga0496126_0000017 Ga0496126_0000017_450799_451278 157
252 3300048929 Ga0496126_0000063 Ga0496126_0000063_33600_34079 157
253 2162886007 SwRhRL2b_contig_2365995 SwRhRL2b_0786.00003340 158
254 2162886007 SwRhRL2b_contig_297057 SwRhRL2b_0803.00005040 158
255 3300005289 Ga0065704_10004445 Ga0065704_100044453 158
256 3300005289 Ga0065704_10254268 Ga0065704_102542681 158
257 3300005290 Ga0065712_10067782 Ga0065712_100677825 158
258 3300005293 Ga0065715_10166022 Ga0065715_101660221 158
259 3300005334 Ga0068869_100399454 Ga0068869_1003994542 158
260 3300005338 Ga0068868_100684585 Ga0068868_1006845852 158
261 3300005340 Ga0070689_100031034 Ga0070689_1000310345 158
262 3300005354 Ga0070675_100163281 Ga0070675_1001632812 158
263 3300005365 Ga0070688_100027441 Ga0070688_1000274413 158
264 3300005441 Ga0070700_100403887 Ga0070700_1004038872 158
265 3300005545 Ga0070695_100435897 Ga0070695_1004358972 158
266 3300005546 Ga0070696_100033838 Ga0070696_1000338383 158
267 3300005617 Ga0068859_100050279 Ga0068859_1000502793 158
268 3300005618 Ga0068864_100401238 Ga0068864_1004012382 158
269 3300005840 Ga0068870_10033934 Ga0068870_100339343 158
270 3300005841 Ga0068863_100147694 Ga0068863_1001476943 158
271 3300006844 Ga0075428_100021725 Ga0075428_1000217255 158
272 3300006846 Ga0075430_100054892 Ga0075430_1000548922 158
273 3300006852 Ga0075433_10347966 Ga0075433_103479663 158
274 3300006871 Ga0075434_100030121 Ga0075434_1000301217 158
275 3300006880 Ga0075429_100016364 Ga0075429_1000163644 158
276 3300006880 Ga0075429_100120119 Ga0075429_1001201192 158
277 3300006931 Ga0097620_100050279 Ga0097620_1000502795 158
278 3300009148 Ga0105243_11867718 Ga0105243_118677181 158
279 3300014745 Ga0157377_10009729 Ga0157377_100097294 158
280 3300015679 Ga0183366_1001 Ga0183366_10011341 158
281 3300015680 Ga0183370_1001 Ga0183370_10011341 158
282 3300015685 Ga0183369_1001 Ga0183369_10011341 158
283 3300015687 Ga0183368_1001 Ga0183368_10011341 158
284 3300025908 Ga0207643_10110579 Ga0207643_101105792 158
285 3300025917 Ga0207660_11255178 Ga0207660_112551781 158
286 3300025926 Ga0207659_10095749 Ga0207659_100957492 158
287 3300025936 Ga0207670_10045615 Ga0207670_100456153 158
288 3300025936 Ga0207670_10481805 Ga0207670_104818051 158
289 3300026023 Ga0207677_10736099 Ga0207677_107360992 158
290 3300026088 Ga0207641_10063525 Ga0207641_100635254 158
291 3300026089 Ga0207648_10667587 Ga0207648_106675872 158
292 3300026095 Ga0207676_10293164 Ga0207676_102931642 158
293 3300027907 Ga0207428_10093627 Ga0207428_100936273 158
294 3300031456 Ga0307513_10001973 Ga0307513_1000197317 158
295 3300042006 Ga0439432_014512 Ga0439432_014512_1289_1780 158
296 3300044658 Ga0466972_0027078 Ga0466972_0027078_205_720 158
297 3300044683 Ga0466965_0001648 Ga0466965_0001648_1831_2346 158
298 3300044901 Ga0466960_0000219 Ga0466960_0000219_13785_14300 158
299 3300047446 Ga0495679_007128 Ga0495679_007128_3232_3708 158
300 3300048912 Ga0496109_0011341 Ga0496109_0011341_2881_3390 158
301 3300048912 Ga0496109_0761417 Ga0496109_0761417_13_522 158
302 3300048913 Ga0496110_0327563 Ga0496110_0327563_289_798 158
303 3300048919 Ga0496116_0179921 Ga0496116_0179921_513_1004 158
304 3300048920 Ga0496117_0137620 Ga0496117_0137620_848_1339 158
305 3300048921 Ga0496118_0074915 Ga0496118_0074915_152_643 158
306 3300048922 Ga0496119_0001654 Ga0496119_0001654_15582_16133 158
307 3300048924 Ga0496121_0000816 Ga0496121_0000816_28873_29424 158
308 3300048925 Ga0496122_0003253 Ga0496122_0003253_7693_8244 158
309 3300048925 Ga0496122_0062137 Ga0496122_0062137_1211_1702 158
310 3300048925 Ga0496122_0313390 Ga0496122_0313390_119_610 158
311 3300048926 Ga0496123_0032551 Ga0496123_0032551_2924_3475 158
312 3300048926 Ga0496123_0087897 Ga0496123_0087897_1035_1526 158
313 3300048926 Ga0496123_0099136 Ga0496123_0099136_244_735 158
314 3300048927 Ga0496124_0148029 Ga0496124_0148029_20_511 158
315 3300048928 Ga0496125_0000610 Ga0496125_0000610_49758_50309 158
316 3300048928 Ga0496125_0002824 Ga0496125_0002824_133_624 158
317 3300048929 Ga0496126_0145092 Ga0496126_0145092_1420_1911 158
318 3300049576 Ga0501040_0241016 Ga0501040_0241016_487_1008 158
319 3300049577 Ga0501041_0349141 Ga0501041_0349141_286_807 158
320 3300050508 nmdc:mga09592_35637_c1 nmdc:mga09592_35637_c1_1648_2199 158
321 3300050515 nmdc:mga0a205_333273_c1 nmdc:mga0a205_333273_c1_47_556 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

65

168

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.897 5 151
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8745 5 156
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8692 4 155
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8685 5 156
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8635 4 155
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.887 6 151 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.882 58 156 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8761 5 156 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8744 58 154 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.87 5 156 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A2S9IF92-F1-model_v4 Peroxiredoxin 0.9972 1 158
AF-G1XXW0-F1-model_v4 deleted 0.9949 1 155
AF-A0A7W4J7M2-F1-model_v4 OsmC family peroxiredoxin 0.9945 4 157
AF-A0A4Q7KTA1-F1-model_v4 Organic hydroperoxide reductase OsmC/OhrA 0.9943 4 157
AF-A0A6B1HMZ6-F1-model_v4 deleted 0.9939 4 155

Feature Viewer

pLDDT pTM Quality
95.83 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map