F405918
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 321 | 224 | 291 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100021725|Ga0075428_1000217255 |
| Length | 183 |
| Sequence | MAGTDPQSVATRAVEPRMHHYEVAVTWTGNLGEGTRTYRSYRRDNEVTAEGPPVIPGSSEPAFRGDPARWNPEQLLVASLSQCHMLWFLHLAVQDGLVVTGYRDEADGHMAEDEDGGGRFTEVTLRPEVVLADDPADRTERIARLHHRAHELCFIANSVNFPVRCEPRDPAQQEQSDQSAPTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 3 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 4 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 5 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 6 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 7 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 8 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 9 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 10 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 11 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 12 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 13 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 14 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 15 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 16 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 17 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 18 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 19 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 20 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 21 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 22 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 23 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 24 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 25 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 26 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 27 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 28 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 91 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 92 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 93 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 99 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 125 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 126 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 134 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 135 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 136 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 137 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 138 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 139 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 140 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 141 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 142 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 143 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 144 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 145 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 146 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 147 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 148 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 149 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 150 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 151 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 191 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 192 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 193 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 194 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 198 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 199 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 200 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 201 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 208 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 221 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 222 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 223 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 224 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.41 |
| Metatranscriptomes | 1.25 |
| Isolates | 9.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.8 |
| Nodule | 0 |
| Rhizoplane | 7.48 |
| Rhizosphere | 69.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2365995 | 2162886007 | Bacteria | 2757 |
| 2 | SwRhRL2b_contig_297057 | 2162886007 | Bacteria | 982 |
| 3 | Ga0055540_1000053 | 3300003792 | Bacteria | 142520 |
| 4 | Ga0065704_10004445 | 3300005289 | Bacteria | 3374 |
| 5 | Ga0065704_10254268 | 3300005289 | Bacteria | 981 |
| 6 | Ga0065712_10067782 | 3300005290 | Bacteria | 36753 |
| 7 | Ga0065715_10166022 | 3300005293 | Bacteria | 1586 |
| 8 | Ga0070658_10345619 | 3300005327 | Bacteria | 1273 |
| 9 | Ga0070683_100064691 | 3300005329 | Bacteria | 3405 |
| 10 | Ga0070683_100068037 | 3300005329 | Bacteria | 3318 |
| 11 | Ga0070683_101208156 | 3300005329 | Bacteria | 726 |
| 12 | Ga0068869_100399454 | 3300005334 | Bacteria | 1130 |
| 13 | Ga0070666_10045428 | 3300005335 | Bacteria | 2944 |
| 14 | Ga0070682_100000406 | 3300005337 | Bacteria | 28207 |
| 15 | Ga0070682_100684953 | 3300005337 | Bacteria | 820 |
| 16 | Ga0068868_100684585 | 3300005338 | Bacteria | 916 |
| 17 | Ga0068868_100733961 | 3300005338 | Bacteria | 886 |
| 18 | Ga0070660_100088070 | 3300005339 | Bacteria | 2444 |
| 19 | Ga0070689_100031034 | 3300005340 | Bacteria | 4060 |
| 20 | Ga0070692_10286967 | 3300005345 | Bacteria | 1000 |
| 21 | Ga0070675_100163281 | 3300005354 | Bacteria | 1917 |
| 22 | Ga0070671_100869181 | 3300005355 | Bacteria | 787 |
| 23 | Ga0070688_100027441 | 3300005365 | Bacteria | 3393 |
| 24 | Ga0070667_100003016 | 3300005367 | Bacteria | 14468 |
| 25 | Ga0070714_100029249 | 3300005435 | Bacteria | 4580 |
| 26 | Ga0070714_100630571 | 3300005435 | Bacteria | 1031 |
| 27 | Ga0070714_101153203 | 3300005435 | Bacteria | 756 |
| 28 | Ga0070713_100251115 | 3300005436 | Bacteria | 1613 |
| 29 | Ga0070713_100333999 | 3300005436 | Bacteria | 1403 |
| 30 | Ga0070700_100403887 | 3300005441 | Bacteria | 1028 |
| 31 | Ga0070663_100057809 | 3300005455 | Bacteria | 2784 |
| 32 | Ga0070663_100677055 | 3300005455 | Bacteria | 875 |
| 33 | Ga0070681_10007383 | 3300005458 | Bacteria | 10743 |
| 34 | Ga0070698_100000874 | 3300005471 | Bacteria | 33107 |
| 35 | Ga0070698_100627138 | 3300005471 | Bacteria | 1016 |
| 36 | Ga0070699_100478014 | 3300005518 | Bacteria | 1131 |
| 37 | Ga0070679_100006465 | 3300005530 | Bacteria | 10920 |
| 38 | Ga0070684_100450428 | 3300005535 | Bacteria | 1190 |
| 39 | Ga0070684_100476755 | 3300005535 | Bacteria | 1155 |
| 40 | Ga0070695_100435897 | 3300005545 | Bacteria | 1001 |
| 41 | Ga0070696_100033838 | 3300005546 | Unclassified | 3514 |
| 42 | Ga0070664_100268700 | 3300005564 | Bacteria | 1536 |
| 43 | Ga0068859_100050279 | 3300005617 | Unclassified | 4188 |
| 44 | Ga0068859_100700606 | 3300005617 | Bacteria | 1103 |
| 45 | Ga0068864_100401238 | 3300005618 | Bacteria | 1303 |
| 46 | Ga0068864_100570082 | 3300005618 | Bacteria | 1096 |
| 47 | Ga0068870_10033934 | 3300005840 | Bacteria | 2608 |
| 48 | Ga0068863_100147694 | 3300005841 | Bacteria | 2249 |
| 49 | Ga0068858_100755914 | 3300005842 | Bacteria | 947 |
| 50 | Ga0081540_1104570 | 3300005983 | Bacteria | 1211 |
| 51 | Ga0075364_10031687 | 3300006051 | Bacteria | 3396 |
| 52 | Ga0075369_10341601 | 3300006186 | Bacteria | 702 |
| 53 | Ga0068871_101342816 | 3300006358 | Bacteria | 673 |
| 54 | Ga0075428_100021725 | 3300006844 | Bacteria | 7104 |
| 55 | Ga0075428_100578578 | 3300006844 | Bacteria | 1200 |
| 56 | Ga0075430_100054892 | 3300006846 | Bacteria | 3352 |
| 57 | Ga0075430_100579892 | 3300006846 | Bacteria | 925 |
| 58 | Ga0075431_100129912 | 3300006847 | Bacteria | 2599 |
| 59 | Ga0075433_10347966 | 3300006852 | Bacteria | 1310 |
| 60 | Ga0075434_100030121 | 3300006871 | Bacteria | 5343 |
| 61 | Ga0075429_100016364 | 3300006880 | Bacteria | 6427 |
| 62 | Ga0075429_100120119 | 3300006880 | Unclassified | 2297 |
| 63 | Ga0075429_100199912 | 3300006880 | Bacteria | 1751 |
| 64 | Ga0075429_100606284 | 3300006880 | Bacteria | 959 |
| 65 | Ga0097620_100050279 | 3300006931 | Unclassified | 4188 |
| 66 | Ga0097620_100700741 | 3300006931 | Bacteria | 1103 |
| 67 | Ga0105250_10000017 | 3300009092 | Bacteria | 255998 |
| 68 | Ga0111539_10010705 | 3300009094 | Bacteria | 11546 |
| 69 | Ga0114129_10000363 | 3300009147 | Bacteria | 52419 |
| 70 | Ga0114129_10009583 | 3300009147 | Bacteria | 13815 |
| 71 | Ga0105243_10089742 | 3300009148 | Bacteria | 2528 |
| 72 | Ga0105243_11867718 | 3300009148 | Bacteria | 633 |
| 73 | Ga0105241_10403231 | 3300009174 | Bacteria | 1200 |
| 74 | Ga0105241_10977415 | 3300009174 | Bacteria | 791 |
| 75 | Ga0105237_10003778 | 3300009545 | Bacteria | 17810 |
| 76 | Ga0105237_11250067 | 3300009545 | Bacteria | 749 |
| 77 | Ga0105238_11097198 | 3300009551 | Bacteria | 818 |
| 78 | Ga0105239_10007883 | 3300010375 | Bacteria | 12174 |
| 79 | Ga0105239_10058134 | 3300010375 | Bacteria | 4243 |
| 80 | Ga0105246_10127518 | 3300011119 | Bacteria | 1895 |
| 81 | Ga0157370_10228184 | 3300013104 | Bacteria | 1724 |
| 82 | Ga0157369_10160016 | 3300013105 | Bacteria | 2377 |
| 83 | Ga0157369_10224409 | 3300013105 | Bacteria | 1966 |
| 84 | Ga0157374_11520643 | 3300013296 | Bacteria | 693 |
| 85 | Ga0157372_10000303 | 3300013307 | Bacteria | 54864 |
| 86 | Ga0157372_10644864 | 3300013307 | Bacteria | 1233 |
| 87 | Ga0157372_11190935 | 3300013307 | Bacteria | 880 |
| 88 | Ga0163163_10461953 | 3300014325 | Bacteria | 1330 |
| 89 | Ga0182008_10064223 | 3300014497 | Bacteria | 1807 |
| 90 | Ga0157377_10009729 | 3300014745 | Bacteria | 4730 |
| 91 | Ga0157377_10530841 | 3300014745 | Bacteria | 828 |
| 92 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 93 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 94 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 95 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 96 | Ga0206356_10007965 | 3300020070 | Bacteria | 957 |
| 97 | Ga0206353_10233672 | 3300020082 | Bacteria | 2141 |
| 98 | Ga0213873_10023981 | 3300021358 | Bacteria | 1460 |
| 99 | Ga0213872_10023748 | 3300021361 | Bacteria | 2820 |
| 100 | Ga0213875_10203709 | 3300021388 | Bacteria | 931 |
| 101 | Ga0224712_10161496 | 3300022467 | Bacteria | 1000 |
| 102 | Ga0209437_112496 | 3300025233 | Bacteria | 1237 |
| 103 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 104 | Ga0209051_1002347 | 3300025303 | Bacteria | 13695 |
| 105 | Ga0207696_1000015 | 3300025711 | Bacteria | 507848 |
| 106 | Ga0207655_1017241 | 3300025728 | Bacteria | 3903 |
| 107 | Ga0207680_10102385 | 3300025903 | Bacteria | 1842 |
| 108 | Ga0207643_10110579 | 3300025908 | Bacteria | 1619 |
| 109 | Ga0207707_10055008 | 3300025912 | Bacteria | 3463 |
| 110 | Ga0207671_10280847 | 3300025914 | Bacteria | 1313 |
| 111 | Ga0207660_11255178 | 3300025917 | Bacteria | 602 |
| 112 | Ga0207652_10002307 | 3300025921 | Bacteria | 16169 |
| 113 | Ga0207659_10095749 | 3300025926 | Bacteria | 2227 |
| 114 | Ga0207664_10005678 | 3300025929 | Bacteria | 8529 |
| 115 | Ga0207644_10374938 | 3300025931 | Bacteria | 1160 |
| 116 | Ga0207709_10163432 | 3300025935 | Bacteria | 1555 |
| 117 | Ga0207670_10045615 | 3300025936 | Bacteria | 2907 |
| 118 | Ga0207670_10481805 | 3300025936 | Bacteria | 1005 |
| 119 | Ga0207661_10052834 | 3300025944 | Bacteria | 3248 |
| 120 | Ga0207661_10283014 | 3300025944 | Bacteria | 1482 |
| 121 | Ga0207679_10087520 | 3300025945 | Bacteria | 2399 |
| 122 | Ga0207679_10261686 | 3300025945 | Bacteria | 1476 |
| 123 | Ga0207658_10001953 | 3300025986 | Bacteria | 15401 |
| 124 | Ga0207677_10736099 | 3300026023 | Bacteria | 878 |
| 125 | Ga0207678_10174880 | 3300026067 | Bacteria | 1833 |
| 126 | Ga0207678_10481448 | 3300026067 | Bacteria | 1081 |
| 127 | Ga0207641_10063525 | 3300026088 | Bacteria | 3154 |
| 128 | Ga0207648_10667587 | 3300026089 | Unclassified | 961 |
| 129 | Ga0207676_10293164 | 3300026095 | Bacteria | 1482 |
| 130 | Ga0207676_10375691 | 3300026095 | Bacteria | 1322 |
| 131 | Ga0207428_10093627 | 3300027907 | Bacteria | 2330 |
| 132 | Ga0314311_1096892 | 3300030733 | Bacteria | 1915 |
| 133 | Ga0314311_1213235 | 3300030733 | Bacteria | 1058 |
| 134 | Ga0265327_10002365 | 3300031251 | Bacteria | 20094 |
| 135 | Ga0265327_10310213 | 3300031251 | Bacteria | 693 |
| 136 | Ga0307513_10001973 | 3300031456 | Bacteria | 29050 |
| 137 | Ga0307513_10424318 | 3300031456 | Bacteria | 1059 |
| 138 | Ga0307410_10305988 | 3300031852 | Bacteria | 1256 |
| 139 | Ga0307409_100462217 | 3300031995 | Bacteria | 1227 |
| 140 | Ga0307409_101268880 | 3300031995 | Bacteria | 761 |
| 141 | Ga0307416_100241150 | 3300032002 | Bacteria | 1752 |
| 142 | Ga0307416_100675735 | 3300032002 | Bacteria | 1120 |
| 143 | Ga0372808_048671 | 3300036459 | Bacteria | 607 |
| 144 | Ga0395905_0003536 | 3300037471 | Bacteria | 16647 |
| 145 | Ga0436364_0880783 | 3300037853 | Bacteria | 1439 |
| 146 | Ga0436364_0996174 | 3300037853 | Bacteria | 2512 |
| 147 | Ga0436364_1136906 | 3300037853 | Bacteria | 931 |
| 148 | Ga0436365_1589230 | 3300039437 | Bacteria | 1108 |
| 149 | Ga0436360_0226348 | 3300039438 | Unclassified | 3732 |
| 150 | Ga0436361_0200270 | 3300039447 | Bacteria | 32952 |
| 151 | Ga0436361_1149602 | 3300039447 | Unclassified | 2862 |
| 152 | Ga0436362_0577533 | 3300039453 | Unclassified | 3968 |
| 153 | Ga0439461_0001633 | 3300041410 | Bacteria | 3481 |
| 154 | Ga0439466_0016174 | 3300041411 | Bacteria | 2700 |
| 155 | Ga0439431_0001607 | 3300041997 | Bacteria | 5012 |
| 156 | Ga0439432_014512 | 3300042006 | Bacteria | 2665 |
| 157 | Ga0450907_071428 | 3300042146 | Bacteria | 601 |
| 158 | Ga0439434_0001186 | 3300042435 | Bacteria | 7506 |
| 159 | Ga0466972_0027078 | 3300044658 | Bacteria | 2838 |
| 160 | Ga0466972_0067352 | 3300044658 | Bacteria | 1711 |
| 161 | Ga0466972_0463503 | 3300044658 | Bacteria | 595 |
| 162 | Ga0466965_0001648 | 3300044683 | Bacteria | 9145 |
| 163 | Ga0466965_0004165 | 3300044683 | Bacteria | 6427 |
| 164 | Ga0466965_0344845 | 3300044683 | Bacteria | 815 |
| 165 | Ga0466966_0030851 | 3300044684 | Bacteria | 3477 |
| 166 | Ga0466966_0305262 | 3300044684 | Bacteria | 956 |
| 167 | Ga0466961_0052827 | 3300044693 | Bacteria | 2594 |
| 168 | Ga0466961_0630768 | 3300044693 | Unclassified | 644 |
| 169 | Ga0466963_0010496 | 3300044694 | Bacteria | 5608 |
| 170 | Ga0453684_0107627 | 3300044712 | Unclassified | 3394 |
| 171 | Ga0466971_0107150 | 3300044719 | Bacteria | 1288 |
| 172 | Ga0466971_0238681 | 3300044719 | Bacteria | 864 |
| 173 | Ga0466968_0078812 | 3300044735 | Bacteria | 1444 |
| 174 | Ga0466970_0258524 | 3300044765 | Bacteria | 977 |
| 175 | Ga0466957_0002459 | 3300044842 | Bacteria | 9948 |
| 176 | Ga0466960_0000219 | 3300044901 | Bacteria | 19833 |
| 177 | Ga0466959_0012778 | 3300045049 | Bacteria | 6076 |
| 178 | Ga0466959_0472246 | 3300045049 | Bacteria | 849 |
| 179 | Ga0466958_0004692 | 3300045836 | Bacteria | 7254 |
| 180 | Ga0466958_0811432 | 3300045836 | Unclassified | 610 |
| 181 | Ga0466967_0019525 | 3300045976 | Bacteria | 5452 |
| 182 | Ga0466967_0041373 | 3300045976 | Bacteria | 3973 |
| 183 | Ga0495627_053359 | 3300046453 | Bacteria | 1210 |
| 184 | Ga0495592_0007946 | 3300046454 | Bacteria | 7957 |
| 185 | Ga0495629_0215613 | 3300046459 | Bacteria | 1325 |
| 186 | Ga0495651_0006431 | 3300046462 | Bacteria | 8987 |
| 187 | Ga0495653_0034029 | 3300046463 | Bacteria | 4033 |
| 188 | Ga0495628_0002367 | 3300046516 | Bacteria | 17016 |
| 189 | Ga0495652_0032660 | 3300046529 | Bacteria | 4550 |
| 190 | Ga0495654_0001021 | 3300046530 | Bacteria | 20493 |
| 191 | Ga0495665_0003574 | 3300046531 | Bacteria | 8439 |
| 192 | Ga0495640_0097943 | 3300046533 | Bacteria | 1928 |
| 193 | Ga0495587_0001445 | 3300046536 | Bacteria | 15834 |
| 194 | Ga0495635_0101177 | 3300046663 | Bacteria | 1969 |
| 195 | Ga0495646_0022724 | 3300046680 | Bacteria | 3952 |
| 196 | Ga0495613_0003206 | 3300046689 | Bacteria | 12243 |
| 197 | Ga0495600_0024294 | 3300046809 | Bacteria | 3900 |
| 198 | Ga0495581_0033515 | 3300047315 | Bacteria | 2972 |
| 199 | Ga0495604_0000225 | 3300047317 | Bacteria | 51285 |
| 200 | Ga0495675_0011554 | 3300047444 | Bacteria | 5543 |
| 201 | Ga0495679_007128 | 3300047446 | Bacteria | 4705 |
| 202 | Ga0495684_0025406 | 3300047471 | Bacteria | 4552 |
| 203 | Ga0495602_0046993 | 3300048088 | Bacteria | 3893 |
| 204 | Ga0496100_0000074 | 3300048903 | Bacteria | 55196 |
| 205 | Ga0496100_1126941 | 3300048903 | Bacteria | 618 |
| 206 | Ga0496101_0000017 | 3300048904 | Bacteria | 239153 |
| 207 | Ga0496101_0106527 | 3300048904 | Bacteria | 2105 |
| 208 | Ga0496102_0221298 | 3300048905 | Bacteria | 1784 |
| 209 | Ga0496102_0605612 | 3300048905 | Bacteria | 1018 |
| 210 | Ga0496102_0904950 | 3300048905 | Bacteria | 804 |
| 211 | Ga0496103_0002372 | 3300048906 | Bacteria | 11879 |
| 212 | Ga0496106_0003417 | 3300048909 | Bacteria | 11828 |
| 213 | Ga0496107_0000570 | 3300048910 | Bacteria | 20542 |
| 214 | Ga0496109_0002454 | 3300048912 | Bacteria | 15541 |
| 215 | Ga0496109_0011341 | 3300048912 | Bacteria | 7657 |
| 216 | Ga0496109_0761417 | 3300048912 | Bacteria | 906 |
| 217 | Ga0496110_0004528 | 3300048913 | Bacteria | 10785 |
| 218 | Ga0496110_0201881 | 3300048913 | Bacteria | 1807 |
| 219 | Ga0496110_0327563 | 3300048913 | Bacteria | 1395 |
| 220 | Ga0496111_0002248 | 3300048914 | Bacteria | 11602 |
| 221 | Ga0496111_0574595 | 3300048914 | Bacteria | 826 |
| 222 | Ga0496113_0001800 | 3300048916 | Bacteria | 12155 |
| 223 | Ga0496113_0375559 | 3300048916 | Bacteria | 1141 |
| 224 | Ga0496114_0003459 | 3300048917 | Bacteria | 12112 |
| 225 | Ga0496114_0503796 | 3300048917 | Bacteria | 1071 |
| 226 | Ga0496115_0185248 | 3300048918 | Bacteria | 1720 |
| 227 | Ga0496116_0020066 | 3300048919 | Bacteria | 5089 |
| 228 | Ga0496116_0179921 | 3300048919 | Bacteria | 1133 |
| 229 | Ga0496116_0221956 | 3300048919 | Bacteria | 967 |
| 230 | Ga0496117_0137620 | 3300048920 | Bacteria | 1468 |
| 231 | Ga0496117_0183766 | 3300048920 | Bacteria | 1198 |
| 232 | Ga0496117_0316493 | 3300048920 | Bacteria | 819 |
| 233 | Ga0496118_0051116 | 3300048921 | Bacteria | 3164 |
| 234 | Ga0496118_0051570 | 3300048921 | Bacteria | 3146 |
| 235 | Ga0496118_0074915 | 3300048921 | Bacteria | 2416 |
| 236 | Ga0496119_0001654 | 3300048922 | Bacteria | 26212 |
| 237 | Ga0496119_0538440 | 3300048922 | Bacteria | 538 |
| 238 | Ga0496120_0060205 | 3300048923 | Bacteria | 2125 |
| 239 | Ga0496120_0114221 | 3300048923 | Bacteria | 1406 |
| 240 | Ga0496120_0190831 | 3300048923 | Bacteria | 999 |
| 241 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 242 | Ga0496121_0000816 | 3300048924 | Bacteria | 56863 |
| 243 | Ga0496122_0000097 | 3300048925 | Bacteria | 199223 |
| 244 | Ga0496122_0003253 | 3300048925 | Bacteria | 21559 |
| 245 | Ga0496122_0062137 | 3300048925 | Bacteria | 2736 |
| 246 | Ga0496122_0313390 | 3300048925 | Bacteria | 838 |
| 247 | Ga0496123_0003143 | 3300048926 | Bacteria | 18934 |
| 248 | Ga0496123_0032551 | 3300048926 | Bacteria | 3772 |
| 249 | Ga0496123_0033490 | 3300048926 | Bacteria | 3696 |
| 250 | Ga0496123_0087897 | 3300048926 | Bacteria | 1857 |
| 251 | Ga0496123_0099136 | 3300048926 | Bacteria | 1701 |
| 252 | Ga0496124_0000019 | 3300048927 | Bacteria | 436995 |
| 253 | Ga0496124_0148029 | 3300048927 | Bacteria | 1845 |
| 254 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 255 | Ga0496125_0000610 | 3300048928 | Bacteria | 60637 |
| 256 | Ga0496125_0002824 | 3300048928 | Bacteria | 21899 |
| 257 | Ga0496125_0185903 | 3300048928 | Bacteria | 1378 |
| 258 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 259 | Ga0496126_0000063 | 3300048929 | Bacteria | 256841 |
| 260 | Ga0496126_0035524 | 3300048929 | Bacteria | 4671 |
| 261 | Ga0496126_0145092 | 3300048929 | Bacteria | 2039 |
| 262 | Ga0496126_0155898 | 3300048929 | Bacteria | 1954 |
| 263 | Ga0501031_0425774 | 3300049568 | Bacteria | 858 |
| 264 | Ga0501032_0029509 | 3300049569 | Bacteria | 3763 |
| 265 | Ga0501036_0739543 | 3300049572 | Bacteria | 812 |
| 266 | Ga0501036_1612662 | 3300049572 | Bacteria | 524 |
| 267 | Ga0501038_0356147 | 3300049574 | Bacteria | 1139 |
| 268 | Ga0501039_1259396 | 3300049575 | Bacteria | 571 |
| 269 | Ga0501040_0241016 | 3300049576 | Bacteria | 1289 |
| 270 | Ga0501040_0878579 | 3300049576 | Bacteria | 649 |
| 271 | Ga0501041_0349141 | 3300049577 | Bacteria | 935 |
| 272 | Ga0501069_0382186 | 3300049585 | Bacteria | 832 |
| 273 | Ga0501071_0711529 | 3300049587 | Bacteria | 773 |
| 274 | Ga0501071_1071788 | 3300049587 | Bacteria | 623 |
| 275 | Ga0501072_0001679 | 3300049588 | Bacteria | 16481 |
| 276 | Ga0501075_0634249 | 3300049591 | Bacteria | 815 |
| 277 | nmdc:mga00v17_161417_c1 | 3300050491 | Bacteria | 1443 |
| 278 | nmdc:mga00v17_35381_c1 | 3300050491 | Bacteria | 2971 |
| 279 | nmdc:mga05p37_33202_c1 | 3300050507 | Bacteria | 6320 |
| 280 | nmdc:mga05p37_68707_c1 | 3300050507 | Bacteria | 4357 |
| 281 | nmdc:mga05p37_85691_c1 | 3300050507 | Bacteria | 3882 |
| 282 | nmdc:mga09592_195283_c1 | 3300050508 | Bacteria | 1752 |
| 283 | nmdc:mga09592_35637_c1 | 3300050508 | Bacteria | 4166 |
| 284 | nmdc:mga09592_544498_c1 | 3300050508 | Bacteria | 997 |
| 285 | nmdc:mga06r32_209599_c1 | 3300050510 | Bacteria | 1937 |
| 286 | nmdc:mga08y16_103779_c1 | 3300050511 | Bacteria | 2960 |
| 287 | nmdc:mga0a205_333273_c1 | 3300050515 | Bacteria | 1387 |
| 288 | Ga0495601_0007575 | 3300053077 | Bacteria | 6374 |
| 289 | Ga0495612_0165862 | 3300053078 | Bacteria | 966 |
| 290 | Ga0500641_0141540 | 3300053096 | Bacteria | 1039 |
| 291 | Ga0466962_0007610 | 3300061719 | Bacteria | 5195 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044683 | Ga0466965_0344845 | Ga0466965_0344845_21_449 | 139 |
| 2 | 3300013104 | Ga0157370_10228184 | Ga0157370_102281841 | 140 |
| 3 | 3300021361 | Ga0213872_10023748 | Ga0213872_100237482 | 140 |
| 4 | 3300039447 | Ga0436361_0200270 | Ga0436361_0200270_14886_15359 | 140 |
| 5 | 3300005327 | Ga0070658_10345619 | Ga0070658_103456192 | 142 |
| 6 | 3300005435 | Ga0070714_101153203 | Ga0070714_1011532031 | 145 |
| 7 | 3300005337 | Ga0070682_100000406 | Ga0070682_10000040626 | 146 |
| 8 | 3300005339 | Ga0070660_100088070 | Ga0070660_1000880704 | 146 |
| 9 | 3300005455 | Ga0070663_100677055 | Ga0070663_1006770551 | 146 |
| 10 | 3300026067 | Ga0207678_10481448 | Ga0207678_104814482 | 146 |
| 11 | 3300044693 | Ga0466961_0052827 | Ga0466961_0052827_92_541 | 146 |
| 12 | 3300044719 | Ga0466971_0238681 | Ga0466971_0238681_231_680 | 146 |
| 13 | 3300044765 | Ga0466970_0258524 | Ga0466970_0258524_132_581 | 146 |
| 14 | 3300037853 | Ga0436364_0880783 | Ga0436364_0880783_197_646 | 147 |
| 15 | iso_pu_bacteria | 2837268691 | 2837270313 | 149 |
| 16 | iso_pu_bacteria | 2887443736 | 2887444185 | 149 |
| 17 | 3300005329 | Ga0070683_100064691 | Ga0070683_1000646914 | 150 |
| 18 | 3300005345 | Ga0070692_10286967 | Ga0070692_102869671 | 150 |
| 19 | 3300005435 | Ga0070714_100029249 | Ga0070714_1000292496 | 150 |
| 20 | 3300005436 | Ga0070713_100333999 | Ga0070713_1003339992 | 150 |
| 21 | 3300005455 | Ga0070663_100057809 | Ga0070663_1000578091 | 150 |
| 22 | 3300005458 | Ga0070681_10007383 | Ga0070681_100073833 | 150 |
| 23 | 3300005530 | Ga0070679_100006465 | Ga0070679_1000064652 | 150 |
| 24 | 3300005617 | Ga0068859_100700606 | Ga0068859_1007006061 | 150 |
| 25 | 3300005618 | Ga0068864_100570082 | Ga0068864_1005700823 | 150 |
| 26 | 3300006931 | Ga0097620_100700741 | Ga0097620_1007007412 | 150 |
| 27 | 3300009551 | Ga0105238_11097198 | Ga0105238_110971982 | 150 |
| 28 | 3300013105 | Ga0157369_10224409 | Ga0157369_102244092 | 150 |
| 29 | 3300013307 | Ga0157372_10644864 | Ga0157372_106448642 | 150 |
| 30 | 3300014745 | Ga0157377_10530841 | Ga0157377_105308412 | 150 |
| 31 | 3300020070 | Ga0206356_10007965 | Ga0206356_100079652 | 150 |
| 32 | 3300020082 | Ga0206353_10233672 | Ga0206353_102336721 | 150 |
| 33 | 3300022467 | Ga0224712_10161496 | Ga0224712_101614962 | 150 |
| 34 | 3300025912 | Ga0207707_10055008 | Ga0207707_100550081 | 150 |
| 35 | 3300025921 | Ga0207652_10002307 | Ga0207652_1000230715 | 150 |
| 36 | 3300025929 | Ga0207664_10005678 | Ga0207664_100056786 | 150 |
| 37 | 3300025945 | Ga0207679_10261686 | Ga0207679_102616862 | 150 |
| 38 | 3300026067 | Ga0207678_10174880 | Ga0207678_101748802 | 150 |
| 39 | 3300026095 | Ga0207676_10375691 | Ga0207676_103756912 | 150 |
| 40 | 3300048929 | Ga0496126_0155898 | Ga0496126_0155898_473_931 | 150 |
| 41 | 3300050507 | nmdc:mga05p37_68707_c1 | nmdc:mga05p37_68707_c1_1140_1694 | 150 |
| 42 | 3300050510 | nmdc:mga06r32_209599_c1 | nmdc:mga06r32_209599_c1_483_1037 | 150 |
| 43 | iso_pu_bacteria | 2558860112 | 2558908103 | 150 |
| 44 | 3300021358 | Ga0213873_10023981 | Ga0213873_100239812 | 151 |
| 45 | 3300037853 | Ga0436364_0996174 | Ga0436364_0996174_635_1096 | 151 |
| 46 | 3300039438 | Ga0436360_0226348 | Ga0436360_0226348_2402_2863 | 151 |
| 47 | 3300039447 | Ga0436361_1149602 | Ga0436361_1149602_477_938 | 151 |
| 48 | 3300039453 | Ga0436362_0577533 | Ga0436362_0577533_628_1089 | 151 |
| 49 | iso_pu_bacteria | 2816332139 | 2816505776 | 151 |
| 50 | iso_pu_bacteria | 2870782633 | 2870789406 | 151 |
| 51 | 3300005471 | Ga0070698_100627138 | Ga0070698_1006271382 | 152 |
| 52 | 3300009148 | Ga0105243_10089742 | Ga0105243_100897422 | 152 |
| 53 | 3300025935 | Ga0207709_10163432 | Ga0207709_101634322 | 152 |
| 54 | 3300031995 | Ga0307409_100462217 | Ga0307409_1004622172 | 152 |
| 55 | 3300032002 | Ga0307416_100675735 | Ga0307416_1006757352 | 152 |
| 56 | 3300036459 | Ga0372808_048671 | Ga0372808_048671_80_544 | 152 |
| 57 | 3300044658 | Ga0466972_0463503 | Ga0466972_0463503_109_573 | 152 |
| 58 | iso_pu_bacteria | 2643221721 | 2644666202 | 152 |
| 59 | iso_pu_bacteria | 2738541272 | 2738695975 | 152 |
| 60 | iso_pu_bacteria | 2738543027 | 2739324798 | 152 |
| 61 | iso_pu_bacteria | 2758568621 | 2760623911 | 152 |
| 62 | iso_pu_bacteria | 2902810491 | 2902811289 | 152 |
| 63 | iso_pu_bacteria | 2904776348 | 2904777327 | 152 |
| 64 | iso_pu_bacteria | 2928142448 | 2928144502 | 152 |
| 65 | iso_pu_bacteria | 2932431166 | 2932431774 | 152 |
| 66 | iso_pu_bacteria | 2935890801 | 2935891176 | 152 |
| 67 | iso_pu_bacteria | 8056579771 | 8056585134 | 152 |
| 68 | iso_pu_bacteria | 8057160832 | 8057161081 | 152 |
| 69 | 3300013307 | Ga0157372_11190935 | Ga0157372_111909352 | 153 |
| 70 | 3300014497 | Ga0182008_10064223 | Ga0182008_100642232 | 153 |
| 71 | 3300021388 | Ga0213875_10203709 | Ga0213875_102037092 | 153 |
| 72 | 3300037853 | Ga0436364_1136906 | Ga0436364_1136906_115_627 | 153 |
| 73 | 3300046530 | Ga0495654_0001021 | Ga0495654_0001021_11677_12144 | 153 |
| 74 | 3300049568 | Ga0501031_0425774 | Ga0501031_0425774_11_478 | 153 |
| 75 | 3300049572 | Ga0501036_0739543 | Ga0501036_0739543_205_672 | 153 |
| 76 | 3300049572 | Ga0501036_1612662 | Ga0501036_1612662_39_506 | 153 |
| 77 | 3300049576 | Ga0501040_0878579 | Ga0501040_0878579_35_502 | 153 |
| 78 | 3300049585 | Ga0501069_0382186 | Ga0501069_0382186_17_484 | 153 |
| 79 | 3300049587 | Ga0501071_1071788 | Ga0501071_1071788_143_610 | 153 |
| 80 | 3300049591 | Ga0501075_0634249 | Ga0501075_0634249_246_713 | 153 |
| 81 | iso_pu_bacteria | 2738541264 | 2738665450 | 153 |
| 82 | iso_pu_bacteria | 2738541356 | 2739144584 | 153 |
| 83 | iso_pu_bacteria | 2739367654 | 2739605597 | 153 |
| 84 | iso_pu_bacteria | 2808606394 | 2809028826 | 153 |
| 85 | iso_pu_bacteria | 2904504865 | 2904508399 | 153 |
| 86 | iso_pu_bacteria | 2946003308 | 2946004916 | 153 |
| 87 | 3300005471 | Ga0070698_100000874 | Ga0070698_10000087418 | 154 |
| 88 | 3300005518 | Ga0070699_100478014 | Ga0070699_1004780141 | 154 |
| 89 | 3300006844 | Ga0075428_100578578 | Ga0075428_1005785782 | 154 |
| 90 | 3300006880 | Ga0075429_100606284 | Ga0075429_1006062841 | 154 |
| 91 | 3300009147 | Ga0114129_10000363 | Ga0114129_1000036323 | 154 |
| 92 | 3300013307 | Ga0157372_10000303 | Ga0157372_1000030333 | 154 |
| 93 | 3300044712 | Ga0453684_0107627 | Ga0453684_0107627_1781_2254 | 154 |
| 94 | 3300044719 | Ga0466971_0107150 | Ga0466971_0107150_638_1111 | 154 |
| 95 | 3300050507 | nmdc:mga05p37_33202_c1 | nmdc:mga05p37_33202_c1_4183_4653 | 154 |
| 96 | 3300050508 | nmdc:mga09592_544498_c1 | nmdc:mga09592_544498_c1_492_962 | 154 |
| 97 | 3300053096 | Ga0500641_0141540 | Ga0500641_0141540_54_533 | 154 |
| 98 | iso_pu_bacteria | 2602042047 | 2603642438 | 154 |
| 99 | iso_pu_bacteria | 2939582691 | 2939584257 | 154 |
| 100 | 3300005329 | Ga0070683_100068037 | Ga0070683_1000680372 | 155 |
| 101 | 3300005329 | Ga0070683_101208156 | Ga0070683_1012081561 | 155 |
| 102 | 3300005337 | Ga0070682_100684953 | Ga0070682_1006849532 | 155 |
| 103 | 3300005338 | Ga0068868_100733961 | Ga0068868_1007339612 | 155 |
| 104 | 3300005355 | Ga0070671_100869181 | Ga0070671_1008691811 | 155 |
| 105 | 3300005535 | Ga0070684_100450428 | Ga0070684_1004504282 | 155 |
| 106 | 3300005535 | Ga0070684_100476755 | Ga0070684_1004767552 | 155 |
| 107 | 3300005564 | Ga0070664_100268700 | Ga0070664_1002687002 | 155 |
| 108 | 3300005983 | Ga0081540_1104570 | Ga0081540_11045702 | 155 |
| 109 | 3300006358 | Ga0068871_101342816 | Ga0068871_1013428161 | 155 |
| 110 | 3300009174 | Ga0105241_10403231 | Ga0105241_104032312 | 155 |
| 111 | 3300009174 | Ga0105241_10977415 | Ga0105241_109774151 | 155 |
| 112 | 3300013105 | Ga0157369_10160016 | Ga0157369_101600162 | 155 |
| 113 | 3300013296 | Ga0157374_11520643 | Ga0157374_115206432 | 155 |
| 114 | 3300014325 | Ga0163163_10461953 | Ga0163163_104619531 | 155 |
| 115 | 3300025931 | Ga0207644_10374938 | Ga0207644_103749381 | 155 |
| 116 | 3300025944 | Ga0207661_10052834 | Ga0207661_100528343 | 155 |
| 117 | 3300025944 | Ga0207661_10283014 | Ga0207661_102830141 | 155 |
| 118 | 3300025945 | Ga0207679_10087520 | Ga0207679_100875203 | 155 |
| 119 | 3300037471 | Ga0395905_0003536 | Ga0395905_0003536_3047_3538 | 155 |
| 120 | 3300039437 | Ga0436365_1589230 | Ga0436365_1589230_174_647 | 155 |
| 121 | 3300044683 | Ga0466965_0004165 | Ga0466965_0004165_5434_5907 | 155 |
| 122 | 3300044684 | Ga0466966_0030851 | Ga0466966_0030851_1953_2426 | 155 |
| 123 | 3300044694 | Ga0466963_0010496 | Ga0466963_0010496_651_1124 | 155 |
| 124 | 3300044735 | Ga0466968_0078812 | Ga0466968_0078812_657_1130 | 155 |
| 125 | 3300044842 | Ga0466957_0002459 | Ga0466957_0002459_9306_9779 | 155 |
| 126 | 3300045049 | Ga0466959_0012778 | Ga0466959_0012778_2198_2671 | 155 |
| 127 | 3300045836 | Ga0466958_0004692 | Ga0466958_0004692_3163_3636 | 155 |
| 128 | 3300045976 | Ga0466967_0019525 | Ga0466967_0019525_2342_2815 | 155 |
| 129 | 3300046533 | Ga0495640_0097943 | Ga0495640_0097943_669_1151 | 155 |
| 130 | 3300048905 | Ga0496102_0904950 | Ga0496102_0904950_213_686 | 155 |
| 131 | 3300048913 | Ga0496110_0201881 | Ga0496110_0201881_914_1387 | 155 |
| 132 | 3300048914 | Ga0496111_0574595 | Ga0496111_0574595_201_674 | 155 |
| 133 | 3300048917 | Ga0496114_0503796 | Ga0496114_0503796_160_633 | 155 |
| 134 | 3300049569 | Ga0501032_0029509 | Ga0501032_0029509_3114_3635 | 155 |
| 135 | 3300049588 | Ga0501072_0001679 | Ga0501072_0001679_1669_2142 | 155 |
| 136 | 3300053077 | Ga0495601_0007575 | Ga0495601_0007575_174_647 | 155 |
| 137 | 3300053078 | Ga0495612_0165862 | Ga0495612_0165862_37_510 | 155 |
| 138 | 3300061719 | Ga0466962_0007610 | Ga0466962_0007610_3857_4330 | 155 |
| 139 | iso_pu_bacteria | 2758568522 | 2760307569 | 155 |
| 140 | iso_pu_bacteria | 2831935698 | 2831936944 | 155 |
| 141 | 3300006051 | Ga0075364_10031687 | Ga0075364_100316872 | 156 |
| 142 | 3300006186 | Ga0075369_10341601 | Ga0075369_103416012 | 156 |
| 143 | 3300006846 | Ga0075430_100579892 | Ga0075430_1005798921 | 156 |
| 144 | 3300006847 | Ga0075431_100129912 | Ga0075431_1001299123 | 156 |
| 145 | 3300006880 | Ga0075429_100199912 | Ga0075429_1001999122 | 156 |
| 146 | 3300009094 | Ga0111539_10010705 | Ga0111539_1001070510 | 156 |
| 147 | 3300009147 | Ga0114129_10009583 | Ga0114129_100095839 | 156 |
| 148 | 3300011119 | Ga0105246_10127518 | Ga0105246_101275182 | 156 |
| 149 | 3300025303 | Ga0209051_1002347 | Ga0209051_10023475 | 156 |
| 150 | 3300025728 | Ga0207655_1017241 | Ga0207655_10172412 | 156 |
| 151 | 3300030733 | Ga0314311_1096892 | Ga0314311_10968921 | 156 |
| 152 | 3300030733 | Ga0314311_1213235 | Ga0314311_12132352 | 156 |
| 153 | 3300031852 | Ga0307410_10305988 | Ga0307410_103059882 | 156 |
| 154 | 3300031995 | Ga0307409_101268880 | Ga0307409_1012688801 | 156 |
| 155 | 3300032002 | Ga0307416_100241150 | Ga0307416_1002411502 | 156 |
| 156 | 3300041410 | Ga0439461_0001633 | Ga0439461_0001633_1608_2090 | 156 |
| 157 | 3300041411 | Ga0439466_0016174 | Ga0439466_0016174_920_1402 | 156 |
| 158 | 3300041997 | Ga0439431_0001607 | Ga0439431_0001607_1758_2240 | 156 |
| 159 | 3300042146 | Ga0450907_071428 | Ga0450907_071428_63_548 | 156 |
| 160 | 3300042435 | Ga0439434_0001186 | Ga0439434_0001186_5234_5710 | 156 |
| 161 | 3300046453 | Ga0495627_053359 | Ga0495627_053359_351_836 | 156 |
| 162 | 3300048903 | Ga0496100_1126941 | Ga0496100_1126941_97_573 | 156 |
| 163 | 3300048904 | Ga0496101_0106527 | Ga0496101_0106527_1357_1833 | 156 |
| 164 | 3300048916 | Ga0496113_0001800 | Ga0496113_0001800_1250_1726 | 156 |
| 165 | 3300048923 | Ga0496120_0114221 | Ga0496120_0114221_275_751 | 156 |
| 166 | 3300048926 | Ga0496123_0033490 | Ga0496123_0033490_431_907 | 156 |
| 167 | 3300048928 | Ga0496125_0185903 | Ga0496125_0185903_138_614 | 156 |
| 168 | 3300048929 | Ga0496126_0035524 | Ga0496126_0035524_2199_2675 | 156 |
| 169 | 3300049574 | Ga0501038_0356147 | Ga0501038_0356147_251_730 | 156 |
| 170 | 3300049575 | Ga0501039_1259396 | Ga0501039_1259396_56_532 | 156 |
| 171 | 3300049587 | Ga0501071_0711529 | Ga0501071_0711529_266_745 | 156 |
| 172 | 3300050491 | nmdc:mga00v17_161417_c1 | nmdc:mga00v17_161417_c1_565_1041 | 156 |
| 173 | 3300050491 | nmdc:mga00v17_35381_c1 | nmdc:mga00v17_35381_c1_1829_2305 | 156 |
| 174 | 3300050507 | nmdc:mga05p37_85691_c1 | nmdc:mga05p37_85691_c1_883_1359 | 156 |
| 175 | 3300050508 | nmdc:mga09592_195283_c1 | nmdc:mga09592_195283_c1_151_627 | 156 |
| 176 | 3300050511 | nmdc:mga08y16_103779_c1 | nmdc:mga08y16_103779_c1_267_743 | 156 |
| 177 | iso_pu_bacteria | 2643221715 | 2644634623 | 156 |
| 178 | iso_pu_bacteria | 2863067949 | 2863071757 | 156 |
| 179 | iso_pu_bacteria | 2866552031 | 2866553756 | 156 |
| 180 | iso_pu_bacteria | 8056207758 | 8056211121 | 156 |
| 181 | 3300003792 | Ga0055540_1000053 | Ga0055540_10000539 | 157 |
| 182 | 3300005335 | Ga0070666_10045428 | Ga0070666_100454282 | 157 |
| 183 | 3300005367 | Ga0070667_100003016 | Ga0070667_10000301612 | 157 |
| 184 | 3300005435 | Ga0070714_100630571 | Ga0070714_1006305712 | 157 |
| 185 | 3300005436 | Ga0070713_100251115 | Ga0070713_1002511152 | 157 |
| 186 | 3300005842 | Ga0068858_100755914 | Ga0068858_1007559141 | 157 |
| 187 | 3300009092 | Ga0105250_10000017 | Ga0105250_1000001743 | 157 |
| 188 | 3300009545 | Ga0105237_10003778 | Ga0105237_1000377812 | 157 |
| 189 | 3300009545 | Ga0105237_11250067 | Ga0105237_112500671 | 157 |
| 190 | 3300010375 | Ga0105239_10007883 | Ga0105239_100078839 | 157 |
| 191 | 3300010375 | Ga0105239_10058134 | Ga0105239_100581344 | 157 |
| 192 | 3300025233 | Ga0209437_112496 | Ga0209437_1124963 | 157 |
| 193 | 3300025303 | Ga0209051_1000021 | Ga0209051_1000021216 | 157 |
| 194 | 3300025711 | Ga0207696_1000015 | Ga0207696_1000015135 | 157 |
| 195 | 3300025903 | Ga0207680_10102385 | Ga0207680_101023853 | 157 |
| 196 | 3300025914 | Ga0207671_10280847 | Ga0207671_102808472 | 157 |
| 197 | 3300025986 | Ga0207658_10001953 | Ga0207658_1000195314 | 157 |
| 198 | 3300031251 | Ga0265327_10002365 | Ga0265327_100023653 | 157 |
| 199 | 3300031251 | Ga0265327_10310213 | Ga0265327_103102131 | 157 |
| 200 | 3300031456 | Ga0307513_10424318 | Ga0307513_104243181 | 157 |
| 201 | 3300044658 | Ga0466972_0067352 | Ga0466972_0067352_1038_1517 | 157 |
| 202 | 3300044684 | Ga0466966_0305262 | Ga0466966_0305262_224_742 | 157 |
| 203 | 3300044693 | Ga0466961_0630768 | Ga0466961_0630768_17_499 | 157 |
| 204 | 3300045049 | Ga0466959_0472246 | Ga0466959_0472246_334_816 | 157 |
| 205 | 3300045836 | Ga0466958_0811432 | Ga0466958_0811432_94_576 | 157 |
| 206 | 3300045976 | Ga0466967_0041373 | Ga0466967_0041373_2443_2922 | 157 |
| 207 | 3300046454 | Ga0495592_0007946 | Ga0495592_0007946_3364_3843 | 157 |
| 208 | 3300046459 | Ga0495629_0215613 | Ga0495629_0215613_636_1115 | 157 |
| 209 | 3300046462 | Ga0495651_0006431 | Ga0495651_0006431_559_1038 | 157 |
| 210 | 3300046463 | Ga0495653_0034029 | Ga0495653_0034029_2694_3173 | 157 |
| 211 | 3300046516 | Ga0495628_0002367 | Ga0495628_0002367_3386_3865 | 157 |
| 212 | 3300046529 | Ga0495652_0032660 | Ga0495652_0032660_3386_3865 | 157 |
| 213 | 3300046531 | Ga0495665_0003574 | Ga0495665_0003574_4207_4686 | 157 |
| 214 | 3300046536 | Ga0495587_0001445 | Ga0495587_0001445_14792_15271 | 157 |
| 215 | 3300046663 | Ga0495635_0101177 | Ga0495635_0101177_564_1043 | 157 |
| 216 | 3300046680 | Ga0495646_0022724 | Ga0495646_0022724_2532_3011 | 157 |
| 217 | 3300046689 | Ga0495613_0003206 | Ga0495613_0003206_6774_7253 | 157 |
| 218 | 3300046809 | Ga0495600_0024294 | Ga0495600_0024294_2734_3213 | 157 |
| 219 | 3300047315 | Ga0495581_0033515 | Ga0495581_0033515_2283_2762 | 157 |
| 220 | 3300047317 | Ga0495604_0000225 | Ga0495604_0000225_17524_18003 | 157 |
| 221 | 3300047444 | Ga0495675_0011554 | Ga0495675_0011554_2406_2885 | 157 |
| 222 | 3300047471 | Ga0495684_0025406 | Ga0495684_0025406_688_1167 | 157 |
| 223 | 3300048088 | Ga0495602_0046993 | Ga0495602_0046993_687_1166 | 157 |
| 224 | 3300048903 | Ga0496100_0000074 | Ga0496100_0000074_10378_10857 | 157 |
| 225 | 3300048904 | Ga0496101_0000017 | Ga0496101_0000017_6918_7397 | 157 |
| 226 | 3300048905 | Ga0496102_0221298 | Ga0496102_0221298_1117_1596 | 157 |
| 227 | 3300048905 | Ga0496102_0605612 | Ga0496102_0605612_262_741 | 157 |
| 228 | 3300048906 | Ga0496103_0002372 | Ga0496103_0002372_1038_1517 | 157 |
| 229 | 3300048909 | Ga0496106_0003417 | Ga0496106_0003417_8300_8779 | 157 |
| 230 | 3300048910 | Ga0496107_0000570 | Ga0496107_0000570_9695_10174 | 157 |
| 231 | 3300048912 | Ga0496109_0002454 | Ga0496109_0002454_4710_5189 | 157 |
| 232 | 3300048913 | Ga0496110_0004528 | Ga0496110_0004528_10189_10668 | 157 |
| 233 | 3300048914 | Ga0496111_0002248 | Ga0496111_0002248_10559_11038 | 157 |
| 234 | 3300048916 | Ga0496113_0375559 | Ga0496113_0375559_235_714 | 157 |
| 235 | 3300048917 | Ga0496114_0003459 | Ga0496114_0003459_1092_1571 | 157 |
| 236 | 3300048918 | Ga0496115_0185248 | Ga0496115_0185248_697_1176 | 157 |
| 237 | 3300048919 | Ga0496116_0020066 | Ga0496116_0020066_4516_4995 | 157 |
| 238 | 3300048919 | Ga0496116_0221956 | Ga0496116_0221956_394_873 | 157 |
| 239 | 3300048920 | Ga0496117_0183766 | Ga0496117_0183766_625_1104 | 157 |
| 240 | 3300048920 | Ga0496117_0316493 | Ga0496117_0316493_246_725 | 157 |
| 241 | 3300048921 | Ga0496118_0051116 | Ga0496118_0051116_2591_3070 | 157 |
| 242 | 3300048921 | Ga0496118_0051570 | Ga0496118_0051570_2573_3052 | 157 |
| 243 | 3300048922 | Ga0496119_0538440 | Ga0496119_0538440_19_498 | 157 |
| 244 | 3300048923 | Ga0496120_0060205 | Ga0496120_0060205_1227_1706 | 157 |
| 245 | 3300048923 | Ga0496120_0190831 | Ga0496120_0190831_137_634 | 157 |
| 246 | 3300048924 | Ga0496121_0000014 | Ga0496121_0000014_159399_159878 | 157 |
| 247 | 3300048925 | Ga0496122_0000097 | Ga0496122_0000097_159392_159871 | 157 |
| 248 | 3300048926 | Ga0496123_0003143 | Ga0496123_0003143_8111_8590 | 157 |
| 249 | 3300048927 | Ga0496124_0000019 | Ga0496124_0000019_159399_159878 | 157 |
| 250 | 3300048928 | Ga0496125_0000014 | Ga0496125_0000014_159399_159878 | 157 |
| 251 | 3300048929 | Ga0496126_0000017 | Ga0496126_0000017_450799_451278 | 157 |
| 252 | 3300048929 | Ga0496126_0000063 | Ga0496126_0000063_33600_34079 | 157 |
| 253 | 2162886007 | SwRhRL2b_contig_2365995 | SwRhRL2b_0786.00003340 | 158 |
| 254 | 2162886007 | SwRhRL2b_contig_297057 | SwRhRL2b_0803.00005040 | 158 |
| 255 | 3300005289 | Ga0065704_10004445 | Ga0065704_100044453 | 158 |
| 256 | 3300005289 | Ga0065704_10254268 | Ga0065704_102542681 | 158 |
| 257 | 3300005290 | Ga0065712_10067782 | Ga0065712_100677825 | 158 |
| 258 | 3300005293 | Ga0065715_10166022 | Ga0065715_101660221 | 158 |
| 259 | 3300005334 | Ga0068869_100399454 | Ga0068869_1003994542 | 158 |
| 260 | 3300005338 | Ga0068868_100684585 | Ga0068868_1006845852 | 158 |
| 261 | 3300005340 | Ga0070689_100031034 | Ga0070689_1000310345 | 158 |
| 262 | 3300005354 | Ga0070675_100163281 | Ga0070675_1001632812 | 158 |
| 263 | 3300005365 | Ga0070688_100027441 | Ga0070688_1000274413 | 158 |
| 264 | 3300005441 | Ga0070700_100403887 | Ga0070700_1004038872 | 158 |
| 265 | 3300005545 | Ga0070695_100435897 | Ga0070695_1004358972 | 158 |
| 266 | 3300005546 | Ga0070696_100033838 | Ga0070696_1000338383 | 158 |
| 267 | 3300005617 | Ga0068859_100050279 | Ga0068859_1000502793 | 158 |
| 268 | 3300005618 | Ga0068864_100401238 | Ga0068864_1004012382 | 158 |
| 269 | 3300005840 | Ga0068870_10033934 | Ga0068870_100339343 | 158 |
| 270 | 3300005841 | Ga0068863_100147694 | Ga0068863_1001476943 | 158 |
| 271 | 3300006844 | Ga0075428_100021725 | Ga0075428_1000217255 | 158 |
| 272 | 3300006846 | Ga0075430_100054892 | Ga0075430_1000548922 | 158 |
| 273 | 3300006852 | Ga0075433_10347966 | Ga0075433_103479663 | 158 |
| 274 | 3300006871 | Ga0075434_100030121 | Ga0075434_1000301217 | 158 |
| 275 | 3300006880 | Ga0075429_100016364 | Ga0075429_1000163644 | 158 |
| 276 | 3300006880 | Ga0075429_100120119 | Ga0075429_1001201192 | 158 |
| 277 | 3300006931 | Ga0097620_100050279 | Ga0097620_1000502795 | 158 |
| 278 | 3300009148 | Ga0105243_11867718 | Ga0105243_118677181 | 158 |
| 279 | 3300014745 | Ga0157377_10009729 | Ga0157377_100097294 | 158 |
| 280 | 3300015679 | Ga0183366_1001 | Ga0183366_10011341 | 158 |
| 281 | 3300015680 | Ga0183370_1001 | Ga0183370_10011341 | 158 |
| 282 | 3300015685 | Ga0183369_1001 | Ga0183369_10011341 | 158 |
| 283 | 3300015687 | Ga0183368_1001 | Ga0183368_10011341 | 158 |
| 284 | 3300025908 | Ga0207643_10110579 | Ga0207643_101105792 | 158 |
| 285 | 3300025917 | Ga0207660_11255178 | Ga0207660_112551781 | 158 |
| 286 | 3300025926 | Ga0207659_10095749 | Ga0207659_100957492 | 158 |
| 287 | 3300025936 | Ga0207670_10045615 | Ga0207670_100456153 | 158 |
| 288 | 3300025936 | Ga0207670_10481805 | Ga0207670_104818051 | 158 |
| 289 | 3300026023 | Ga0207677_10736099 | Ga0207677_107360992 | 158 |
| 290 | 3300026088 | Ga0207641_10063525 | Ga0207641_100635254 | 158 |
| 291 | 3300026089 | Ga0207648_10667587 | Ga0207648_106675872 | 158 |
| 292 | 3300026095 | Ga0207676_10293164 | Ga0207676_102931642 | 158 |
| 293 | 3300027907 | Ga0207428_10093627 | Ga0207428_100936273 | 158 |
| 294 | 3300031456 | Ga0307513_10001973 | Ga0307513_1000197317 | 158 |
| 295 | 3300042006 | Ga0439432_014512 | Ga0439432_014512_1289_1780 | 158 |
| 296 | 3300044658 | Ga0466972_0027078 | Ga0466972_0027078_205_720 | 158 |
| 297 | 3300044683 | Ga0466965_0001648 | Ga0466965_0001648_1831_2346 | 158 |
| 298 | 3300044901 | Ga0466960_0000219 | Ga0466960_0000219_13785_14300 | 158 |
| 299 | 3300047446 | Ga0495679_007128 | Ga0495679_007128_3232_3708 | 158 |
| 300 | 3300048912 | Ga0496109_0011341 | Ga0496109_0011341_2881_3390 | 158 |
| 301 | 3300048912 | Ga0496109_0761417 | Ga0496109_0761417_13_522 | 158 |
| 302 | 3300048913 | Ga0496110_0327563 | Ga0496110_0327563_289_798 | 158 |
| 303 | 3300048919 | Ga0496116_0179921 | Ga0496116_0179921_513_1004 | 158 |
| 304 | 3300048920 | Ga0496117_0137620 | Ga0496117_0137620_848_1339 | 158 |
| 305 | 3300048921 | Ga0496118_0074915 | Ga0496118_0074915_152_643 | 158 |
| 306 | 3300048922 | Ga0496119_0001654 | Ga0496119_0001654_15582_16133 | 158 |
| 307 | 3300048924 | Ga0496121_0000816 | Ga0496121_0000816_28873_29424 | 158 |
| 308 | 3300048925 | Ga0496122_0003253 | Ga0496122_0003253_7693_8244 | 158 |
| 309 | 3300048925 | Ga0496122_0062137 | Ga0496122_0062137_1211_1702 | 158 |
| 310 | 3300048925 | Ga0496122_0313390 | Ga0496122_0313390_119_610 | 158 |
| 311 | 3300048926 | Ga0496123_0032551 | Ga0496123_0032551_2924_3475 | 158 |
| 312 | 3300048926 | Ga0496123_0087897 | Ga0496123_0087897_1035_1526 | 158 |
| 313 | 3300048926 | Ga0496123_0099136 | Ga0496123_0099136_244_735 | 158 |
| 314 | 3300048927 | Ga0496124_0148029 | Ga0496124_0148029_20_511 | 158 |
| 315 | 3300048928 | Ga0496125_0000610 | Ga0496125_0000610_49758_50309 | 158 |
| 316 | 3300048928 | Ga0496125_0002824 | Ga0496125_0002824_133_624 | 158 |
| 317 | 3300048929 | Ga0496126_0145092 | Ga0496126_0145092_1420_1911 | 158 |
| 318 | 3300049576 | Ga0501040_0241016 | Ga0501040_0241016_487_1008 | 158 |
| 319 | 3300049577 | Ga0501041_0349141 | Ga0501041_0349141_286_807 | 158 |
| 320 | 3300050508 | nmdc:mga09592_35637_c1 | nmdc:mga09592_35637_c1_1648_2199 | 158 |
| 321 | 3300050515 | nmdc:mga0a205_333273_c1 | nmdc:mga0a205_333273_c1_47_556 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.897 | 5 | 151 |
| 2e8c-assembly1.cif.gz_A | crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 | 0.8745 | 5 | 156 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8692 | 4 | 155 |
| 2e8c-assembly1.cif.gz_A | crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 | 0.8685 | 5 | 156 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8635 | 4 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d7vB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.887 | 6 | 151 | 3.30.300.20 |
| 2egtA02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.882 | 58 | 156 | 3.30.300.20 |
| 2e8fA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8761 | 5 | 156 | 3.30.300.20 |
| 1lqlE02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8744 | 58 | 154 | 3.30.300.20 |
| 2e8fA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.87 | 5 | 156 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9IF92-F1-model_v4 | Peroxiredoxin | 0.9972 | 1 | 158 |
|
| AF-G1XXW0-F1-model_v4 | deleted | 0.9949 | 1 | 155 |
|
| AF-A0A7W4J7M2-F1-model_v4 | OsmC family peroxiredoxin | 0.9945 | 4 | 157 |
|
| AF-A0A4Q7KTA1-F1-model_v4 | Organic hydroperoxide reductase OsmC/OhrA | 0.9943 | 4 | 157 |
|
| AF-A0A6B1HMZ6-F1-model_v4 | deleted | 0.9939 | 4 | 155 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar