F405198

General Info

Members Datasets Scaffolds Average Seq Length
319 228 315 219

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0455250|Ga0451576_0455250_96_833
Length 245
Sequence MSGLAADATGFRRRGGTAMTTQVGTIALQLGSIAPDFEAETTEGRIRFHDWIGDSWAVLFSHPKDFTPVCTTELGYMARLKPEFDKRRTKVIGLSVDPVGNHAKWAEDIRETQGHAPNFPMIGDTTLAVSKLYGMLPADLDGTCDGRTAADNQTVRTVFIIGPDKKIKLMIAYPMTTGRNFDEVLRVIDSLQLTAAHKVSTPVNWKQGEDVIIAGSVSDDDARKTYPQGWKAPKPYLRIVPSPVR

Samples

Sample ID Description Type Environment
1 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
2 2922425934
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
185 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
205 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
206 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
228 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 2.52
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 0.94
Rhizoplane 1.25
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 2.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c001698 3300000043 Bacteria 2381
2 ARCol0yngRDRAFT_1003537 3300000652 Bacteria 1142
3 JGI25153J46596_10037586 3300003215 Bacteria 1537
4 Ga0055526_1022139 3300003771 Bacteria 2177
5 Ga0055537_1001383 3300003773 Bacteria 9678
6 Ga0055524_1010349 3300003775 Bacteria 3720
7 Ga0055528_1013409 3300003790 Bacteria 3103
8 Ga0055530_10004576 3300003791 Bacteria 7056
9 Ga0055531_10006977 3300003794 Bacteria 6277
10 Ga0055543_1014370 3300004625 Bacteria 1545
11 Ga0058859_11506652 3300004798 Bacteria 807
12 Ga0058860_12164246 3300004801 Bacteria 1549
13 Ga0058862_10110420 3300004803 Bacteria 764
14 Ga0065165_1001889 3300005262 Bacteria 20208
15 Ga0065704_10259066 3300005289 Bacteria 970
16 Ga0065712_10224837 3300005290 Bacteria 1029
17 Ga0065715_10351753 3300005293 Bacteria 950
18 Ga0065707_10147743 3300005295 Bacteria 1694
19 Ga0070683_100065661 3300005329 Bacteria 3379
20 Ga0070682_100484191 3300005337 Bacteria 955
21 Ga0070682_100701045 3300005337 Bacteria 812
22 Ga0070689_100367508 3300005340 Bacteria 1210
23 Ga0070691_10012704 3300005341 Bacteria 3858
24 Ga0070675_100070310 3300005354 Bacteria 2901
25 Ga0070674_100255296 3300005356 Bacteria 1379
26 Ga0070709_10002089 3300005434 Bacteria 10823
27 Ga0070711_100006394 3300005439 Bacteria 7103
28 Ga0070711_100220504 3300005439 Bacteria 1474
29 Ga0070705_100078339 3300005440 Bacteria 2021
30 Ga0070700_100174785 3300005441 Bacteria 1490
31 Ga0070694_100822584 3300005444 Bacteria 763
32 Ga0070708_100000102 3300005445 Bacteria 56306
33 Ga0070708_100071539 3300005445 Bacteria 3123
34 Ga0070708_100731166 3300005445 Bacteria 931
35 Ga0070662_100037331 3300005457 Bacteria 3445
36 Ga0070681_10125481 3300005458 Bacteria 2499
37 Ga0070681_10681412 3300005458 Bacteria 943
38 Ga0068867_100458510 3300005459 Bacteria 1088
39 Ga0070685_10633698 3300005466 Bacteria 773
40 Ga0070706_100837420 3300005467 Bacteria 851
41 Ga0070707_100075378 3300005468 Bacteria 3254
42 Ga0070707_100270521 3300005468 Bacteria 1652
43 Ga0070698_100070041 3300005471 Bacteria 3520
44 Ga0070698_100188281 3300005471 Bacteria 2001
45 Ga0070699_100171443 3300005518 Bacteria 1923
46 Ga0070684_100082690 3300005535 Bacteria 2843
47 Ga0070697_100071499 3300005536 Bacteria 2846
48 Ga0070672_100233803 3300005543 Bacteria 1545
49 Ga0070672_100822443 3300005543 Bacteria 818
50 Ga0070695_100001652 3300005545 Bacteria 12527
51 Ga0070695_100794650 3300005545 Bacteria 758
52 Ga0070696_100018372 3300005546 Bacteria 4724
53 Ga0070696_100031704 3300005546 Bacteria 3624
54 Ga0070696_100033515 3300005546 Bacteria 3529
55 Ga0070696_100048977 3300005546 Bacteria 2934
56 Ga0070696_100058831 3300005546 Bacteria 2685
57 Ga0070696_100063634 3300005546 Bacteria 2584
58 Ga0070665_100160401 3300005548 Bacteria 2251
59 Ga0070665_100586541 3300005548 Bacteria 1128
60 Ga0070704_100460236 3300005549 Bacteria 1097
61 Ga0068855_100570643 3300005563 Bacteria 1223
62 Ga0070664_100026190 3300005564 Bacteria 4836
63 Ga0070702_100784666 3300005615 Bacteria 735
64 Ga0068859_101183340 3300005617 Bacteria 842
65 Ga0068866_10307848 3300005718 Bacteria 992
66 Ga0068861_100123877 3300005719 Bacteria 2089
67 Ga0068863_100615079 3300005841 Bacteria 1076
68 Ga0068860_100767098 3300005843 Bacteria 977
69 Ga0081455_10024365 3300005937 Bacteria 5605
70 Ga0081455_10115604 3300005937 Bacteria 2123
71 Ga0081539_10001744 3300005985 Bacteria 34702
72 Ga0081539_10076771 3300005985 Bacteria 1769
73 Ga0097621_100049969 3300006237 Bacteria 3399
74 Ga0068871_100235374 3300006358 Bacteria 1591
75 Ga0068871_100236902 3300006358 Bacteria 1585
76 Ga0075428_100013930 3300006844 Bacteria 8954
77 Ga0075428_100184702 3300006844 Bacteria 2256
78 Ga0075430_100147485 3300006846 Bacteria 1959
79 Ga0075433_10010862 3300006852 Bacteria 7322
80 Ga0075433_10042289 3300006852 Bacteria 3953
81 Ga0075433_10171422 3300006852 Bacteria 1931
82 Ga0075433_10236339 3300006852 Bacteria 1622
83 Ga0075433_11048716 3300006852 Bacteria 710
84 Ga0075434_100003996 3300006871 Bacteria 13211
85 Ga0075434_100140256 3300006871 Bacteria 2437
86 Ga0075434_100562841 3300006871 Bacteria 1159
87 Ga0075429_100034088 3300006880 Bacteria 4423
88 Ga0075429_100046067 3300006880 Bacteria 3794
89 Ga0097620_101183502 3300006931 Bacteria 842
90 Ga0075435_100016593 3300007076 Bacteria 5554
91 Ga0099794_10324031 3300007265 Bacteria 800
92 Ga0105240_10270675 3300009093 Bacteria 1956
93 Ga0111539_10427797 3300009094 Bacteria 1542
94 Ga0105245_10001787 3300009098 Bacteria 19573
95 Ga0105245_10089912 3300009098 Bacteria 2823
96 Ga0114129_10002128 3300009147 Bacteria 27300
97 Ga0114129_10005778 3300009147 Bacteria 17518
98 Ga0114129_10011388 3300009147 Bacteria 12671
99 Ga0114129_10029009 3300009147 Bacteria 7837
100 Ga0114129_10091210 3300009147 Bacteria 4222
101 Ga0114129_10139086 3300009147 Bacteria 3330
102 Ga0114129_10618222 3300009147 Bacteria 1402
103 Ga0114129_10856897 3300009147 Bacteria 1155
104 Ga0105243_10611718 3300009148 Bacteria 1050
105 Ga0105248_10000016 3300009177 Bacteria 308151
106 Ga0105248_11066121 3300009177 Bacteria 913
107 Ga0105249_10000116 3300009553 Bacteria 108394
108 Ga0105249_10942542 3300009553 Bacteria 931
109 Ga0157372_10122089 3300013307 Bacteria 2993
110 Ga0157380_10142030 3300014326 Bacteria 2064
111 Ga0157377_10123445 3300014745 Bacteria 1572
112 Ga0157379_10006292 3300014968 Bacteria 10223
113 Ga0157376_10826156 3300014969 Bacteria 941
114 Ga0197907_10029402 3300020069 Bacteria 688
115 Ga0206351_10503546 3300020077 Bacteria 921
116 Ga0206350_10674049 3300020080 Bacteria 875
117 Ga0206350_11477388 3300020080 Bacteria 751
118 Ga0154015_1354629 3300020610 Bacteria 1287
119 Ga0213875_10008325 3300021388 Bacteria 5316
120 Ga0209026_1001794 3300025250 Bacteria 8878
121 Ga0209565_1000222 3300025263 Bacteria 63600
122 Ga0209673_1001079 3300025273 Bacteria 30757
123 Ga0209564_1012367 3300025295 Bacteria 3726
124 Ga0209758_1000424 3300025297 Bacteria 71558
125 Ga0209758_1001283 3300025297 Bacteria 30965
126 Ga0209050_1000169 3300025298 Bacteria 151269
127 Ga0209257_1000954 3300025304 Bacteria 39793
128 Ga0209257_1006257 3300025304 Bacteria 7786
129 Ga0207682_10030907 3300025893 Bacteria 2147
130 Ga0207710_10021657 3300025900 Bacteria 2756
131 Ga0207688_10003714 3300025901 Bacteria 8332
132 Ga0207699_10030710 3300025906 Bacteria 3009
133 Ga0207645_10386612 3300025907 Bacteria 940
134 Ga0207643_10466934 3300025908 Bacteria 804
135 Ga0207705_10000775 3300025909 Bacteria 26277
136 Ga0207705_10564786 3300025909 Bacteria 885
137 Ga0207663_10140425 3300025916 Bacteria 1682
138 Ga0207660_10077317 3300025917 Bacteria 2436
139 Ga0207657_10045030 3300025919 Bacteria 3875
140 Ga0207652_10167234 3300025921 Bacteria 1972
141 Ga0207652_10228300 3300025921 Bacteria 1678
142 Ga0207646_10055059 3300025922 Bacteria 3558
143 Ga0207646_10081355 3300025922 Bacteria 2896
144 Ga0207687_10050614 3300025927 Bacteria 2892
145 Ga0207690_10000197 3300025932 Bacteria 47054
146 Ga0207690_10023013 3300025932 Bacteria 3884
147 Ga0207706_10104048 3300025933 Bacteria 2498
148 Ga0207686_10486172 3300025934 Bacteria 955
149 Ga0207709_10076985 3300025935 Bacteria 2137
150 Ga0207669_10262663 3300025937 Bacteria 1292
151 Ga0207665_10082554 3300025939 Bacteria 2215
152 Ga0207691_10108681 3300025940 Bacteria 2468
153 Ga0207711_10000022 3300025941 Bacteria 340441
154 Ga0207711_10075021 3300025941 Bacteria 2943
155 Ga0207689_10144433 3300025942 Bacteria 1960
156 Ga0207661_10968797 3300025944 Bacteria 783
157 Ga0207712_10000380 3300025961 Bacteria 38956
158 Ga0207640_10864102 3300025981 Bacteria 788
159 Ga0207658_10643709 3300025986 Bacteria 955
160 Ga0207677_10115503 3300026023 Bacteria 2008
161 Ga0207639_10036908 3300026041 Bacteria 3626
162 Ga0207708_10484875 3300026075 Bacteria 1034
163 Ga0207641_10923984 3300026088 Bacteria 867
164 Ga0207648_10540334 3300026089 Bacteria 1070
165 Ga0207674_10193950 3300026116 Bacteria 1981
166 Ga0207675_100136870 3300026118 Bacteria 2325
167 Ga0209998_10019822 3300027717 Bacteria 1435
168 Ga0207428_10000511 3300027907 Bacteria 46384
169 Ga0307408_100137222 3300031548 Bacteria 1915
170 Ga0307408_100198991 3300031548 Bacteria 1620
171 Ga0307516_10020602 3300031730 Bacteria 6810
172 Ga0307405_10018535 3300031731 Bacteria 3842
173 Ga0307407_10236337 3300031903 Bacteria 1244
174 Ga0307412_10068034 3300031911 Bacteria 2420
175 Ga0307416_100033492 3300032002 Bacteria 3895
176 Ga0307416_100167769 3300032002 Bacteria 2039
177 Ga0307414_10340506 3300032004 Bacteria 1284
178 Ga0307411_10365602 3300032005 Bacteria 1181
179 Ga0307411_10437920 3300032005 Bacteria 1090
180 Ga0307411_10602228 3300032005 Bacteria 945
181 Ga0307415_100065201 3300032126 Bacteria 2537
182 Ga0373957_0216081 3300035120 Bacteria 802
183 Ga0373946_0217598 3300035171 Bacteria 921
184 Ga0373931_0376413 3300035691 Bacteria 894
185 Ga0395900_0023022 3300037418 Bacteria 6376
186 Ga0395905_0102252 3300037471 Bacteria 2690
187 Ga0395901_0024557 3300038443 Bacteria 6189
188 Ga0436360_0154460 3300039438 Unclassified 1790
189 Ga0436361_0138250 3300039447 Bacteria 2162
190 Ga0436361_0235908 3300039447 Bacteria 1502
191 Ga0436361_0977160 3300039447 Unclassified 1644
192 Ga0436363_0901702 3300039450 Bacteria 2718
193 Ga0436362_0719061 3300039453 Bacteria 858
194 Ga0439439_0066888 3300041406 Bacteria 959
195 Ga0439453_0037042 3300041408 Bacteria 945
196 Ga0451577_0156961 3300042876 Bacteria 2048
197 Ga0466963_0294329 3300044694 Bacteria 1141
198 Ga0451576_0045377 3300045051 Bacteria 4629
199 Ga0451576_0455250 3300045051 Bacteria 1344
200 Ga0466967_0042699 3300045976 Bacteria 3920
201 Ga0466967_1303390 3300045976 Bacteria 723
202 Ga0495580_0003137 3300046472 Bacteria 14161
203 Ga0495582_0009207 3300046473 Bacteria 5446
204 Ga0495584_0018873 3300046491 Bacteria 3504
205 Ga0495596_0123313 3300046500 Bacteria 1006
206 Ga0495616_0101191 3300046513 Bacteria 1351
207 Ga0495620_0027181 3300046515 Bacteria 2681
208 Ga0495630_0682856 3300046517 Bacteria 786
209 Ga0495632_0005020 3300046519 Bacteria 8863
210 Ga0495643_0012153 3300046522 Bacteria 5204
211 Ga0495663_0011201 3300046525 Bacteria 2496
212 Ga0495666_0051587 3300046526 Bacteria 1976
213 Ga0495654_0000039 3300046530 Bacteria 185363
214 Ga0495665_0236724 3300046531 Bacteria 942
215 Ga0495633_0119799 3300046558 Bacteria 1219
216 Ga0495667_0127909 3300046559 Bacteria 1639
217 Ga0495625_0006847 3300046660 Bacteria 10067
218 Ga0495625_0012148 3300046660 Bacteria 6987
219 Ga0495635_0035539 3300046663 Bacteria 3455
220 Ga0495659_0081918 3300046664 Bacteria 1226
221 Ga0495658_0001871 3300046683 Bacteria 10742
222 Ga0495658_0051061 3300046683 Bacteria 2342
223 Ga0495658_0206083 3300046683 Bacteria 1227
224 Ga0495669_0030086 3300046684 Bacteria 2383
225 Ga0495613_0458202 3300046689 Bacteria 863
226 Ga0495624_0024561 3300046690 Bacteria 3964
227 Ga0495670_0000006 3300046691 Bacteria 255322
228 Ga0495649_0006923 3300046694 Bacteria 7010
229 Ga0495660_0097398 3300046810 Bacteria 1519
230 Ga0495672_0000266 3300047320 Bacteria 72321
231 Ga0495676_0096626 3300047321 Bacteria 2196
232 Ga0495677_0088278 3300047445 Bacteria 1167
233 Ga0496102_0065798 3300048905 Bacteria 3323
234 Ga0496104_0225536 3300048907 Bacteria 1786
235 Ga0496112_0165443 3300048915 Bacteria 2178
236 Ga0496115_0004584 3300048918 Bacteria 10010
237 Ga0501292_013577 3300049515 Bacteria 1254
238 Ga0501298_080466 3300049521 Bacteria 716
239 Ga0501034_0009339 3300049571 Bacteria 10276
240 Ga0501034_0012048 3300049571 Bacteria 8938
241 Ga0501036_0030398 3300049572 Bacteria 4563
242 Ga0501036_0242868 3300049572 Bacteria 1510
243 Ga0501036_1072894 3300049572 Bacteria 658
244 Ga0501038_0315115 3300049574 Bacteria 1225
245 Ga0501039_0004346 3300049575 Bacteria 10686
246 Ga0501040_0139849 3300049576 Bacteria 1705
247 Ga0501040_0146367 3300049576 Bacteria 1665
248 Ga0501041_0050641 3300049577 Bacteria 2531
249 Ga0501047_0155567 3300049581 Bacteria 2160
250 Ga0501067_0000944 3300049583 Bacteria 15589
251 Ga0501067_0020665 3300049583 Bacteria 3643
252 Ga0501068_0002282 3300049584 Bacteria 10210
253 Ga0501068_0006224 3300049584 Bacteria 6563
254 Ga0501068_0160780 3300049584 Bacteria 1415
255 Ga0501069_0000347 3300049585 Bacteria 20913
256 Ga0501069_0007368 3300049585 Bacteria 5772
257 Ga0501070_0001721 3300049586 Bacteria 19353
258 Ga0501070_0018094 3300049586 Bacteria 5911
259 Ga0501070_0452366 3300049586 Bacteria 1035
260 Ga0501071_0002765 3300049587 Bacteria 10773
261 Ga0501071_0019917 3300049587 Bacteria 4659
262 Ga0501071_0198093 3300049587 Bacteria 1508
263 Ga0501071_0230125 3300049587 Bacteria 1396
264 Ga0501071_0305558 3300049587 Bacteria 1206
265 Ga0501072_0084432 3300049588 Bacteria 2518
266 Ga0501073_0001399 3300049589 Bacteria 17801
267 Ga0501073_0053516 3300049589 Bacteria 2825
268 Ga0501074_0000748 3300049590 Bacteria 20422
269 Ga0501074_0004256 3300049590 Bacteria 10221
270 Ga0501075_0034941 3300049591 Bacteria 3746
271 Ga0501075_0586809 3300049591 Bacteria 850
272 Ga0501076_0012207 3300049592 Bacteria 6423
273 Ga0501076_0030968 3300049592 Bacteria 4169
274 Ga0501076_0281921 3300049592 Bacteria 1361
275 Ga0501076_0702392 3300049592 Bacteria 835
276 Ga0501077_0010657 3300049593 Bacteria 5723
277 Ga0501217_050414 3300049661 Bacteria 1086
278 Ga0501236_030259 3300049670 Bacteria 853
279 Ga0501261_018865 3300049690 Bacteria 976
280 Ga0501079_0095142 3300049741 Bacteria 2308
281 Ga0501080_0028632 3300049742 Bacteria 5185
282 Ga0501080_0934742 3300049742 Bacteria 754
283 Ga0501083_0002135 3300049744 Bacteria 13570
284 Ga0501083_0009593 3300049744 Bacteria 6838
285 Ga0501045_0209343 3300049824 Bacteria 1453
286 nmdc:mga05p37_10005_c1 3300050507 Bacteria 11262
287 nmdc:mga05p37_109351_c1 3300050507 Bacteria 3401
288 nmdc:mga05p37_109712_c1 3300050507 Bacteria 3395
289 nmdc:mga05p37_142300_c1 3300050507 Bacteria 2938
290 nmdc:mga05p37_247159_c1 3300050507 Bacteria 2141
291 nmdc:mga05p37_42090_c1 3300050507 Bacteria 5611
292 nmdc:mga05p37_614274_c1 3300050507 Bacteria 1225
293 nmdc:mga09592_96295_c1 3300050508 Bacteria 2531
294 nmdc:mga0qj67_58016_c1 3300050509 Bacteria 3069
295 nmdc:mga06r32_235712_c1 3300050510 Bacteria 1817
296 nmdc:mga08y16_140970_c1 3300050511 Bacteria 2506
297 nmdc:mga08y16_674547_c1 3300050511 Bacteria 1036
298 nmdc:mga0n895_20326_c1 3300050512 Bacteria 6190
299 nmdc:mga0n895_325779_c1 3300050512 Bacteria 1557
300 nmdc:mga0rr50_17561_c1 3300050513 Bacteria 4780
301 nmdc:mga08x19_213218_c1 3300050514 Bacteria 1326
302 nmdc:mga0a205_279279_c1 3300050515 Bacteria 1546
303 nmdc:mga0a205_2904_c1 3300050515 Bacteria 15159
304 nmdc:mga0a205_35336_c1 3300050515 Bacteria 4798
305 nmdc:mga0a205_430038_c1 3300050515 Bacteria 1182
306 Ga0495601_0294546 3300053077 Bacteria 1057
307 Ga0500627_0088927 3300053158 Bacteria 1381
308 Ga0500645_020053 3300053730 Bacteria 2074
309 Ga0501084_0000590 3300054114 Bacteria 27782
310 Ga0501084_0006361 3300054114 Bacteria 9700
311 Ga0590077_025026 3300059426 Bacteria 1284
312 Ga0501082_0006041 3300060353 Bacteria 10506
313 Ga0501082_0014675 3300060353 Bacteria 6750
314 Ga0530510_0261977 3300061734 Bacteria 1289
315 Ga0530510_0387801 3300061734 Bacteria 1052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_1072894 Ga0501036_1072894_25_558 176
2 3300025908 Ga0207643_10466934 Ga0207643_104669342 200
3 3300049571 Ga0501034_0009339 Ga0501034_0009339_8668_9297 208
4 3300049571 Ga0501034_0012048 Ga0501034_0012048_5054_5683 208
5 3300049581 Ga0501047_0155567 Ga0501047_0155567_629_1258 208
6 3300049583 Ga0501067_0000944 Ga0501067_0000944_11930_12559 208
7 3300049583 Ga0501067_0020665 Ga0501067_0020665_338_967 208
8 3300049584 Ga0501068_0002282 Ga0501068_0002282_9524_10153 208
9 3300049584 Ga0501068_0006224 Ga0501068_0006224_2847_3476 208
10 3300049585 Ga0501069_0000347 Ga0501069_0000347_13449_14078 208
11 3300049585 Ga0501069_0007368 Ga0501069_0007368_1074_1703 208
12 3300049586 Ga0501070_0001721 Ga0501070_0001721_5054_5683 208
13 3300049586 Ga0501070_0018094 Ga0501070_0018094_1992_2621 208
14 3300049586 Ga0501070_0452366 Ga0501070_0452366_365_994 208
15 3300049587 Ga0501071_0002765 Ga0501071_0002765_6712_7341 208
16 3300049587 Ga0501071_0019917 Ga0501071_0019917_1116_1745 208
17 3300049587 Ga0501071_0198093 Ga0501071_0198093_138_767 208
18 3300049588 Ga0501072_0084432 Ga0501072_0084432_48_677 208
19 3300049589 Ga0501073_0001399 Ga0501073_0001399_17033_17662 208
20 3300049589 Ga0501073_0053516 Ga0501073_0053516_544_1173 208
21 3300049590 Ga0501074_0000748 Ga0501074_0000748_13269_13898 208
22 3300049590 Ga0501074_0004256 Ga0501074_0004256_9336_9965 208
23 3300049592 Ga0501076_0030968 Ga0501076_0030968_3019_3648 208
24 3300049742 Ga0501080_0028632 Ga0501080_0028632_929_1558 208
25 3300049742 Ga0501080_0934742 Ga0501080_0934742_49_678 208
26 3300049744 Ga0501083_0002135 Ga0501083_0002135_8666_9295 208
27 3300049744 Ga0501083_0009593 Ga0501083_0009593_146_775 208
28 3300054114 Ga0501084_0000590 Ga0501084_0000590_13885_14514 208
29 3300054114 Ga0501084_0006361 Ga0501084_0006361_4893_5522 208
30 3300060353 Ga0501082_0014675 Ga0501082_0014675_3126_3755 208
31 3300005548 Ga0070665_100160401 Ga0070665_1001604012 209
32 3300005718 Ga0068866_10307848 Ga0068866_103078482 209
33 3300009098 Ga0105245_10089912 Ga0105245_100899122 209
34 3300026089 Ga0207648_10540334 Ga0207648_105403342 209
35 3300039447 Ga0436361_0235908 Ga0436361_0235908_246_887 209
36 3300039453 Ga0436362_0719061 Ga0436362_0719061_78_713 209
37 3300005289 Ga0065704_10259066 Ga0065704_102590661 214
38 3300009553 Ga0105249_10000116 Ga0105249_1000011636 214
39 3300014968 Ga0157379_10006292 Ga0157379_100062926 214
40 3300025961 Ga0207712_10000380 Ga0207712_1000038034 214
41 3300035171 Ga0373946_0217598 Ga0373946_0217598_223_876 214
42 iso_pu_bacteria 2791355197 2793071864 214
43 iso_pu_bacteria 2922425934 2922429086 214
44 iso_pu_bacteria 8019555841 8019557834 214
45 iso_pu_bacteria 8019565922 8019567460 214
46 3300046522 Ga0495643_0012153 Ga0495643_0012153_1624_2277 216
47 3300046694 Ga0495649_0006923 Ga0495649_0006923_4696_5349 216
48 3300032005 Ga0307411_10437920 Ga0307411_104379201 217
49 3300046500 Ga0495596_0123313 Ga0495596_0123313_272_925 217
50 3300049521 Ga0501298_080466 Ga0501298_080466_33_689 217
51 3300000043 ARcpr5yngRDRAFT_c001698 ARcpr5yngRDRAFT_0016984 218
52 3300000652 ARCol0yngRDRAFT_1003537 ARCol0yngRDRAFT_10035372 218
53 3300003215 JGI25153J46596_10037586 JGI25153J46596_100375862 218
54 3300003771 Ga0055526_1022139 Ga0055526_10221392 218
55 3300003773 Ga0055537_1001383 Ga0055537_10013838 218
56 3300003775 Ga0055524_1010349 Ga0055524_10103492 218
57 3300003790 Ga0055528_1013409 Ga0055528_10134093 218
58 3300003791 Ga0055530_10004576 Ga0055530_100045765 218
59 3300003794 Ga0055531_10006977 Ga0055531_100069776 218
60 3300004625 Ga0055543_1014370 Ga0055543_10143702 218
61 3300004798 Ga0058859_11506652 Ga0058859_115066521 218
62 3300004801 Ga0058860_12164246 Ga0058860_121642461 218
63 3300004803 Ga0058862_10110420 Ga0058862_101104201 218
64 3300005262 Ga0065165_1001889 Ga0065165_10018892 218
65 3300005290 Ga0065712_10224837 Ga0065712_102248371 218
66 3300005293 Ga0065715_10351753 Ga0065715_103517531 218
67 3300005295 Ga0065707_10147743 Ga0065707_101477432 218
68 3300005329 Ga0070683_100065661 Ga0070683_1000656612 218
69 3300005337 Ga0070682_100484191 Ga0070682_1004841911 218
70 3300005337 Ga0070682_100701045 Ga0070682_1007010451 218
71 3300005340 Ga0070689_100367508 Ga0070689_1003675082 218
72 3300005341 Ga0070691_10012704 Ga0070691_100127042 218
73 3300005354 Ga0070675_100070310 Ga0070675_1000703102 218
74 3300005356 Ga0070674_100255296 Ga0070674_1002552962 218
75 3300005434 Ga0070709_10002089 Ga0070709_100020894 218
76 3300005439 Ga0070711_100006394 Ga0070711_1000063946 218
77 3300005439 Ga0070711_100220504 Ga0070711_1002205041 218
78 3300005440 Ga0070705_100078339 Ga0070705_1000783392 218
79 3300005441 Ga0070700_100174785 Ga0070700_1001747851 218
80 3300005444 Ga0070694_100822584 Ga0070694_1008225841 218
81 3300005445 Ga0070708_100000102 Ga0070708_10000010225 218
82 3300005445 Ga0070708_100071539 Ga0070708_1000715393 218
83 3300005445 Ga0070708_100731166 Ga0070708_1007311661 218
84 3300005457 Ga0070662_100037331 Ga0070662_1000373312 218
85 3300005458 Ga0070681_10125481 Ga0070681_101254812 218
86 3300005458 Ga0070681_10681412 Ga0070681_106814121 218
87 3300005459 Ga0068867_100458510 Ga0068867_1004585102 218
88 3300005466 Ga0070685_10633698 Ga0070685_106336981 218
89 3300005467 Ga0070706_100837420 Ga0070706_1008374201 218
90 3300005468 Ga0070707_100075378 Ga0070707_1000753784 218
91 3300005468 Ga0070707_100270521 Ga0070707_1002705212 218
92 3300005471 Ga0070698_100070041 Ga0070698_1000700414 218
93 3300005471 Ga0070698_100188281 Ga0070698_1001882812 218
94 3300005518 Ga0070699_100171443 Ga0070699_1001714432 218
95 3300005535 Ga0070684_100082690 Ga0070684_1000826903 218
96 3300005536 Ga0070697_100071499 Ga0070697_1000714992 218
97 3300005543 Ga0070672_100233803 Ga0070672_1002338032 218
98 3300005543 Ga0070672_100822443 Ga0070672_1008224431 218
99 3300005545 Ga0070695_100001652 Ga0070695_1000016528 218
100 3300005545 Ga0070695_100794650 Ga0070695_1007946501 218
101 3300005546 Ga0070696_100018372 Ga0070696_1000183724 218
102 3300005546 Ga0070696_100031704 Ga0070696_1000317043 218
103 3300005546 Ga0070696_100033515 Ga0070696_1000335153 218
104 3300005546 Ga0070696_100048977 Ga0070696_1000489775 218
105 3300005546 Ga0070696_100058831 Ga0070696_1000588312 218
106 3300005546 Ga0070696_100063634 Ga0070696_1000636343 218
107 3300005548 Ga0070665_100586541 Ga0070665_1005865412 218
108 3300005549 Ga0070704_100460236 Ga0070704_1004602362 218
109 3300005563 Ga0068855_100570643 Ga0068855_1005706431 218
110 3300005564 Ga0070664_100026190 Ga0070664_1000261902 218
111 3300005615 Ga0070702_100784666 Ga0070702_1007846661 218
112 3300005617 Ga0068859_101183340 Ga0068859_1011833401 218
113 3300005719 Ga0068861_100123877 Ga0068861_1001238772 218
114 3300005841 Ga0068863_100615079 Ga0068863_1006150792 218
115 3300005843 Ga0068860_100767098 Ga0068860_1007670982 218
116 3300005937 Ga0081455_10024365 Ga0081455_100243655 218
117 3300005937 Ga0081455_10115604 Ga0081455_101156043 218
118 3300005985 Ga0081539_10001744 Ga0081539_100017446 218
119 3300005985 Ga0081539_10076771 Ga0081539_100767712 218
120 3300006237 Ga0097621_100049969 Ga0097621_1000499693 218
121 3300006358 Ga0068871_100235374 Ga0068871_1002353742 218
122 3300006358 Ga0068871_100236902 Ga0068871_1002369022 218
123 3300006844 Ga0075428_100013930 Ga0075428_1000139302 218
124 3300006844 Ga0075428_100184702 Ga0075428_1001847021 218
125 3300006846 Ga0075430_100147485 Ga0075430_1001474851 218
126 3300006852 Ga0075433_10010862 Ga0075433_100108622 218
127 3300006852 Ga0075433_10042289 Ga0075433_100422894 218
128 3300006852 Ga0075433_10171422 Ga0075433_101714222 218
129 3300006852 Ga0075433_10236339 Ga0075433_102363392 218
130 3300006852 Ga0075433_11048716 Ga0075433_110487161 218
131 3300006871 Ga0075434_100003996 Ga0075434_10000399612 218
132 3300006871 Ga0075434_100140256 Ga0075434_1001402562 218
133 3300006871 Ga0075434_100562841 Ga0075434_1005628412 218
134 3300006880 Ga0075429_100034088 Ga0075429_1000340884 218
135 3300006880 Ga0075429_100046067 Ga0075429_1000460675 218
136 3300006931 Ga0097620_101183502 Ga0097620_1011835021 218
137 3300007076 Ga0075435_100016593 Ga0075435_1000165934 218
138 3300007265 Ga0099794_10324031 Ga0099794_103240311 218
139 3300009093 Ga0105240_10270675 Ga0105240_102706752 218
140 3300009094 Ga0111539_10427797 Ga0111539_104277972 218
141 3300009098 Ga0105245_10001787 Ga0105245_100017874 218
142 3300009147 Ga0114129_10002128 Ga0114129_1000212824 218
143 3300009147 Ga0114129_10005778 Ga0114129_100057784 218
144 3300009147 Ga0114129_10011388 Ga0114129_100113886 218
145 3300009147 Ga0114129_10029009 Ga0114129_100290096 218
146 3300009147 Ga0114129_10091210 Ga0114129_100912105 218
147 3300009147 Ga0114129_10139086 Ga0114129_101390864 218
148 3300009147 Ga0114129_10618222 Ga0114129_106182222 218
149 3300009147 Ga0114129_10856897 Ga0114129_108568971 218
150 3300009148 Ga0105243_10611718 Ga0105243_106117181 218
151 3300009177 Ga0105248_10000016 Ga0105248_10000016296 218
152 3300009177 Ga0105248_11066121 Ga0105248_110661211 218
153 3300009553 Ga0105249_10942542 Ga0105249_109425421 218
154 3300013307 Ga0157372_10122089 Ga0157372_101220893 218
155 3300014326 Ga0157380_10142030 Ga0157380_101420302 218
156 3300014745 Ga0157377_10123445 Ga0157377_101234452 218
157 3300014969 Ga0157376_10826156 Ga0157376_108261561 218
158 3300020069 Ga0197907_10029402 Ga0197907_100294021 218
159 3300020077 Ga0206351_10503546 Ga0206351_105035462 218
160 3300020080 Ga0206350_10674049 Ga0206350_106740491 218
161 3300020080 Ga0206350_11477388 Ga0206350_114773881 218
162 3300020610 Ga0154015_1354629 Ga0154015_13546292 218
163 3300021388 Ga0213875_10008325 Ga0213875_100083253 218
164 3300025250 Ga0209026_1001794 Ga0209026_10017943 218
165 3300025263 Ga0209565_1000222 Ga0209565_10002223 218
166 3300025273 Ga0209673_1001079 Ga0209673_10010793 218
167 3300025295 Ga0209564_1012367 Ga0209564_10123673 218
168 3300025297 Ga0209758_1000424 Ga0209758_100042462 218
169 3300025297 Ga0209758_1001283 Ga0209758_100128328 218
170 3300025298 Ga0209050_1000169 Ga0209050_1000169143 218
171 3300025304 Ga0209257_1000954 Ga0209257_100095433 218
172 3300025304 Ga0209257_1006257 Ga0209257_10062571 218
173 3300025893 Ga0207682_10030907 Ga0207682_100309073 218
174 3300025900 Ga0207710_10021657 Ga0207710_100216574 218
175 3300025901 Ga0207688_10003714 Ga0207688_100037142 218
176 3300025906 Ga0207699_10030710 Ga0207699_100307103 218
177 3300025907 Ga0207645_10386612 Ga0207645_103866121 218
178 3300025909 Ga0207705_10000775 Ga0207705_1000077517 218
179 3300025909 Ga0207705_10564786 Ga0207705_105647861 218
180 3300025916 Ga0207663_10140425 Ga0207663_101404251 218
181 3300025917 Ga0207660_10077317 Ga0207660_100773174 218
182 3300025919 Ga0207657_10045030 Ga0207657_100450303 218
183 3300025921 Ga0207652_10167234 Ga0207652_101672342 218
184 3300025921 Ga0207652_10228300 Ga0207652_102283002 218
185 3300025922 Ga0207646_10055059 Ga0207646_100550594 218
186 3300025922 Ga0207646_10081355 Ga0207646_100813553 218
187 3300025927 Ga0207687_10050614 Ga0207687_100506142 218
188 3300025932 Ga0207690_10000197 Ga0207690_1000019732 218
189 3300025932 Ga0207690_10023013 Ga0207690_100230133 218
190 3300025933 Ga0207706_10104048 Ga0207706_101040483 218
191 3300025934 Ga0207686_10486172 Ga0207686_104861722 218
192 3300025935 Ga0207709_10076985 Ga0207709_100769852 218
193 3300025937 Ga0207669_10262663 Ga0207669_102626631 218
194 3300025939 Ga0207665_10082554 Ga0207665_100825543 218
195 3300025940 Ga0207691_10108681 Ga0207691_101086812 218
196 3300025941 Ga0207711_10000022 Ga0207711_10000022292 218
197 3300025941 Ga0207711_10075021 Ga0207711_100750213 218
198 3300025942 Ga0207689_10144433 Ga0207689_101444332 218
199 3300025944 Ga0207661_10968797 Ga0207661_109687971 218
200 3300025981 Ga0207640_10864102 Ga0207640_108641021 218
201 3300025986 Ga0207658_10643709 Ga0207658_106437091 218
202 3300026023 Ga0207677_10115503 Ga0207677_101155032 218
203 3300026041 Ga0207639_10036908 Ga0207639_100369082 218
204 3300026075 Ga0207708_10484875 Ga0207708_104848751 218
205 3300026088 Ga0207641_10923984 Ga0207641_109239841 218
206 3300026116 Ga0207674_10193950 Ga0207674_101939502 218
207 3300026118 Ga0207675_100136870 Ga0207675_1001368702 218
208 3300027717 Ga0209998_10019822 Ga0209998_100198222 218
209 3300027907 Ga0207428_10000511 Ga0207428_1000051146 218
210 3300031548 Ga0307408_100137222 Ga0307408_1001372222 218
211 3300031548 Ga0307408_100198991 Ga0307408_1001989912 218
212 3300031730 Ga0307516_10020602 Ga0307516_100206026 218
213 3300031731 Ga0307405_10018535 Ga0307405_100185352 218
214 3300031903 Ga0307407_10236337 Ga0307407_102363372 218
215 3300031911 Ga0307412_10068034 Ga0307412_100680343 218
216 3300032002 Ga0307416_100033492 Ga0307416_1000334922 218
217 3300032002 Ga0307416_100167769 Ga0307416_1001677692 218
218 3300032004 Ga0307414_10340506 Ga0307414_103405062 218
219 3300032005 Ga0307411_10365602 Ga0307411_103656021 218
220 3300032005 Ga0307411_10602228 Ga0307411_106022282 218
221 3300032126 Ga0307415_100065201 Ga0307415_1000652013 218
222 3300035120 Ga0373957_0216081 Ga0373957_0216081_58_750 218
223 3300035691 Ga0373931_0376413 Ga0373931_0376413_122_835 218
224 3300037418 Ga0395900_0023022 Ga0395900_0023022_2454_3110 218
225 3300037471 Ga0395905_0102252 Ga0395905_0102252_950_1606 218
226 3300038443 Ga0395901_0024557 Ga0395901_0024557_179_835 218
227 3300039438 Ga0436360_0154460 Ga0436360_0154460_295_954 218
228 3300039447 Ga0436361_0138250 Ga0436361_0138250_216_872 218
229 3300039447 Ga0436361_0977160 Ga0436361_0977160_911_1570 218
230 3300039450 Ga0436363_0901702 Ga0436363_0901702_840_1499 218
231 3300041406 Ga0439439_0066888 Ga0439439_0066888_163_822 218
232 3300041408 Ga0439453_0037042 Ga0439453_0037042_125_787 218
233 3300042876 Ga0451577_0156961 Ga0451577_0156961_691_1362 218
234 3300044694 Ga0466963_0294329 Ga0466963_0294329_51_737 218
235 3300045051 Ga0451576_0045377 Ga0451576_0045377_1012_1695 218
236 3300045051 Ga0451576_0455250 Ga0451576_0455250_96_833 218
237 3300045976 Ga0466967_0042699 Ga0466967_0042699_2604_3260 218
238 3300045976 Ga0466967_1303390 Ga0466967_1303390_20_682 218
239 3300046472 Ga0495580_0003137 Ga0495580_0003137_8486_9151 218
240 3300046473 Ga0495582_0009207 Ga0495582_0009207_3015_3680 218
241 3300046491 Ga0495584_0018873 Ga0495584_0018873_39_698 218
242 3300046513 Ga0495616_0101191 Ga0495616_0101191_265_924 218
243 3300046515 Ga0495620_0027181 Ga0495620_0027181_74_733 218
244 3300046517 Ga0495630_0682856 Ga0495630_0682856_85_741 218
245 3300046519 Ga0495632_0005020 Ga0495632_0005020_5075_5734 218
246 3300046525 Ga0495663_0011201 Ga0495663_0011201_1337_1996 218
247 3300046526 Ga0495666_0051587 Ga0495666_0051587_206_898 218
248 3300046530 Ga0495654_0000039 Ga0495654_0000039_147723_148382 218
249 3300046531 Ga0495665_0236724 Ga0495665_0236724_71_736 218
250 3300046558 Ga0495633_0119799 Ga0495633_0119799_484_1149 218
251 3300046559 Ga0495667_0127909 Ga0495667_0127909_331_987 218
252 3300046660 Ga0495625_0006847 Ga0495625_0006847_487_1188 218
253 3300046660 Ga0495625_0012148 Ga0495625_0012148_5224_5883 218
254 3300046663 Ga0495635_0035539 Ga0495635_0035539_450_1106 218
255 3300046664 Ga0495659_0081918 Ga0495659_0081918_499_1179 218
256 3300046683 Ga0495658_0001871 Ga0495658_0001871_8410_9075 218
257 3300046683 Ga0495658_0051061 Ga0495658_0051061_98_754 218
258 3300046683 Ga0495658_0206083 Ga0495658_0206083_353_1012 218
259 3300046684 Ga0495669_0030086 Ga0495669_0030086_1498_2163 218
260 3300046689 Ga0495613_0458202 Ga0495613_0458202_70_735 218
261 3300046690 Ga0495624_0024561 Ga0495624_0024561_2707_3363 218
262 3300046691 Ga0495670_0000006 Ga0495670_0000006_118506_119165 218
263 3300046810 Ga0495660_0097398 Ga0495660_0097398_295_954 218
264 3300047320 Ga0495672_0000266 Ga0495672_0000266_30388_31047 218
265 3300047321 Ga0495676_0096626 Ga0495676_0096626_1291_1947 218
266 3300047445 Ga0495677_0088278 Ga0495677_0088278_405_1064 218
267 3300048905 Ga0496102_0065798 Ga0496102_0065798_2267_2944 218
268 3300048907 Ga0496104_0225536 Ga0496104_0225536_1004_1669 218
269 3300048915 Ga0496112_0165443 Ga0496112_0165443_386_1063 218
270 3300048918 Ga0496115_0004584 Ga0496115_0004584_126_785 218
271 3300049515 Ga0501292_013577 Ga0501292_013577_304_966 218
272 3300049572 Ga0501036_0030398 Ga0501036_0030398_1268_1933 218
273 3300049572 Ga0501036_0242868 Ga0501036_0242868_274_936 218
274 3300049574 Ga0501038_0315115 Ga0501038_0315115_547_1203 218
275 3300049575 Ga0501039_0004346 Ga0501039_0004346_7123_7779 218
276 3300049576 Ga0501040_0139849 Ga0501040_0139849_366_1028 218
277 3300049576 Ga0501040_0146367 Ga0501040_0146367_928_1593 218
278 3300049577 Ga0501041_0050641 Ga0501041_0050641_1139_1795 218
279 3300049584 Ga0501068_0160780 Ga0501068_0160780_381_1037 218
280 3300049587 Ga0501071_0230125 Ga0501071_0230125_217_879 218
281 3300049587 Ga0501071_0305558 Ga0501071_0305558_372_1037 218
282 3300049591 Ga0501075_0034941 Ga0501075_0034941_1631_2296 218
283 3300049591 Ga0501075_0586809 Ga0501075_0586809_92_748 218
284 3300049592 Ga0501076_0012207 Ga0501076_0012207_1784_2440 218
285 3300049592 Ga0501076_0281921 Ga0501076_0281921_231_896 218
286 3300049592 Ga0501076_0702392 Ga0501076_0702392_72_734 218
287 3300049593 Ga0501077_0010657 Ga0501077_0010657_2927_3583 218
288 3300049661 Ga0501217_050414 Ga0501217_050414_163_825 218
289 3300049670 Ga0501236_030259 Ga0501236_030259_46_708 218
290 3300049690 Ga0501261_018865 Ga0501261_018865_157_819 218
291 3300049741 Ga0501079_0095142 Ga0501079_0095142_1180_1836 218
292 3300049824 Ga0501045_0209343 Ga0501045_0209343_18_677 218
293 3300050507 nmdc:mga05p37_10005_c1 nmdc:mga05p37_10005_c1_6343_7005 218
294 3300050507 nmdc:mga05p37_109351_c1 nmdc:mga05p37_109351_c1_344_1006 218
295 3300050507 nmdc:mga05p37_109712_c1 nmdc:mga05p37_109712_c1_2073_2735 218
296 3300050507 nmdc:mga05p37_142300_c1 nmdc:mga05p37_142300_c1_1464_2177 218
297 3300050507 nmdc:mga05p37_247159_c1 nmdc:mga05p37_247159_c1_124_786 218
298 3300050507 nmdc:mga05p37_42090_c1 nmdc:mga05p37_42090_c1_4830_5492 218
299 3300050507 nmdc:mga05p37_614274_c1 nmdc:mga05p37_614274_c1_110_772 218
300 3300050508 nmdc:mga09592_96295_c1 nmdc:mga09592_96295_c1_1823_2488 218
301 3300050509 nmdc:mga0qj67_58016_c1 nmdc:mga0qj67_58016_c1_1960_2622 218
302 3300050510 nmdc:mga06r32_235712_c1 nmdc:mga06r32_235712_c1_461_1123 218
303 3300050511 nmdc:mga08y16_140970_c1 nmdc:mga08y16_140970_c1_922_1590 218
304 3300050511 nmdc:mga08y16_674547_c1 nmdc:mga08y16_674547_c1_366_1022 218
305 3300050512 nmdc:mga0n895_20326_c1 nmdc:mga0n895_20326_c1_2561_3223 218
306 3300050512 nmdc:mga0n895_325779_c1 nmdc:mga0n895_325779_c1_820_1485 218
307 3300050513 nmdc:mga0rr50_17561_c1 nmdc:mga0rr50_17561_c1_731_1396 218
308 3300050514 nmdc:mga08x19_213218_c1 nmdc:mga08x19_213218_c1_24_719 218
309 3300050515 nmdc:mga0a205_279279_c1 nmdc:mga0a205_279279_c1_187_849 218
310 3300050515 nmdc:mga0a205_2904_c1 nmdc:mga0a205_2904_c1_8554_9216 218
311 3300050515 nmdc:mga0a205_35336_c1 nmdc:mga0a205_35336_c1_2146_2808 218
312 3300050515 nmdc:mga0a205_430038_c1 nmdc:mga0a205_430038_c1_73_738 218
313 3300053077 Ga0495601_0294546 Ga0495601_0294546_103_759 218
314 3300053158 Ga0500627_0088927 Ga0500627_0088927_519_1178 218
315 3300053730 Ga0500645_020053 Ga0500645_020053_1398_2057 218
316 3300059426 Ga0590077_025026 Ga0590077_025026_425_1087 218
317 3300060353 Ga0501082_0006041 Ga0501082_0006041_7686_8351 218
318 3300061734 Ga0530510_0261977 Ga0530510_0261977_73_735 218
319 3300061734 Ga0530510_0387801 Ga0530510_0387801_358_1023 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

30

170

0.96

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

190

229

0.96

PF08534

Redoxin

Redoxin

29

188

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9537 3 218
6p0w-assembly1.cif.gz_A-2 lsfa from p. aeruginosa, a 1-cys prx in reduced form 0.9446 3 218
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9441 3 218
7kuu-assembly1.cif.gz_B lsfa from p. aeruginosa, a 1-cys prx in sulfonic acid form 0.9395 3 218
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.9308 3 215
ID Description Score Start End Superfamily
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9529 5 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.9444 155 217 3.30.1020.10
af_P34227_199_260_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.934 155 215 3.30.1020.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9267 5 106 3.40.30.10
af_Q54SE2_176_239_3.30.1020.10 Alpha Beta;2-Layer Sandwich;Antioxidant, Horf6; Chain A, domain 2;Antioxidant, Horf6; Chain A, domain2 0.917 155 217 3.30.1020.10
ID Description Score Start End GO Terms
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9825 1 184 GO:0005829
GO:0045454
GO:0051920
AF-A0A534YD48-F1-model_v4 Peroxiredoxin 0.9772 1 184 GO:0005829
GO:0045454
GO:0051920
AF-A0A659YRX5-F1-model_v4 deleted 0.9762 1 103
AF-A0A3D2S068-F1-model_v4 Peroxidase 0.9749 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A2V5ZNJ6-F1-model_v4 Peroxidase 0.9735 3 94 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Feature Viewer

pLDDT pTM Quality
91.25 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map