F404374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 239 | 262 | 257 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2751185821|2753463786 |
| Length | 315 |
| Sequence | PTPSGDRTALFEFLQRLGDNALILGHRLSEWCGHAPALEEDIALANTALDLIGQTQLWLGLAGEVEGKGRSADDLAYLRDATEFRNVLLVERPNGDFGKTLLRQLLFDAWHLLLLQALRSSADKRIADIAEKASKEVAYHLDRSRDLVVRLGDGTAESHRRMQEALDELWPYTGELFIGDPADAELAAAGIAPTPERLKAAWDEVVGATLAAATLKKPADGYMHQGGKRGVHTEHIGFILAEMXELAAAGIAPAPERLKAAWDEVVGATLAAATLKKPADGYMHQGGKRGVHTEHIGFILAEMQFLQRAYPGATW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 3 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 4 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 5 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 6 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 7 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 8 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 9 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 10 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 11 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 12 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 13 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 14 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 15 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 16 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 17 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 18 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 19 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 20 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 21 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 22 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 23 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 24 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 25 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 26 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 27 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 28 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 29 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 30 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 31 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 32 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 33 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 34 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 35 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 36 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 37 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 38 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 39 | 2941479691 | |||
| 40 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 41 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 42 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 43 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 44 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 45 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 46 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 47 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 50 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 51 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 52 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 53 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 54 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 55 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 56 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 60 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 61 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 63 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 104 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 111 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 112 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 164 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 173 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 176 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 177 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 180 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 191 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 192 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 193 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 194 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 195 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 196 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 197 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 198 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 199 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 200 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 221 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 222 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 223 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 225 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 226 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 227 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 228 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 231 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 232 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 233 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 234 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 235 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 236 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 237 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 238 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 239 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.65 |
| Metatranscriptomes | 0 |
| Isolates | 17.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.87 |
| Nodule | 9.15 |
| Rhizoplane | 2.21 |
| Rhizosphere | 49.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10029556 | 3300001979 | Bacteria | 1798 |
| 2 | JGI24740J21852_10050565 | 3300001979 | Bacteria | 1195 |
| 3 | JGI25155J39150_1000020 | 3300002704 | Bacteria | 152963 |
| 4 | JGI25156J39149_1000021 | 3300002705 | Bacteria | 152968 |
| 5 | JGI25162J39368_1000476 | 3300002737 | Bacteria | 30796 |
| 6 | JGI25162J39368_1001403 | 3300002737 | Bacteria | 13139 |
| 7 | JGI25154J39366_1000039 | 3300002738 | Bacteria | 152972 |
| 8 | JGI25157J39369_1000019 | 3300002741 | Bacteria | 176591 |
| 9 | JGI25151J46595_10001702 | 3300003187 | Bacteria | 14367 |
| 10 | JGI25151J46595_10008247 | 3300003187 | Bacteria | 5025 |
| 11 | JGI25165J46597_1000068 | 3300003214 | Bacteria | 196201 |
| 12 | JGI25165J46597_1000537 | 3300003214 | Bacteria | 35164 |
| 13 | rootH2_10183881 | 3300003320 | Bacteria | 2258 |
| 14 | rootH1_10034734 | 3300003323 | Bacteria | 8289 |
| 15 | Ga0055526_1000303 | 3300003771 | Bacteria | 41129 |
| 16 | Ga0055526_1003505 | 3300003771 | Bacteria | 9921 |
| 17 | Ga0055526_1003534 | 3300003771 | Bacteria | 9868 |
| 18 | Ga0055526_1009070 | 3300003771 | Bacteria | 4853 |
| 19 | Ga0055526_1027977 | 3300003771 | Bacteria | 1721 |
| 20 | Ga0055537_1001681 | 3300003773 | Bacteria | 8205 |
| 21 | Ga0055524_1000402 | 3300003775 | Bacteria | 36997 |
| 22 | Ga0055524_1007404 | 3300003775 | Bacteria | 4667 |
| 23 | Ga0055536_1000158 | 3300003781 | Bacteria | 58733 |
| 24 | Ga0055534_1001061 | 3300003784 | Bacteria | 11910 |
| 25 | Ga0055534_1002288 | 3300003784 | Bacteria | 6729 |
| 26 | Ga0055528_1012178 | 3300003790 | Bacteria | 3357 |
| 27 | Ga0055540_1011084 | 3300003792 | Bacteria | 2942 |
| 28 | Ga0055540_1013851 | 3300003792 | Bacteria | 2440 |
| 29 | Ga0070668_100004039 | 3300005347 | Bacteria | 10856 |
| 30 | Ga0070669_100115447 | 3300005353 | Bacteria | 2042 |
| 31 | Ga0070671_100052708 | 3300005355 | Bacteria | 3382 |
| 32 | Ga0070674_100015723 | 3300005356 | Bacteria | 4731 |
| 33 | Ga0070659_100197446 | 3300005366 | Bacteria | 1655 |
| 34 | Ga0070667_100697888 | 3300005367 | Bacteria | 939 |
| 35 | Ga0070708_100183818 | 3300005445 | Bacteria | 1954 |
| 36 | Ga0070662_100052590 | 3300005457 | Bacteria | 2945 |
| 37 | Ga0068867_100068824 | 3300005459 | Bacteria | 2642 |
| 38 | Ga0070685_10081811 | 3300005466 | Bacteria | 1937 |
| 39 | Ga0070706_100094354 | 3300005467 | Bacteria | 2776 |
| 40 | Ga0070706_100498370 | 3300005467 | Bacteria | 1133 |
| 41 | Ga0070699_100060494 | 3300005518 | Bacteria | 3282 |
| 42 | Ga0070684_100130627 | 3300005535 | Bacteria | 2266 |
| 43 | Ga0070697_100003615 | 3300005536 | Bacteria | 11874 |
| 44 | Ga0070697_100102065 | 3300005536 | Bacteria | 2383 |
| 45 | Ga0070672_100036184 | 3300005543 | Bacteria | 3759 |
| 46 | Ga0068856_100168599 | 3300005614 | Bacteria | 2201 |
| 47 | Ga0068861_100008169 | 3300005719 | Bacteria | 7202 |
| 48 | Ga0068862_100003804 | 3300005844 | Bacteria | 12855 |
| 49 | Ga0081539_10000161 | 3300005985 | Bacteria | 156560 |
| 50 | Ga0081539_10043493 | 3300005985 | Bacteria | 2603 |
| 51 | Ga0070717_10297326 | 3300006028 | Unclassified | 1435 |
| 52 | Ga0075365_10000188 | 3300006038 | Bacteria | 20119 |
| 53 | Ga0075363_100099552 | 3300006048 | Bacteria | 1608 |
| 54 | Ga0075362_10211394 | 3300006177 | Bacteria | 946 |
| 55 | Ga0075367_10000065 | 3300006178 | Bacteria | 26310 |
| 56 | Ga0075369_10000260 | 3300006186 | Bacteria | 15573 |
| 57 | Ga0075369_10068110 | 3300006186 | Bacteria | 1564 |
| 58 | Ga0075428_100001020 | 3300006844 | Bacteria | 29707 |
| 59 | Ga0075428_100001300 | 3300006844 | Bacteria | 26505 |
| 60 | Ga0075428_100055322 | 3300006844 | Bacteria | 4347 |
| 61 | Ga0075428_100079542 | 3300006844 | Bacteria | 3578 |
| 62 | Ga0075428_100340080 | 3300006844 | Bacteria | 1612 |
| 63 | Ga0075430_100054711 | 3300006846 | Bacteria | 3357 |
| 64 | Ga0075431_100003294 | 3300006847 | Bacteria | 15634 |
| 65 | Ga0075431_100026802 | 3300006847 | Bacteria | 5911 |
| 66 | Ga0075431_100028431 | 3300006847 | Bacteria | 5746 |
| 67 | Ga0075431_100042473 | 3300006847 | Bacteria | 4690 |
| 68 | Ga0075431_100384633 | 3300006847 | Unclassified | 1407 |
| 69 | Ga0075433_10008299 | 3300006852 | Bacteria | 8280 |
| 70 | Ga0075434_100021659 | 3300006871 | Bacteria | 6250 |
| 71 | Ga0075429_100007787 | 3300006880 | Bacteria | 9304 |
| 72 | Ga0075429_100352965 | 3300006880 | Bacteria | 1287 |
| 73 | Ga0075435_100218526 | 3300007076 | Bacteria | 1618 |
| 74 | Ga0105250_10071593 | 3300009092 | Bacteria | 1400 |
| 75 | Ga0105240_10896138 | 3300009093 | Bacteria | 955 |
| 76 | Ga0111539_10000794 | 3300009094 | Bacteria | 41122 |
| 77 | Ga0111539_10017029 | 3300009094 | Bacteria | 8996 |
| 78 | Ga0111539_10239524 | 3300009094 | Bacteria | 2112 |
| 79 | Ga0114129_10030299 | 3300009147 | Bacteria | 7658 |
| 80 | Ga0105241_10034715 | 3300009174 | Bacteria | 3791 |
| 81 | Ga0105248_10070539 | 3300009177 | Bacteria | 3924 |
| 82 | Ga0105237_10015412 | 3300009545 | Bacteria | 7956 |
| 83 | Ga0105238_10138129 | 3300009551 | Bacteria | 2415 |
| 84 | Ga0123340_1051829 | 3300009763 | Bacteria | 1457 |
| 85 | Ga0123341_1070096 | 3300009765 | Bacteria | 1541 |
| 86 | Ga0105239_10072890 | 3300010375 | Bacteria | 3776 |
| 87 | Ga0157378_10024511 | 3300013297 | Bacteria | 5310 |
| 88 | Ga0157378_10806229 | 3300013297 | Bacteria | 965 |
| 89 | Ga0157375_10649068 | 3300013308 | Bacteria | 1212 |
| 90 | Ga0163163_10223043 | 3300014325 | Bacteria | 1934 |
| 91 | Ga0163161_10097801 | 3300017792 | Bacteria | 2180 |
| 92 | Ga0214544_1000029 | 3300021320 | Bacteria | 153924 |
| 93 | Ga0214542_1000092 | 3300021321 | Bacteria | 117288 |
| 94 | Ga0214543_1000045 | 3300021327 | Bacteria | 152699 |
| 95 | Ga0213874_10038515 | 3300021377 | Bacteria | 1419 |
| 96 | Ga0213871_10000788 | 3300021441 | Bacteria | 4716 |
| 97 | Ga0209435_100025 | 3300025206 | Bacteria | 198776 |
| 98 | Ga0209672_106674 | 3300025228 | Bacteria | 1852 |
| 99 | Ga0209437_100023 | 3300025233 | Bacteria | 614195 |
| 100 | Ga0209437_100067 | 3300025233 | Bacteria | 317685 |
| 101 | Ga0209646_1000083 | 3300025246 | Bacteria | 198777 |
| 102 | Ga0209026_1000078 | 3300025250 | Bacteria | 198777 |
| 103 | Ga0209759_1000060 | 3300025256 | Bacteria | 198777 |
| 104 | Ga0209759_1020250 | 3300025256 | Bacteria | 1549 |
| 105 | Ga0209129_1004779 | 3300025258 | Bacteria | 5121 |
| 106 | Ga0209233_1000088 | 3300025261 | Bacteria | 317980 |
| 107 | Ga0209233_1000219 | 3300025261 | Bacteria | 104797 |
| 108 | Ga0209565_1000104 | 3300025263 | Bacteria | 124432 |
| 109 | Ga0209455_1002241 | 3300025272 | Bacteria | 7607 |
| 110 | Ga0209673_1036273 | 3300025273 | Bacteria | 1465 |
| 111 | Ga0209675_1000065 | 3300025291 | Bacteria | 174791 |
| 112 | Ga0209675_1004119 | 3300025291 | Bacteria | 6607 |
| 113 | Ga0209676_1000044 | 3300025292 | Bacteria | 416215 |
| 114 | Ga0209025_1000147 | 3300025294 | Bacteria | 180008 |
| 115 | Ga0209025_1021183 | 3300025294 | Bacteria | 3514 |
| 116 | Ga0209025_1035598 | 3300025294 | Bacteria | 2246 |
| 117 | Ga0209564_1000080 | 3300025295 | Bacteria | 263547 |
| 118 | Ga0209564_1000253 | 3300025295 | Bacteria | 114335 |
| 119 | Ga0209564_1000923 | 3300025295 | Bacteria | 38212 |
| 120 | Ga0209758_1015455 | 3300025297 | Bacteria | 3948 |
| 121 | Ga0209758_1032847 | 3300025297 | Bacteria | 2098 |
| 122 | Ga0209256_1000543 | 3300025299 | Bacteria | 54373 |
| 123 | Ga0207426_1001794 | 3300025302 | Bacteria | 16028 |
| 124 | Ga0209051_1000909 | 3300025303 | Bacteria | 29436 |
| 125 | Ga0209051_1001539 | 3300025303 | Bacteria | 19182 |
| 126 | Ga0209051_1013339 | 3300025303 | Bacteria | 3918 |
| 127 | Ga0207682_10070472 | 3300025893 | Bacteria | 1480 |
| 128 | Ga0207645_10003256 | 3300025907 | Bacteria | 12402 |
| 129 | Ga0207684_10164571 | 3300025910 | Unclassified | 1911 |
| 130 | Ga0207654_10018301 | 3300025911 | Bacteria | 3674 |
| 131 | Ga0207671_10079601 | 3300025914 | Bacteria | 2455 |
| 132 | Ga0207660_10064013 | 3300025917 | Bacteria | 2653 |
| 133 | Ga0207646_10016503 | 3300025922 | Bacteria | 6930 |
| 134 | Ga0207681_10046901 | 3300025923 | Bacteria | 2907 |
| 135 | Ga0207644_10102252 | 3300025931 | Bacteria | 2155 |
| 136 | Ga0207690_10162532 | 3300025932 | Bacteria | 1666 |
| 137 | Ga0207706_10001508 | 3300025933 | Bacteria | 23112 |
| 138 | Ga0207704_10068501 | 3300025938 | Bacteria | 2237 |
| 139 | Ga0207691_10002454 | 3300025940 | Bacteria | 18133 |
| 140 | Ga0207639_10001641 | 3300026041 | Bacteria | 15068 |
| 141 | Ga0207708_10056553 | 3300026075 | Bacteria | 2993 |
| 142 | Ga0207708_10355321 | 3300026075 | Bacteria | 1203 |
| 143 | Ga0207702_10018453 | 3300026078 | Bacteria | 5772 |
| 144 | Ga0207702_10403034 | 3300026078 | Bacteria | 1319 |
| 145 | Ga0207648_10003102 | 3300026089 | Bacteria | 17547 |
| 146 | Ga0207675_100000205 | 3300026118 | Bacteria | 54926 |
| 147 | Ga0207683_10110322 | 3300026121 | Bacteria | 2463 |
| 148 | Ga0209982_1007004 | 3300027552 | Bacteria | 1647 |
| 149 | Ga0210002_1001501 | 3300027617 | Bacteria | 3303 |
| 150 | Ga0209983_1000057 | 3300027665 | Bacteria | 16946 |
| 151 | Ga0209971_1003992 | 3300027682 | Bacteria | 3488 |
| 152 | Ga0209966_1011181 | 3300027695 | Bacteria | 1632 |
| 153 | Ga0209998_10000641 | 3300027717 | Bacteria | 9378 |
| 154 | Ga0209974_10002031 | 3300027876 | Bacteria | 7395 |
| 155 | Ga0207428_10009790 | 3300027907 | Bacteria | 8587 |
| 156 | Ga0207428_10024731 | 3300027907 | Bacteria | 5040 |
| 157 | Ga0307515_10007099 | 3300028794 | Bacteria | 22248 |
| 158 | Ga0307515_10055819 | 3300028794 | Bacteria | 5759 |
| 159 | Ga0268256_1001086 | 3300030500 | Bacteria | 17888 |
| 160 | Ga0307513_10042369 | 3300031456 | Bacteria | 5013 |
| 161 | Ga0307513_10104416 | 3300031456 | Bacteria | 2847 |
| 162 | Ga0307509_10000189 | 3300031507 | Bacteria | 96946 |
| 163 | Ga0307408_100088432 | 3300031548 | Bacteria | 2333 |
| 164 | Ga0307410_10157125 | 3300031852 | Bacteria | 1700 |
| 165 | Ga0373937_0592053 | 3300036401 | Bacteria | 1053 |
| 166 | Ga0436364_0630663 | 3300037853 | Bacteria | 1105 |
| 167 | Ga0436364_0820266 | 3300037853 | Bacteria | 1495 |
| 168 | Ga0436365_0387253 | 3300039437 | Bacteria | 1277 |
| 169 | Ga0436365_0746130 | 3300039437 | Bacteria | 3400 |
| 170 | Ga0436365_1074806 | 3300039437 | Bacteria | 1009 |
| 171 | Ga0436365_1199995 | 3300039437 | Bacteria | 1234 |
| 172 | Ga0436360_1109844 | 3300039438 | Bacteria | 2176 |
| 173 | Ga0436360_1309412 | 3300039438 | Bacteria | 8677 |
| 174 | Ga0436361_0304034 | 3300039447 | Bacteria | 5566 |
| 175 | Ga0436362_0267176 | 3300039453 | Bacteria | 3681 |
| 176 | Ga0439442_045074 | 3300042002 | Bacteria | 929 |
| 177 | Ga0439449_0017489 | 3300042007 | Bacteria | 2693 |
| 178 | Ga0450914_003291 | 3300042118 | Bacteria | 1231 |
| 179 | Ga0450896_006783 | 3300042133 | Bacteria | 1573 |
| 180 | Ga0466972_0020808 | 3300044658 | Bacteria | 3276 |
| 181 | Ga0466966_0122023 | 3300044684 | Bacteria | 1600 |
| 182 | Ga0466970_0000741 | 3300044765 | Bacteria | 15890 |
| 183 | Ga0466957_0002063 | 3300044842 | Bacteria | 10743 |
| 184 | Ga0466958_0031809 | 3300045836 | Bacteria | 3136 |
| 185 | Ga0495638_0042622 | 3300046460 | Bacteria | 2866 |
| 186 | Ga0495650_0003612 | 3300046471 | Bacteria | 11145 |
| 187 | Ga0495672_0021416 | 3300047320 | Bacteria | 4217 |
| 188 | Ga0496105_0181334 | 3300048908 | Bacteria | 1724 |
| 189 | Ga0496108_0478840 | 3300048911 | Bacteria | 1088 |
| 190 | Ga0496109_0179539 | 3300048912 | Bacteria | 1988 |
| 191 | Ga0496110_0315266 | 3300048913 | Bacteria | 1424 |
| 192 | Ga0496111_0268394 | 3300048914 | Bacteria | 1266 |
| 193 | Ga0496116_0015097 | 3300048919 | Bacteria | 6123 |
| 194 | Ga0496117_0056329 | 3300048920 | Bacteria | 2739 |
| 195 | Ga0496119_0002271 | 3300048922 | Bacteria | 21345 |
| 196 | Ga0496119_0022631 | 3300048922 | Bacteria | 4490 |
| 197 | Ga0496120_0019298 | 3300048923 | Bacteria | 4365 |
| 198 | Ga0496120_0066204 | 3300048923 | Bacteria | 1999 |
| 199 | Ga0496120_0104267 | 3300048923 | Bacteria | 1493 |
| 200 | Ga0496121_0001430 | 3300048924 | Bacteria | 40317 |
| 201 | Ga0496121_0232427 | 3300048924 | Bacteria | 1290 |
| 202 | Ga0496122_0000484 | 3300048925 | Bacteria | 82756 |
| 203 | Ga0496122_0044052 | 3300048925 | Bacteria | 3488 |
| 204 | Ga0496122_0056012 | 3300048925 | Bacteria | 2944 |
| 205 | Ga0496123_0000641 | 3300048926 | Bacteria | 58369 |
| 206 | Ga0496124_0050942 | 3300048927 | Bacteria | 3524 |
| 207 | Ga0496124_0070659 | 3300048927 | Bacteria | 2895 |
| 208 | Ga0496124_0429446 | 3300048927 | Bacteria | 908 |
| 209 | Ga0496125_0000011 | 3300048928 | Bacteria | 655895 |
| 210 | Ga0496125_0053529 | 3300048928 | Bacteria | 3307 |
| 211 | Ga0496125_0073124 | 3300048928 | Bacteria | 2667 |
| 212 | Ga0496126_0162544 | 3300048929 | Bacteria | 1907 |
| 213 | Ga0501032_0358313 | 3300049569 | Bacteria | 939 |
| 214 | Ga0501033_0000942 | 3300049570 | Bacteria | 26447 |
| 215 | Ga0501033_0007581 | 3300049570 | Bacteria | 8441 |
| 216 | Ga0501033_0235885 | 3300049570 | Bacteria | 1298 |
| 217 | Ga0501033_0255414 | 3300049570 | Bacteria | 1241 |
| 218 | Ga0501034_0033987 | 3300049571 | Bacteria | 5170 |
| 219 | Ga0501034_0055343 | 3300049571 | Bacteria | 3992 |
| 220 | Ga0501034_0069214 | 3300049571 | Bacteria | 3540 |
| 221 | Ga0501034_0158480 | 3300049571 | Bacteria | 2236 |
| 222 | Ga0501034_0548817 | 3300049571 | Bacteria | 1065 |
| 223 | Ga0501037_0014354 | 3300049573 | Bacteria | 5833 |
| 224 | Ga0501037_0173239 | 3300049573 | Bacteria | 1533 |
| 225 | Ga0501037_0380840 | 3300049573 | Bacteria | 970 |
| 226 | Ga0501039_0121983 | 3300049575 | Bacteria | 2043 |
| 227 | Ga0501046_0030231 | 3300049580 | Bacteria | 4398 |
| 228 | Ga0501047_0001116 | 3300049581 | Bacteria | 26651 |
| 229 | Ga0501067_0047668 | 3300049583 | Bacteria | 2377 |
| 230 | Ga0501068_0005693 | 3300049584 | Bacteria | 6824 |
| 231 | Ga0501069_0138590 | 3300049585 | Bacteria | 1395 |
| 232 | Ga0501071_0022048 | 3300049587 | Bacteria | 4439 |
| 233 | Ga0501075_0464976 | 3300049591 | Bacteria | 965 |
| 234 | Ga0501035_0005194 | 3300049822 | Bacteria | 12317 |
| 235 | Ga0501035_0394965 | 3300049822 | Bacteria | 1151 |
| 236 | Ga0501044_0001409 | 3300049823 | Bacteria | 28201 |
| 237 | Ga0501044_0029505 | 3300049823 | Bacteria | 5783 |
| 238 | Ga0501044_0091922 | 3300049823 | Bacteria | 3060 |
| 239 | nmdc:mga05p37_44564_c1 | 3300050507 | Bacteria | 5457 |
| 240 | nmdc:mga09592_2703_c1 | 3300050508 | Bacteria | 14341 |
| 241 | nmdc:mga06r32_110_c1 | 3300050510 | Bacteria | 58239 |
| 242 | nmdc:mga06r32_111502_c1 | 3300050510 | Bacteria | 2692 |
| 243 | nmdc:mga06r32_348916_c1 | 3300050510 | Unclassified | 1464 |
| 244 | nmdc:mga06r32_36808_c1 | 3300050510 | Bacteria | 4627 |
| 245 | nmdc:mga08y16_330805_c1 | 3300050511 | Bacteria | 1567 |
| 246 | nmdc:mga08y16_332166_c1 | 3300050511 | Bacteria | 1563 |
| 247 | nmdc:mga08y16_3896_c1 | 3300050511 | Bacteria | 15538 |
| 248 | nmdc:mga0rr50_258855_c1 | 3300050513 | Bacteria | 1447 |
| 249 | nmdc:mga0a205_2569_c1 | 3300050515 | Bacteria | 16006 |
| 250 | nmdc:mga0sz30_158841_c1 | 3300050516 | Bacteria | 1001 |
| 251 | Ga0500651_0056619 | 3300053093 | Bacteria | 2455 |
| 252 | Ga0500617_067171 | 3300053124 | Bacteria | 1578 |
| 253 | Ga0500618_001473 | 3300053125 | Bacteria | 10423 |
| 254 | Ga0500568_0045499 | 3300053139 | Bacteria | 1746 |
| 255 | Ga0500568_0064809 | 3300053139 | Bacteria | 1407 |
| 256 | Ga0500588_0027121 | 3300053146 | Bacteria | 1610 |
| 257 | Ga0500604_0082790 | 3300053151 | Bacteria | 1039 |
| 258 | Ga0500622_0003800 | 3300053156 | Bacteria | 9830 |
| 259 | Ga0500622_0015374 | 3300053156 | Bacteria | 4098 |
| 260 | Ga0500622_0017572 | 3300053156 | Bacteria | 3807 |
| 261 | Ga0500627_0077470 | 3300053158 | Bacteria | 1479 |
| 262 | Ga0466962_0030014 | 3300061719 | Bacteria | 2603 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049585 | Ga0501069_0138590 | Ga0501069_0138590_29_688 | 215 |
| 2 | 3300025893 | Ga0207682_10070472 | Ga0207682_100704723 | 217 |
| 3 | 3300053093 | Ga0500651_0056619 | Ga0500651_0056619_594_1319 | 237 |
| 4 | 3300005347 | Ga0070668_100004039 | Ga0070668_1000040398 | 238 |
| 5 | 3300005356 | Ga0070674_100015723 | Ga0070674_1000157236 | 238 |
| 6 | 3300005459 | Ga0068867_100068824 | Ga0068867_1000688243 | 238 |
| 7 | 3300047320 | Ga0495672_0021416 | Ga0495672_0021416_687_1415 | 238 |
| 8 | 3300050510 | nmdc:mga06r32_36808_c1 | nmdc:mga06r32_36808_c1_1119_1847 | 238 |
| 9 | 3300013308 | Ga0157375_10649068 | Ga0157375_106490682 | 239 |
| 10 | 3300025933 | Ga0207706_10001508 | Ga0207706_100015088 | 239 |
| 11 | 3300006844 | Ga0075428_100001300 | Ga0075428_1000013006 | 241 |
| 12 | 3300006847 | Ga0075431_100003294 | Ga0075431_10000329413 | 241 |
| 13 | 3300006880 | Ga0075429_100007787 | Ga0075429_1000077876 | 241 |
| 14 | 3300009094 | Ga0111539_10000794 | Ga0111539_1000079417 | 241 |
| 15 | 3300009147 | Ga0114129_10030299 | Ga0114129_100302996 | 241 |
| 16 | 3300027907 | Ga0207428_10009790 | Ga0207428_100097905 | 241 |
| 17 | 3300027907 | Ga0207428_10024731 | Ga0207428_100247314 | 241 |
| 18 | 3300042118 | Ga0450914_003291 | Ga0450914_003291_430_1167 | 241 |
| 19 | 3300050507 | nmdc:mga05p37_44564_c1 | nmdc:mga05p37_44564_c1_4238_4975 | 241 |
| 20 | 3300050508 | nmdc:mga09592_2703_c1 | nmdc:mga09592_2703_c1_3631_4368 | 241 |
| 21 | 3300050510 | nmdc:mga06r32_110_c1 | nmdc:mga06r32_110_c1_34213_34950 | 241 |
| 22 | 3300050511 | nmdc:mga08y16_3896_c1 | nmdc:mga08y16_3896_c1_8694_9431 | 241 |
| 23 | 3300053158 | Ga0500627_0077470 | Ga0500627_0077470_497_1249 | 241 |
| 24 | 3300039437 | Ga0436365_1199995 | Ga0436365_1199995_481_1215 | 243 |
| 25 | 3300042002 | Ga0439442_045074 | Ga0439442_045074_44_787 | 243 |
| 26 | 3300053139 | Ga0500568_0045499 | Ga0500568_0045499_331_1086 | 243 |
| 27 | 3300053139 | Ga0500568_0064809 | Ga0500568_0064809_23_778 | 243 |
| 28 | 3300053151 | Ga0500604_0082790 | Ga0500604_0082790_191_946 | 243 |
| 29 | 3300006852 | Ga0075433_10008299 | Ga0075433_100082992 | 245 |
| 30 | 3300006871 | Ga0075434_100021659 | Ga0075434_1000216595 | 245 |
| 31 | 3300007076 | Ga0075435_100218526 | Ga0075435_1002185262 | 245 |
| 32 | 3300009094 | Ga0111539_10239524 | Ga0111539_102395242 | 245 |
| 33 | 3300046460 | Ga0495638_0042622 | Ga0495638_0042622_294_1064 | 245 |
| 34 | 3300049583 | Ga0501067_0047668 | Ga0501067_0047668_332_1081 | 245 |
| 35 | 3300049584 | Ga0501068_0005693 | Ga0501068_0005693_1077_1826 | 245 |
| 36 | 3300049587 | Ga0501071_0022048 | Ga0501071_0022048_367_1116 | 245 |
| 37 | 3300050511 | nmdc:mga08y16_330805_c1 | nmdc:mga08y16_330805_c1_411_1160 | 245 |
| 38 | 3300050513 | nmdc:mga0rr50_258855_c1 | nmdc:mga0rr50_258855_c1_86_835 | 245 |
| 39 | 3300050515 | nmdc:mga0a205_2569_c1 | nmdc:mga0a205_2569_c1_435_1184 | 245 |
| 40 | 3300026075 | Ga0207708_10355321 | Ga0207708_103553212 | 246 |
| 41 | 3300031507 | Ga0307509_10000189 | Ga0307509_100001898 | 246 |
| 42 | 3300053156 | Ga0500622_0015374 | Ga0500622_0015374_156_908 | 246 |
| 43 | iso_pu_bacteria | 2599185292 | 2599903416 | 246 |
| 44 | iso_pu_bacteria | 2643221621 | 2644122330 | 246 |
| 45 | iso_pu_bacteria | 2857537821 | 2857542633 | 246 |
| 46 | iso_pu_bacteria | 2858950400 | 2858955515 | 246 |
| 47 | iso_pu_bacteria | 2941479691 | 2941482181 | 246 |
| 48 | 3300049591 | Ga0501075_0464976 | Ga0501075_0464976_166_951 | 247 |
| 49 | 3300005366 | Ga0070659_100197446 | Ga0070659_1001974462 | 248 |
| 50 | 3300005535 | Ga0070684_100130627 | Ga0070684_1001306272 | 248 |
| 51 | 3300006847 | Ga0075431_100028431 | Ga0075431_1000284316 | 248 |
| 52 | 3300009174 | Ga0105241_10034715 | Ga0105241_100347153 | 248 |
| 53 | 3300009545 | Ga0105237_10015412 | Ga0105237_100154123 | 248 |
| 54 | 3300009551 | Ga0105238_10138129 | Ga0105238_101381291 | 248 |
| 55 | 3300010375 | Ga0105239_10072890 | Ga0105239_100728903 | 248 |
| 56 | 3300025911 | Ga0207654_10018301 | Ga0207654_100183013 | 248 |
| 57 | 3300025914 | Ga0207671_10079601 | Ga0207671_100796012 | 248 |
| 58 | 3300025932 | Ga0207690_10162532 | Ga0207690_101625322 | 248 |
| 59 | 3300026041 | Ga0207639_10001641 | Ga0207639_100016416 | 248 |
| 60 | 3300031548 | Ga0307408_100088432 | Ga0307408_1000884324 | 248 |
| 61 | 3300048927 | Ga0496124_0429446 | Ga0496124_0429446_80_862 | 248 |
| 62 | 3300049580 | Ga0501046_0030231 | Ga0501046_0030231_881_1666 | 248 |
| 63 | 3300053124 | Ga0500617_067171 | Ga0500617_067171_688_1473 | 248 |
| 64 | 3300053146 | Ga0500588_0027121 | Ga0500588_0027121_266_1051 | 248 |
| 65 | 3300053156 | Ga0500622_0003800 | Ga0500622_0003800_759_1541 | 248 |
| 66 | 3300053156 | Ga0500622_0017572 | Ga0500622_0017572_930_1712 | 248 |
| 67 | 3300005536 | Ga0070697_100003615 | Ga0070697_1000036158 | 249 |
| 68 | 3300003792 | Ga0055540_1013851 | Ga0055540_10138513 | 250 |
| 69 | 3300005466 | Ga0070685_10081811 | Ga0070685_100818113 | 250 |
| 70 | 3300025228 | Ga0209672_106674 | Ga0209672_1066743 | 250 |
| 71 | 3300025272 | Ga0209455_1002241 | Ga0209455_10022412 | 250 |
| 72 | 3300025303 | Ga0209051_1001539 | Ga0209051_100153911 | 250 |
| 73 | 3300042007 | Ga0439449_0017489 | Ga0439449_0017489_890_1645 | 250 |
| 74 | 3300048919 | Ga0496116_0015097 | Ga0496116_0015097_3890_4654 | 250 |
| 75 | 3300048920 | Ga0496117_0056329 | Ga0496117_0056329_88_852 | 250 |
| 76 | 3300048922 | Ga0496119_0002271 | Ga0496119_0002271_2452_3216 | 250 |
| 77 | 3300048924 | Ga0496121_0001430 | Ga0496121_0001430_7190_7954 | 250 |
| 78 | 3300048924 | Ga0496121_0232427 | Ga0496121_0232427_346_1110 | 250 |
| 79 | 3300048925 | Ga0496122_0000484 | Ga0496122_0000484_27624_28388 | 250 |
| 80 | 3300048925 | Ga0496122_0044052 | Ga0496122_0044052_1523_2287 | 250 |
| 81 | 3300048926 | Ga0496123_0000641 | Ga0496123_0000641_28078_28842 | 250 |
| 82 | 3300048927 | Ga0496124_0050942 | Ga0496124_0050942_2149_2913 | 250 |
| 83 | 3300048928 | Ga0496125_0000011 | Ga0496125_0000011_380600_381364 | 250 |
| 84 | 3300048928 | Ga0496125_0073124 | Ga0496125_0073124_141_905 | 250 |
| 85 | 3300048929 | Ga0496126_0162544 | Ga0496126_0162544_887_1651 | 250 |
| 86 | 3300003320 | rootH2_10183881 | rootH2_101838813 | 251 |
| 87 | 3300005353 | Ga0070669_100115447 | Ga0070669_1001154472 | 251 |
| 88 | 3300005457 | Ga0070662_100052590 | Ga0070662_1000525901 | 251 |
| 89 | 3300005543 | Ga0070672_100036184 | Ga0070672_1000361845 | 251 |
| 90 | 3300005719 | Ga0068861_100008169 | Ga0068861_1000081696 | 251 |
| 91 | 3300005844 | Ga0068862_100003804 | Ga0068862_10000380411 | 251 |
| 92 | 3300006844 | Ga0075428_100001020 | Ga0075428_10000102024 | 251 |
| 93 | 3300006844 | Ga0075428_100055322 | Ga0075428_1000553224 | 251 |
| 94 | 3300006846 | Ga0075430_100054711 | Ga0075430_1000547113 | 251 |
| 95 | 3300006847 | Ga0075431_100026802 | Ga0075431_1000268023 | 251 |
| 96 | 3300006847 | Ga0075431_100042473 | Ga0075431_1000424735 | 251 |
| 97 | 3300006847 | Ga0075431_100384633 | Ga0075431_1003846332 | 251 |
| 98 | 3300006880 | Ga0075429_100352965 | Ga0075429_1003529652 | 251 |
| 99 | 3300009094 | Ga0111539_10017029 | Ga0111539_100170295 | 251 |
| 100 | 3300025907 | Ga0207645_10003256 | Ga0207645_1000325611 | 251 |
| 101 | 3300025917 | Ga0207660_10064013 | Ga0207660_100640134 | 251 |
| 102 | 3300025923 | Ga0207681_10046901 | Ga0207681_100469012 | 251 |
| 103 | 3300025938 | Ga0207704_10068501 | Ga0207704_100685013 | 251 |
| 104 | 3300025940 | Ga0207691_10002454 | Ga0207691_1000245420 | 251 |
| 105 | 3300026075 | Ga0207708_10056553 | Ga0207708_100565534 | 251 |
| 106 | 3300026089 | Ga0207648_10003102 | Ga0207648_1000310212 | 251 |
| 107 | 3300026118 | Ga0207675_100000205 | Ga0207675_10000020536 | 251 |
| 108 | 3300027552 | Ga0209982_1007004 | Ga0209982_10070043 | 251 |
| 109 | 3300027617 | Ga0210002_1001501 | Ga0210002_10015012 | 251 |
| 110 | 3300027665 | Ga0209983_1000057 | Ga0209983_100005715 | 251 |
| 111 | 3300027682 | Ga0209971_1003992 | Ga0209971_10039923 | 251 |
| 112 | 3300027695 | Ga0209966_1011181 | Ga0209966_10111812 | 251 |
| 113 | 3300027717 | Ga0209998_10000641 | Ga0209998_100006415 | 251 |
| 114 | 3300027876 | Ga0209974_10002031 | Ga0209974_100020313 | 251 |
| 115 | 3300039437 | Ga0436365_0746130 | Ga0436365_0746130_1547_2311 | 251 |
| 116 | 3300039437 | Ga0436365_1074806 | Ga0436365_1074806_95_850 | 251 |
| 117 | 3300042133 | Ga0450896_006783 | Ga0450896_006783_412_1191 | 251 |
| 118 | 3300044658 | Ga0466972_0020808 | Ga0466972_0020808_1332_2162 | 251 |
| 119 | 3300049569 | Ga0501032_0358313 | Ga0501032_0358313_31_798 | 251 |
| 120 | 3300049570 | Ga0501033_0007581 | Ga0501033_0007581_2826_3593 | 251 |
| 121 | 3300049571 | Ga0501034_0069214 | Ga0501034_0069214_2688_3455 | 251 |
| 122 | 3300049573 | Ga0501037_0173239 | Ga0501037_0173239_308_1075 | 251 |
| 123 | 3300049575 | Ga0501039_0121983 | Ga0501039_0121983_1128_1895 | 251 |
| 124 | 3300049581 | Ga0501047_0001116 | Ga0501047_0001116_15723_16490 | 251 |
| 125 | 3300049822 | Ga0501035_0005194 | Ga0501035_0005194_9540_10307 | 251 |
| 126 | 3300049823 | Ga0501044_0001409 | Ga0501044_0001409_16470_17237 | 251 |
| 127 | 3300050510 | nmdc:mga06r32_111502_c1 | nmdc:mga06r32_111502_c1_882_1676 | 251 |
| 128 | 3300050510 | nmdc:mga06r32_348916_c1 | nmdc:mga06r32_348916_c1_557_1312 | 251 |
| 129 | 3300005445 | Ga0070708_100183818 | Ga0070708_1001838182 | 252 |
| 130 | 3300005467 | Ga0070706_100094354 | Ga0070706_1000943543 | 252 |
| 131 | 3300005467 | Ga0070706_100498370 | Ga0070706_1004983702 | 252 |
| 132 | 3300005518 | Ga0070699_100060494 | Ga0070699_1000604942 | 252 |
| 133 | 3300005536 | Ga0070697_100102065 | Ga0070697_1001020652 | 252 |
| 134 | 3300005985 | Ga0081539_10000161 | Ga0081539_10000161134 | 252 |
| 135 | 3300006028 | Ga0070717_10297326 | Ga0070717_102973262 | 252 |
| 136 | 3300006844 | Ga0075428_100079542 | Ga0075428_1000795424 | 252 |
| 137 | 3300017792 | Ga0163161_10097801 | Ga0163161_100978013 | 252 |
| 138 | 3300025910 | Ga0207684_10164571 | Ga0207684_101645713 | 252 |
| 139 | 3300025922 | Ga0207646_10016503 | Ga0207646_100165034 | 252 |
| 140 | 3300031456 | Ga0307513_10104416 | Ga0307513_101044163 | 252 |
| 141 | 3300036401 | Ga0373937_0592053 | Ga0373937_0592053_13_783 | 252 |
| 142 | 3300039438 | Ga0436360_1109844 | Ga0436360_1109844_323_1114 | 252 |
| 143 | 3300050511 | nmdc:mga08y16_332166_c1 | nmdc:mga08y16_332166_c1_85_867 | 252 |
| 144 | 3300003187 | JGI25151J46595_10001702 | JGI25151J46595_100017025 | 253 |
| 145 | 3300003187 | JGI25151J46595_10008247 | JGI25151J46595_100082474 | 253 |
| 146 | 3300003771 | Ga0055526_1003505 | Ga0055526_100350510 | 253 |
| 147 | 3300003771 | Ga0055526_1003534 | Ga0055526_10035344 | 253 |
| 148 | 3300003771 | Ga0055526_1009070 | Ga0055526_10090704 | 253 |
| 149 | 3300003773 | Ga0055537_1001681 | Ga0055537_10016815 | 253 |
| 150 | 3300003775 | Ga0055524_1000402 | Ga0055524_100040216 | 253 |
| 151 | 3300003781 | Ga0055536_1000158 | Ga0055536_100015820 | 253 |
| 152 | 3300003784 | Ga0055534_1001061 | Ga0055534_100106110 | 253 |
| 153 | 3300003784 | Ga0055534_1002288 | Ga0055534_10022884 | 253 |
| 154 | 3300013297 | Ga0157378_10024511 | Ga0157378_100245114 | 253 |
| 155 | 3300014325 | Ga0163163_10223043 | Ga0163163_102230432 | 253 |
| 156 | 3300021377 | Ga0213874_10038515 | Ga0213874_100385152 | 253 |
| 157 | 3300021441 | Ga0213871_10000788 | Ga0213871_100007882 | 253 |
| 158 | 3300025263 | Ga0209565_1000104 | Ga0209565_1000104120 | 253 |
| 159 | 3300025291 | Ga0209675_1000065 | Ga0209675_100006588 | 253 |
| 160 | 3300025291 | Ga0209675_1004119 | Ga0209675_10041193 | 253 |
| 161 | 3300025292 | Ga0209676_1000044 | Ga0209676_100004488 | 253 |
| 162 | 3300025294 | Ga0209025_1000147 | Ga0209025_1000147111 | 253 |
| 163 | 3300025294 | Ga0209025_1021183 | Ga0209025_10211832 | 253 |
| 164 | 3300025295 | Ga0209564_1000080 | Ga0209564_100008088 | 253 |
| 165 | 3300025295 | Ga0209564_1000253 | Ga0209564_100025325 | 253 |
| 166 | 3300025295 | Ga0209564_1000923 | Ga0209564_100092320 | 253 |
| 167 | 3300025297 | Ga0209758_1015455 | Ga0209758_10154553 | 253 |
| 168 | 3300025299 | Ga0209256_1000543 | Ga0209256_100054334 | 253 |
| 169 | 3300037853 | Ga0436364_0630663 | Ga0436364_0630663_180_944 | 253 |
| 170 | 3300037853 | Ga0436364_0820266 | Ga0436364_0820266_162_926 | 253 |
| 171 | 3300039437 | Ga0436365_0387253 | Ga0436365_0387253_58_822 | 253 |
| 172 | 3300039438 | Ga0436360_1309412 | Ga0436360_1309412_197_961 | 253 |
| 173 | 3300039453 | Ga0436362_0267176 | Ga0436362_0267176_130_894 | 253 |
| 174 | 3300046471 | Ga0495650_0003612 | Ga0495650_0003612_5209_6012 | 253 |
| 175 | 3300048923 | Ga0496120_0066204 | Ga0496120_0066204_823_1626 | 253 |
| 176 | 3300049570 | Ga0501033_0235885 | Ga0501033_0235885_420_1208 | 253 |
| 177 | 3300049571 | Ga0501034_0033987 | Ga0501034_0033987_2257_3045 | 253 |
| 178 | 3300049571 | Ga0501034_0055343 | Ga0501034_0055343_1479_2267 | 253 |
| 179 | 3300049573 | Ga0501037_0380840 | Ga0501037_0380840_14_802 | 253 |
| 180 | 3300049822 | Ga0501035_0394965 | Ga0501035_0394965_83_871 | 253 |
| 181 | 3300049823 | Ga0501044_0091922 | Ga0501044_0091922_582_1370 | 253 |
| 182 | 3300006844 | Ga0075428_100340080 | Ga0075428_1003400802 | 254 |
| 183 | 3300013297 | Ga0157378_10806229 | Ga0157378_108062291 | 254 |
| 184 | 3300039447 | Ga0436361_0304034 | Ga0436361_0304034_3378_4142 | 254 |
| 185 | 3300049823 | Ga0501044_0029505 | Ga0501044_0029505_2729_3541 | 254 |
| 186 | 3300003771 | Ga0055526_1000303 | Ga0055526_100030321 | 255 |
| 187 | 3300005614 | Ga0068856_100168599 | Ga0068856_1001685993 | 255 |
| 188 | 3300006186 | Ga0075369_10068110 | Ga0075369_100681101 | 255 |
| 189 | 3300009093 | Ga0105240_10896138 | Ga0105240_108961382 | 255 |
| 190 | 3300026078 | Ga0207702_10403034 | Ga0207702_104030342 | 255 |
| 191 | 3300048925 | Ga0496122_0056012 | Ga0496122_0056012_108_875 | 255 |
| 192 | 3300050516 | nmdc:mga0sz30_158841_c1 | nmdc:mga0sz30_158841_c1_71_838 | 255 |
| 193 | iso_pu_bacteria | 2510917028 | 2511185949 | 255 |
| 194 | iso_pu_bacteria | 2513237088 | 2513595795 | 255 |
| 195 | iso_pu_bacteria | 2513237138 | 2513870465 | 255 |
| 196 | iso_pu_bacteria | 2516143018 | 2516207721 | 255 |
| 197 | iso_pu_bacteria | 2524023209 | 2524463213 | 255 |
| 198 | iso_pu_bacteria | 2534681796 | 2535519903 | 255 |
| 199 | iso_pu_bacteria | 2582581294 | 2585204741 | 255 |
| 200 | iso_pu_bacteria | 2582581867 | 2585401339 | 255 |
| 201 | iso_pu_bacteria | 2585427590 | 2585821516 | 255 |
| 202 | iso_pu_bacteria | 2643221599 | 2644003546 | 255 |
| 203 | iso_pu_bacteria | 2751185821 | 2753463786 | 255 |
| 204 | iso_pu_bacteria | 2841859092 | 2841863021 | 255 |
| 205 | iso_pu_bacteria | 2842298080 | 2842303923 | 255 |
| 206 | iso_pu_bacteria | 2842515876 | 2842519462 | 255 |
| 207 | iso_pu_bacteria | 2923556063 | 2923560396 | 255 |
| 208 | iso_pu_bacteria | 2933011516 | 2933016667 | 255 |
| 209 | iso_pu_bacteria | 2996887358 | 2996891267 | 255 |
| 210 | iso_pu_bacteria | 3005452660 | 3005458433 | 255 |
| 211 | iso_pu_bacteria | 8005258706 | 8005263816 | 255 |
| 212 | iso_pu_bacteria | 8005321885 | 8005325794 | 255 |
| 213 | iso_pu_bacteria | 8005542996 | 8005547627 | 255 |
| 214 | 3300026121 | Ga0207683_10110322 | Ga0207683_101103222 | 256 |
| 215 | iso_pu_bacteria | 2582581306 | 2585268662 | 256 |
| 216 | iso_pu_bacteria | 2582581316 | 2585334901 | 256 |
| 217 | iso_pu_bacteria | 2615840698 | 2616552760 | 256 |
| 218 | iso_pu_bacteria | 2667528174 | 2671114288 | 256 |
| 219 | iso_pu_bacteria | 2775506902 | 2776267814 | 256 |
| 220 | iso_pu_bacteria | 2775506904 | 2776281785 | 256 |
| 221 | iso_pu_bacteria | 2791355082 | 2792583553 | 256 |
| 222 | iso_pu_bacteria | 2808606387 | 2808990096 | 256 |
| 223 | iso_pu_bacteria | 2818991448 | 2819608073 | 256 |
| 224 | iso_pu_bacteria | 2838029111 | 2838030606 | 256 |
| 225 | iso_pu_bacteria | 2842475841 | 2842477113 | 256 |
| 226 | iso_pu_bacteria | 2842482326 | 2842485976 | 256 |
| 227 | iso_pu_bacteria | 2842502639 | 2842503910 | 256 |
| 228 | iso_pu_bacteria | 2919408235 | 2919412385 | 256 |
| 229 | iso_pu_bacteria | 2989349275 | 2989354522 | 256 |
| 230 | iso_pu_bacteria | 3005416602 | 3005420579 | 256 |
| 231 | iso_pu_bacteria | 8005314921 | 8005318000 | 256 |
| 232 | iso_pu_bacteria | 8005484373 | 8005487703 | 256 |
| 233 | iso_pu_bacteria | 8005645114 | 8005650350 | 256 |
| 234 | iso_pu_bacteria | 8005682033 | 8005683799 | 256 |
| 235 | iso_pu_bacteria | 8049293176 | 8049297933 | 256 |
| 236 | iso_pu_bacteria | 8055431914 | 8055436156 | 256 |
| 237 | iso_pu_bacteria | 2524023207 | 2524451245 | 257 |
| 238 | iso_pu_bacteria | 2916000859 | 2916004518 | 257 |
| 239 | iso_pu_bacteria | 2924179722 | 2924179830 | 257 |
| 240 | iso_pu_bacteria | 2970095765 | 2970096066 | 257 |
| 241 | 3300009763 | Ga0123340_1051829 | Ga0123340_10518293 | 258 |
| 242 | 3300009765 | Ga0123341_1070096 | Ga0123341_10700963 | 258 |
| 243 | 3300003771 | Ga0055526_1027977 | Ga0055526_10279773 | 259 |
| 244 | 3300003775 | Ga0055524_1007404 | Ga0055524_10074042 | 259 |
| 245 | 3300003790 | Ga0055528_1012178 | Ga0055528_10121784 | 259 |
| 246 | 3300003792 | Ga0055540_1011084 | Ga0055540_10110844 | 259 |
| 247 | 3300005355 | Ga0070671_100052708 | Ga0070671_1000527084 | 259 |
| 248 | 3300005367 | Ga0070667_100697888 | Ga0070667_1006978881 | 259 |
| 249 | 3300005985 | Ga0081539_10043493 | Ga0081539_100434933 | 259 |
| 250 | 3300006038 | Ga0075365_10000188 | Ga0075365_100001889 | 259 |
| 251 | 3300006048 | Ga0075363_100099552 | Ga0075363_1000995523 | 259 |
| 252 | 3300006177 | Ga0075362_10211394 | Ga0075362_102113942 | 259 |
| 253 | 3300006178 | Ga0075367_10000065 | Ga0075367_100000657 | 259 |
| 254 | 3300006186 | Ga0075369_10000260 | Ga0075369_100002607 | 259 |
| 255 | 3300009092 | Ga0105250_10071593 | Ga0105250_100715932 | 259 |
| 256 | 3300009177 | Ga0105248_10070539 | Ga0105248_100705394 | 259 |
| 257 | 3300025258 | Ga0209129_1004779 | Ga0209129_10047795 | 259 |
| 258 | 3300025273 | Ga0209673_1036273 | Ga0209673_10362732 | 259 |
| 259 | 3300025294 | Ga0209025_1035598 | Ga0209025_10355983 | 259 |
| 260 | 3300025297 | Ga0209758_1032847 | Ga0209758_10328473 | 259 |
| 261 | 3300025302 | Ga0207426_1001794 | Ga0207426_100179410 | 259 |
| 262 | 3300025303 | Ga0209051_1000909 | Ga0209051_100090922 | 259 |
| 263 | 3300025931 | Ga0207644_10102252 | Ga0207644_101022523 | 259 |
| 264 | 3300048908 | Ga0496105_0181334 | Ga0496105_0181334_84_863 | 259 |
| 265 | 3300048911 | Ga0496108_0478840 | Ga0496108_0478840_94_873 | 259 |
| 266 | 3300048913 | Ga0496110_0315266 | Ga0496110_0315266_481_1260 | 259 |
| 267 | 3300048914 | Ga0496111_0268394 | Ga0496111_0268394_271_1050 | 259 |
| 268 | 3300048923 | Ga0496120_0104267 | Ga0496120_0104267_538_1317 | 259 |
| 269 | 3300048927 | Ga0496124_0070659 | Ga0496124_0070659_501_1280 | 259 |
| 270 | iso_pu_bacteria | 2837651117 | 2837654380 | 259 |
| 271 | iso_pu_bacteria | 3003665799 | 3003672004 | 259 |
| 272 | iso_pu_bacteria | 643348564 | 643601036 | 259 |
| 273 | 3300001979 | JGI24740J21852_10029556 | JGI24740J21852_100295562 | 260 |
| 274 | 3300001979 | JGI24740J21852_10050565 | JGI24740J21852_100505652 | 260 |
| 275 | 3300002704 | JGI25155J39150_1000020 | JGI25155J39150_100002022 | 260 |
| 276 | 3300002705 | JGI25156J39149_1000021 | JGI25156J39149_1000021126 | 260 |
| 277 | 3300002737 | JGI25162J39368_1000476 | JGI25162J39368_10004766 | 260 |
| 278 | 3300002737 | JGI25162J39368_1001403 | JGI25162J39368_100140313 | 260 |
| 279 | 3300002738 | JGI25154J39366_1000039 | JGI25154J39366_100003922 | 260 |
| 280 | 3300002741 | JGI25157J39369_1000019 | JGI25157J39369_1000019126 | 260 |
| 281 | 3300003214 | JGI25165J46597_1000068 | JGI25165J46597_100006841 | 260 |
| 282 | 3300003214 | JGI25165J46597_1000537 | JGI25165J46597_100053714 | 260 |
| 283 | 3300003323 | rootH1_10034734 | rootH1_100347343 | 260 |
| 284 | 3300021320 | Ga0214544_1000029 | Ga0214544_1000029119 | 260 |
| 285 | 3300021321 | Ga0214542_1000092 | Ga0214542_100009287 | 260 |
| 286 | 3300021327 | Ga0214543_1000045 | Ga0214543_1000045119 | 260 |
| 287 | 3300025206 | Ga0209435_100025 | Ga0209435_10002546 | 260 |
| 288 | 3300025233 | Ga0209437_100023 | Ga0209437_10002377 | 260 |
| 289 | 3300025233 | Ga0209437_100067 | Ga0209437_100067119 | 260 |
| 290 | 3300025246 | Ga0209646_1000083 | Ga0209646_100008346 | 260 |
| 291 | 3300025250 | Ga0209026_1000078 | Ga0209026_100007846 | 260 |
| 292 | 3300025256 | Ga0209759_1000060 | Ga0209759_100006046 | 260 |
| 293 | 3300025256 | Ga0209759_1020250 | Ga0209759_10202502 | 260 |
| 294 | 3300025261 | Ga0209233_1000088 | Ga0209233_1000088119 | 260 |
| 295 | 3300025261 | Ga0209233_1000219 | Ga0209233_100021977 | 260 |
| 296 | 3300025303 | Ga0209051_1013339 | Ga0209051_10133393 | 260 |
| 297 | 3300026078 | Ga0207702_10018453 | Ga0207702_100184535 | 260 |
| 298 | 3300028794 | Ga0307515_10007099 | Ga0307515_1000709910 | 260 |
| 299 | 3300028794 | Ga0307515_10055819 | Ga0307515_100558195 | 260 |
| 300 | 3300030500 | Ga0268256_1001086 | Ga0268256_100108610 | 260 |
| 301 | 3300031456 | Ga0307513_10042369 | Ga0307513_100423695 | 260 |
| 302 | 3300031852 | Ga0307410_10157125 | Ga0307410_101571252 | 260 |
| 303 | 3300044684 | Ga0466966_0122023 | Ga0466966_0122023_608_1390 | 260 |
| 304 | 3300044765 | Ga0466970_0000741 | Ga0466970_0000741_10896_11678 | 260 |
| 305 | 3300044842 | Ga0466957_0002063 | Ga0466957_0002063_1268_2050 | 260 |
| 306 | 3300045836 | Ga0466958_0031809 | Ga0466958_0031809_583_1365 | 260 |
| 307 | 3300048912 | Ga0496109_0179539 | Ga0496109_0179539_232_1083 | 260 |
| 308 | 3300048922 | Ga0496119_0022631 | Ga0496119_0022631_730_1512 | 260 |
| 309 | 3300048923 | Ga0496120_0019298 | Ga0496120_0019298_1450_2232 | 260 |
| 310 | 3300048928 | Ga0496125_0053529 | Ga0496125_0053529_1553_2335 | 260 |
| 311 | 3300049570 | Ga0501033_0000942 | Ga0501033_0000942_24637_25488 | 260 |
| 312 | 3300049570 | Ga0501033_0255414 | Ga0501033_0255414_236_1087 | 260 |
| 313 | 3300049571 | Ga0501034_0158480 | Ga0501034_0158480_513_1364 | 260 |
| 314 | 3300049571 | Ga0501034_0548817 | Ga0501034_0548817_114_965 | 260 |
| 315 | 3300049573 | Ga0501037_0014354 | Ga0501037_0014354_772_1623 | 260 |
| 316 | 3300053125 | Ga0500618_001473 | Ga0500618_001473_2262_3044 | 260 |
| 317 | 3300061719 | Ga0466962_0030014 | Ga0466962_0030014_369_1151 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pwq-assembly5.cif.gz_K | the phenylacetyl-coa monooxygenase paaac subcomplex | 0.9944 | 17 | 249 |
| 4iit-assembly1.cif.gz_C-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.9875 | 14 | 260 |
| 4ii4-assembly1.cif.gz_C | the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa | 0.987 | 13 | 260 |
| 3pwq-assembly5.cif.gz_K | the phenylacetyl-coa monooxygenase paaac subcomplex | 0.9817 | 17 | 249 |
| 4iit-assembly1.cif.gz_C-2 | the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa | 0.9796 | 14 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pwqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9873 | 13 | 260 | 1.20.1260.10 |
| 3pwqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9794 | 13 | 260 | 1.20.1260.10 |
| 4mudC00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8602 | 12 | 224 | 1.20.1260.10 |
| 3pwqH00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8444 | 8 | 254 | 1.20.1260.10 |
| 4mudC00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8128 | 12 | 224 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519PAS0-F1-model_v4 | deleted | 0.9987 | 12 | 115 |
|
| AF-A0A533J113-F1-model_v4 | deleted | 0.9967 | 15 | 160 |
|
| AF-A0A699WU94-F1-model_v4 | Phenylacetate-CoA oxygenase subunit PaaI | 0.9961 | 50 | 170 |
GO:0005829
GO:0010124 |
| AF-A0A2N2ZBI9-F1-model_v4 | Phenylacetate-CoA oxygenase subunit PaaI | 0.9958 | 11 | 167 |
GO:0005829
GO:0010124 |
| AF-A0A3D3K2S3-F1-model_v4 | Phenylacetate-CoA oxygenase subunit PaaI | 0.9951 | 15 | 119 |
GO:0005829
GO:0010124 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar