F404374

General Info

Members Datasets Scaffolds Average Seq Length
317 239 262 257

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185821|2753463786
Length 315
Sequence PTPSGDRTALFEFLQRLGDNALILGHRLSEWCGHAPALEEDIALANTALDLIGQTQLWLGLAGEVEGKGRSADDLAYLRDATEFRNVLLVERPNGDFGKTLLRQLLFDAWHLLLLQALRSSADKRIADIAEKASKEVAYHLDRSRDLVVRLGDGTAESHRRMQEALDELWPYTGELFIGDPADAELAAAGIAPTPERLKAAWDEVVGATLAAATLKKPADGYMHQGGKRGVHTEHIGFILAEMXELAAAGIAPAPERLKAAWDEVVGATLAAATLKKPADGYMHQGGKRGVHTEHIGFILAEMQFLQRAYPGATW

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
3 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
4 2516143018 Ensifer sp. BR816 Isolate Nodule
5 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
6 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
7 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
8 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
9 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
10 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
11 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
12 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
13 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
14 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
15 2643221599 Rhizobium sp. Root708 Isolate Unclassified
16 2643221621 Achromobacter sp. Root83 Isolate Unclassified
17 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
18 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
19 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
20 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
21 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
22 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
23 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
24 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
25 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
26 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
27 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
28 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
29 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
30 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
31 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
32 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
33 2858950400 Achromobacter sp. K91 Isolate Unclassified
34 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
35 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
36 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
37 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
38 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
39 2941479691
40 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
41 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
42 2996887358 Rhizobium sp. R711 Isolate Nodule
43 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
44 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
45 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
50 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
51 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
57 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
104 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
111 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
112 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
116 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
173 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
176 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
228 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
231 8005258706 Rhizobium sp. R693 Isolate Nodule
232 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
233 8005321885 Rhizobium sp. R72 Isolate Nodule
234 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
235 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
236 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
237 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
238 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
239 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.65
Metatranscriptomes 0
Isolates 17.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.87
Nodule 9.15
Rhizoplane 2.21
Rhizosphere 49.21
Stem 0
Stem Tuber 0
Unclassified 19.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10029556 3300001979 Bacteria 1798
2 JGI24740J21852_10050565 3300001979 Bacteria 1195
3 JGI25155J39150_1000020 3300002704 Bacteria 152963
4 JGI25156J39149_1000021 3300002705 Bacteria 152968
5 JGI25162J39368_1000476 3300002737 Bacteria 30796
6 JGI25162J39368_1001403 3300002737 Bacteria 13139
7 JGI25154J39366_1000039 3300002738 Bacteria 152972
8 JGI25157J39369_1000019 3300002741 Bacteria 176591
9 JGI25151J46595_10001702 3300003187 Bacteria 14367
10 JGI25151J46595_10008247 3300003187 Bacteria 5025
11 JGI25165J46597_1000068 3300003214 Bacteria 196201
12 JGI25165J46597_1000537 3300003214 Bacteria 35164
13 rootH2_10183881 3300003320 Bacteria 2258
14 rootH1_10034734 3300003323 Bacteria 8289
15 Ga0055526_1000303 3300003771 Bacteria 41129
16 Ga0055526_1003505 3300003771 Bacteria 9921
17 Ga0055526_1003534 3300003771 Bacteria 9868
18 Ga0055526_1009070 3300003771 Bacteria 4853
19 Ga0055526_1027977 3300003771 Bacteria 1721
20 Ga0055537_1001681 3300003773 Bacteria 8205
21 Ga0055524_1000402 3300003775 Bacteria 36997
22 Ga0055524_1007404 3300003775 Bacteria 4667
23 Ga0055536_1000158 3300003781 Bacteria 58733
24 Ga0055534_1001061 3300003784 Bacteria 11910
25 Ga0055534_1002288 3300003784 Bacteria 6729
26 Ga0055528_1012178 3300003790 Bacteria 3357
27 Ga0055540_1011084 3300003792 Bacteria 2942
28 Ga0055540_1013851 3300003792 Bacteria 2440
29 Ga0070668_100004039 3300005347 Bacteria 10856
30 Ga0070669_100115447 3300005353 Bacteria 2042
31 Ga0070671_100052708 3300005355 Bacteria 3382
32 Ga0070674_100015723 3300005356 Bacteria 4731
33 Ga0070659_100197446 3300005366 Bacteria 1655
34 Ga0070667_100697888 3300005367 Bacteria 939
35 Ga0070708_100183818 3300005445 Bacteria 1954
36 Ga0070662_100052590 3300005457 Bacteria 2945
37 Ga0068867_100068824 3300005459 Bacteria 2642
38 Ga0070685_10081811 3300005466 Bacteria 1937
39 Ga0070706_100094354 3300005467 Bacteria 2776
40 Ga0070706_100498370 3300005467 Bacteria 1133
41 Ga0070699_100060494 3300005518 Bacteria 3282
42 Ga0070684_100130627 3300005535 Bacteria 2266
43 Ga0070697_100003615 3300005536 Bacteria 11874
44 Ga0070697_100102065 3300005536 Bacteria 2383
45 Ga0070672_100036184 3300005543 Bacteria 3759
46 Ga0068856_100168599 3300005614 Bacteria 2201
47 Ga0068861_100008169 3300005719 Bacteria 7202
48 Ga0068862_100003804 3300005844 Bacteria 12855
49 Ga0081539_10000161 3300005985 Bacteria 156560
50 Ga0081539_10043493 3300005985 Bacteria 2603
51 Ga0070717_10297326 3300006028 Unclassified 1435
52 Ga0075365_10000188 3300006038 Bacteria 20119
53 Ga0075363_100099552 3300006048 Bacteria 1608
54 Ga0075362_10211394 3300006177 Bacteria 946
55 Ga0075367_10000065 3300006178 Bacteria 26310
56 Ga0075369_10000260 3300006186 Bacteria 15573
57 Ga0075369_10068110 3300006186 Bacteria 1564
58 Ga0075428_100001020 3300006844 Bacteria 29707
59 Ga0075428_100001300 3300006844 Bacteria 26505
60 Ga0075428_100055322 3300006844 Bacteria 4347
61 Ga0075428_100079542 3300006844 Bacteria 3578
62 Ga0075428_100340080 3300006844 Bacteria 1612
63 Ga0075430_100054711 3300006846 Bacteria 3357
64 Ga0075431_100003294 3300006847 Bacteria 15634
65 Ga0075431_100026802 3300006847 Bacteria 5911
66 Ga0075431_100028431 3300006847 Bacteria 5746
67 Ga0075431_100042473 3300006847 Bacteria 4690
68 Ga0075431_100384633 3300006847 Unclassified 1407
69 Ga0075433_10008299 3300006852 Bacteria 8280
70 Ga0075434_100021659 3300006871 Bacteria 6250
71 Ga0075429_100007787 3300006880 Bacteria 9304
72 Ga0075429_100352965 3300006880 Bacteria 1287
73 Ga0075435_100218526 3300007076 Bacteria 1618
74 Ga0105250_10071593 3300009092 Bacteria 1400
75 Ga0105240_10896138 3300009093 Bacteria 955
76 Ga0111539_10000794 3300009094 Bacteria 41122
77 Ga0111539_10017029 3300009094 Bacteria 8996
78 Ga0111539_10239524 3300009094 Bacteria 2112
79 Ga0114129_10030299 3300009147 Bacteria 7658
80 Ga0105241_10034715 3300009174 Bacteria 3791
81 Ga0105248_10070539 3300009177 Bacteria 3924
82 Ga0105237_10015412 3300009545 Bacteria 7956
83 Ga0105238_10138129 3300009551 Bacteria 2415
84 Ga0123340_1051829 3300009763 Bacteria 1457
85 Ga0123341_1070096 3300009765 Bacteria 1541
86 Ga0105239_10072890 3300010375 Bacteria 3776
87 Ga0157378_10024511 3300013297 Bacteria 5310
88 Ga0157378_10806229 3300013297 Bacteria 965
89 Ga0157375_10649068 3300013308 Bacteria 1212
90 Ga0163163_10223043 3300014325 Bacteria 1934
91 Ga0163161_10097801 3300017792 Bacteria 2180
92 Ga0214544_1000029 3300021320 Bacteria 153924
93 Ga0214542_1000092 3300021321 Bacteria 117288
94 Ga0214543_1000045 3300021327 Bacteria 152699
95 Ga0213874_10038515 3300021377 Bacteria 1419
96 Ga0213871_10000788 3300021441 Bacteria 4716
97 Ga0209435_100025 3300025206 Bacteria 198776
98 Ga0209672_106674 3300025228 Bacteria 1852
99 Ga0209437_100023 3300025233 Bacteria 614195
100 Ga0209437_100067 3300025233 Bacteria 317685
101 Ga0209646_1000083 3300025246 Bacteria 198777
102 Ga0209026_1000078 3300025250 Bacteria 198777
103 Ga0209759_1000060 3300025256 Bacteria 198777
104 Ga0209759_1020250 3300025256 Bacteria 1549
105 Ga0209129_1004779 3300025258 Bacteria 5121
106 Ga0209233_1000088 3300025261 Bacteria 317980
107 Ga0209233_1000219 3300025261 Bacteria 104797
108 Ga0209565_1000104 3300025263 Bacteria 124432
109 Ga0209455_1002241 3300025272 Bacteria 7607
110 Ga0209673_1036273 3300025273 Bacteria 1465
111 Ga0209675_1000065 3300025291 Bacteria 174791
112 Ga0209675_1004119 3300025291 Bacteria 6607
113 Ga0209676_1000044 3300025292 Bacteria 416215
114 Ga0209025_1000147 3300025294 Bacteria 180008
115 Ga0209025_1021183 3300025294 Bacteria 3514
116 Ga0209025_1035598 3300025294 Bacteria 2246
117 Ga0209564_1000080 3300025295 Bacteria 263547
118 Ga0209564_1000253 3300025295 Bacteria 114335
119 Ga0209564_1000923 3300025295 Bacteria 38212
120 Ga0209758_1015455 3300025297 Bacteria 3948
121 Ga0209758_1032847 3300025297 Bacteria 2098
122 Ga0209256_1000543 3300025299 Bacteria 54373
123 Ga0207426_1001794 3300025302 Bacteria 16028
124 Ga0209051_1000909 3300025303 Bacteria 29436
125 Ga0209051_1001539 3300025303 Bacteria 19182
126 Ga0209051_1013339 3300025303 Bacteria 3918
127 Ga0207682_10070472 3300025893 Bacteria 1480
128 Ga0207645_10003256 3300025907 Bacteria 12402
129 Ga0207684_10164571 3300025910 Unclassified 1911
130 Ga0207654_10018301 3300025911 Bacteria 3674
131 Ga0207671_10079601 3300025914 Bacteria 2455
132 Ga0207660_10064013 3300025917 Bacteria 2653
133 Ga0207646_10016503 3300025922 Bacteria 6930
134 Ga0207681_10046901 3300025923 Bacteria 2907
135 Ga0207644_10102252 3300025931 Bacteria 2155
136 Ga0207690_10162532 3300025932 Bacteria 1666
137 Ga0207706_10001508 3300025933 Bacteria 23112
138 Ga0207704_10068501 3300025938 Bacteria 2237
139 Ga0207691_10002454 3300025940 Bacteria 18133
140 Ga0207639_10001641 3300026041 Bacteria 15068
141 Ga0207708_10056553 3300026075 Bacteria 2993
142 Ga0207708_10355321 3300026075 Bacteria 1203
143 Ga0207702_10018453 3300026078 Bacteria 5772
144 Ga0207702_10403034 3300026078 Bacteria 1319
145 Ga0207648_10003102 3300026089 Bacteria 17547
146 Ga0207675_100000205 3300026118 Bacteria 54926
147 Ga0207683_10110322 3300026121 Bacteria 2463
148 Ga0209982_1007004 3300027552 Bacteria 1647
149 Ga0210002_1001501 3300027617 Bacteria 3303
150 Ga0209983_1000057 3300027665 Bacteria 16946
151 Ga0209971_1003992 3300027682 Bacteria 3488
152 Ga0209966_1011181 3300027695 Bacteria 1632
153 Ga0209998_10000641 3300027717 Bacteria 9378
154 Ga0209974_10002031 3300027876 Bacteria 7395
155 Ga0207428_10009790 3300027907 Bacteria 8587
156 Ga0207428_10024731 3300027907 Bacteria 5040
157 Ga0307515_10007099 3300028794 Bacteria 22248
158 Ga0307515_10055819 3300028794 Bacteria 5759
159 Ga0268256_1001086 3300030500 Bacteria 17888
160 Ga0307513_10042369 3300031456 Bacteria 5013
161 Ga0307513_10104416 3300031456 Bacteria 2847
162 Ga0307509_10000189 3300031507 Bacteria 96946
163 Ga0307408_100088432 3300031548 Bacteria 2333
164 Ga0307410_10157125 3300031852 Bacteria 1700
165 Ga0373937_0592053 3300036401 Bacteria 1053
166 Ga0436364_0630663 3300037853 Bacteria 1105
167 Ga0436364_0820266 3300037853 Bacteria 1495
168 Ga0436365_0387253 3300039437 Bacteria 1277
169 Ga0436365_0746130 3300039437 Bacteria 3400
170 Ga0436365_1074806 3300039437 Bacteria 1009
171 Ga0436365_1199995 3300039437 Bacteria 1234
172 Ga0436360_1109844 3300039438 Bacteria 2176
173 Ga0436360_1309412 3300039438 Bacteria 8677
174 Ga0436361_0304034 3300039447 Bacteria 5566
175 Ga0436362_0267176 3300039453 Bacteria 3681
176 Ga0439442_045074 3300042002 Bacteria 929
177 Ga0439449_0017489 3300042007 Bacteria 2693
178 Ga0450914_003291 3300042118 Bacteria 1231
179 Ga0450896_006783 3300042133 Bacteria 1573
180 Ga0466972_0020808 3300044658 Bacteria 3276
181 Ga0466966_0122023 3300044684 Bacteria 1600
182 Ga0466970_0000741 3300044765 Bacteria 15890
183 Ga0466957_0002063 3300044842 Bacteria 10743
184 Ga0466958_0031809 3300045836 Bacteria 3136
185 Ga0495638_0042622 3300046460 Bacteria 2866
186 Ga0495650_0003612 3300046471 Bacteria 11145
187 Ga0495672_0021416 3300047320 Bacteria 4217
188 Ga0496105_0181334 3300048908 Bacteria 1724
189 Ga0496108_0478840 3300048911 Bacteria 1088
190 Ga0496109_0179539 3300048912 Bacteria 1988
191 Ga0496110_0315266 3300048913 Bacteria 1424
192 Ga0496111_0268394 3300048914 Bacteria 1266
193 Ga0496116_0015097 3300048919 Bacteria 6123
194 Ga0496117_0056329 3300048920 Bacteria 2739
195 Ga0496119_0002271 3300048922 Bacteria 21345
196 Ga0496119_0022631 3300048922 Bacteria 4490
197 Ga0496120_0019298 3300048923 Bacteria 4365
198 Ga0496120_0066204 3300048923 Bacteria 1999
199 Ga0496120_0104267 3300048923 Bacteria 1493
200 Ga0496121_0001430 3300048924 Bacteria 40317
201 Ga0496121_0232427 3300048924 Bacteria 1290
202 Ga0496122_0000484 3300048925 Bacteria 82756
203 Ga0496122_0044052 3300048925 Bacteria 3488
204 Ga0496122_0056012 3300048925 Bacteria 2944
205 Ga0496123_0000641 3300048926 Bacteria 58369
206 Ga0496124_0050942 3300048927 Bacteria 3524
207 Ga0496124_0070659 3300048927 Bacteria 2895
208 Ga0496124_0429446 3300048927 Bacteria 908
209 Ga0496125_0000011 3300048928 Bacteria 655895
210 Ga0496125_0053529 3300048928 Bacteria 3307
211 Ga0496125_0073124 3300048928 Bacteria 2667
212 Ga0496126_0162544 3300048929 Bacteria 1907
213 Ga0501032_0358313 3300049569 Bacteria 939
214 Ga0501033_0000942 3300049570 Bacteria 26447
215 Ga0501033_0007581 3300049570 Bacteria 8441
216 Ga0501033_0235885 3300049570 Bacteria 1298
217 Ga0501033_0255414 3300049570 Bacteria 1241
218 Ga0501034_0033987 3300049571 Bacteria 5170
219 Ga0501034_0055343 3300049571 Bacteria 3992
220 Ga0501034_0069214 3300049571 Bacteria 3540
221 Ga0501034_0158480 3300049571 Bacteria 2236
222 Ga0501034_0548817 3300049571 Bacteria 1065
223 Ga0501037_0014354 3300049573 Bacteria 5833
224 Ga0501037_0173239 3300049573 Bacteria 1533
225 Ga0501037_0380840 3300049573 Bacteria 970
226 Ga0501039_0121983 3300049575 Bacteria 2043
227 Ga0501046_0030231 3300049580 Bacteria 4398
228 Ga0501047_0001116 3300049581 Bacteria 26651
229 Ga0501067_0047668 3300049583 Bacteria 2377
230 Ga0501068_0005693 3300049584 Bacteria 6824
231 Ga0501069_0138590 3300049585 Bacteria 1395
232 Ga0501071_0022048 3300049587 Bacteria 4439
233 Ga0501075_0464976 3300049591 Bacteria 965
234 Ga0501035_0005194 3300049822 Bacteria 12317
235 Ga0501035_0394965 3300049822 Bacteria 1151
236 Ga0501044_0001409 3300049823 Bacteria 28201
237 Ga0501044_0029505 3300049823 Bacteria 5783
238 Ga0501044_0091922 3300049823 Bacteria 3060
239 nmdc:mga05p37_44564_c1 3300050507 Bacteria 5457
240 nmdc:mga09592_2703_c1 3300050508 Bacteria 14341
241 nmdc:mga06r32_110_c1 3300050510 Bacteria 58239
242 nmdc:mga06r32_111502_c1 3300050510 Bacteria 2692
243 nmdc:mga06r32_348916_c1 3300050510 Unclassified 1464
244 nmdc:mga06r32_36808_c1 3300050510 Bacteria 4627
245 nmdc:mga08y16_330805_c1 3300050511 Bacteria 1567
246 nmdc:mga08y16_332166_c1 3300050511 Bacteria 1563
247 nmdc:mga08y16_3896_c1 3300050511 Bacteria 15538
248 nmdc:mga0rr50_258855_c1 3300050513 Bacteria 1447
249 nmdc:mga0a205_2569_c1 3300050515 Bacteria 16006
250 nmdc:mga0sz30_158841_c1 3300050516 Bacteria 1001
251 Ga0500651_0056619 3300053093 Bacteria 2455
252 Ga0500617_067171 3300053124 Bacteria 1578
253 Ga0500618_001473 3300053125 Bacteria 10423
254 Ga0500568_0045499 3300053139 Bacteria 1746
255 Ga0500568_0064809 3300053139 Bacteria 1407
256 Ga0500588_0027121 3300053146 Bacteria 1610
257 Ga0500604_0082790 3300053151 Bacteria 1039
258 Ga0500622_0003800 3300053156 Bacteria 9830
259 Ga0500622_0015374 3300053156 Bacteria 4098
260 Ga0500622_0017572 3300053156 Bacteria 3807
261 Ga0500627_0077470 3300053158 Bacteria 1479
262 Ga0466962_0030014 3300061719 Bacteria 2603

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0138590 Ga0501069_0138590_29_688 215
2 3300025893 Ga0207682_10070472 Ga0207682_100704723 217
3 3300053093 Ga0500651_0056619 Ga0500651_0056619_594_1319 237
4 3300005347 Ga0070668_100004039 Ga0070668_1000040398 238
5 3300005356 Ga0070674_100015723 Ga0070674_1000157236 238
6 3300005459 Ga0068867_100068824 Ga0068867_1000688243 238
7 3300047320 Ga0495672_0021416 Ga0495672_0021416_687_1415 238
8 3300050510 nmdc:mga06r32_36808_c1 nmdc:mga06r32_36808_c1_1119_1847 238
9 3300013308 Ga0157375_10649068 Ga0157375_106490682 239
10 3300025933 Ga0207706_10001508 Ga0207706_100015088 239
11 3300006844 Ga0075428_100001300 Ga0075428_1000013006 241
12 3300006847 Ga0075431_100003294 Ga0075431_10000329413 241
13 3300006880 Ga0075429_100007787 Ga0075429_1000077876 241
14 3300009094 Ga0111539_10000794 Ga0111539_1000079417 241
15 3300009147 Ga0114129_10030299 Ga0114129_100302996 241
16 3300027907 Ga0207428_10009790 Ga0207428_100097905 241
17 3300027907 Ga0207428_10024731 Ga0207428_100247314 241
18 3300042118 Ga0450914_003291 Ga0450914_003291_430_1167 241
19 3300050507 nmdc:mga05p37_44564_c1 nmdc:mga05p37_44564_c1_4238_4975 241
20 3300050508 nmdc:mga09592_2703_c1 nmdc:mga09592_2703_c1_3631_4368 241
21 3300050510 nmdc:mga06r32_110_c1 nmdc:mga06r32_110_c1_34213_34950 241
22 3300050511 nmdc:mga08y16_3896_c1 nmdc:mga08y16_3896_c1_8694_9431 241
23 3300053158 Ga0500627_0077470 Ga0500627_0077470_497_1249 241
24 3300039437 Ga0436365_1199995 Ga0436365_1199995_481_1215 243
25 3300042002 Ga0439442_045074 Ga0439442_045074_44_787 243
26 3300053139 Ga0500568_0045499 Ga0500568_0045499_331_1086 243
27 3300053139 Ga0500568_0064809 Ga0500568_0064809_23_778 243
28 3300053151 Ga0500604_0082790 Ga0500604_0082790_191_946 243
29 3300006852 Ga0075433_10008299 Ga0075433_100082992 245
30 3300006871 Ga0075434_100021659 Ga0075434_1000216595 245
31 3300007076 Ga0075435_100218526 Ga0075435_1002185262 245
32 3300009094 Ga0111539_10239524 Ga0111539_102395242 245
33 3300046460 Ga0495638_0042622 Ga0495638_0042622_294_1064 245
34 3300049583 Ga0501067_0047668 Ga0501067_0047668_332_1081 245
35 3300049584 Ga0501068_0005693 Ga0501068_0005693_1077_1826 245
36 3300049587 Ga0501071_0022048 Ga0501071_0022048_367_1116 245
37 3300050511 nmdc:mga08y16_330805_c1 nmdc:mga08y16_330805_c1_411_1160 245
38 3300050513 nmdc:mga0rr50_258855_c1 nmdc:mga0rr50_258855_c1_86_835 245
39 3300050515 nmdc:mga0a205_2569_c1 nmdc:mga0a205_2569_c1_435_1184 245
40 3300026075 Ga0207708_10355321 Ga0207708_103553212 246
41 3300031507 Ga0307509_10000189 Ga0307509_100001898 246
42 3300053156 Ga0500622_0015374 Ga0500622_0015374_156_908 246
43 iso_pu_bacteria 2599185292 2599903416 246
44 iso_pu_bacteria 2643221621 2644122330 246
45 iso_pu_bacteria 2857537821 2857542633 246
46 iso_pu_bacteria 2858950400 2858955515 246
47 iso_pu_bacteria 2941479691 2941482181 246
48 3300049591 Ga0501075_0464976 Ga0501075_0464976_166_951 247
49 3300005366 Ga0070659_100197446 Ga0070659_1001974462 248
50 3300005535 Ga0070684_100130627 Ga0070684_1001306272 248
51 3300006847 Ga0075431_100028431 Ga0075431_1000284316 248
52 3300009174 Ga0105241_10034715 Ga0105241_100347153 248
53 3300009545 Ga0105237_10015412 Ga0105237_100154123 248
54 3300009551 Ga0105238_10138129 Ga0105238_101381291 248
55 3300010375 Ga0105239_10072890 Ga0105239_100728903 248
56 3300025911 Ga0207654_10018301 Ga0207654_100183013 248
57 3300025914 Ga0207671_10079601 Ga0207671_100796012 248
58 3300025932 Ga0207690_10162532 Ga0207690_101625322 248
59 3300026041 Ga0207639_10001641 Ga0207639_100016416 248
60 3300031548 Ga0307408_100088432 Ga0307408_1000884324 248
61 3300048927 Ga0496124_0429446 Ga0496124_0429446_80_862 248
62 3300049580 Ga0501046_0030231 Ga0501046_0030231_881_1666 248
63 3300053124 Ga0500617_067171 Ga0500617_067171_688_1473 248
64 3300053146 Ga0500588_0027121 Ga0500588_0027121_266_1051 248
65 3300053156 Ga0500622_0003800 Ga0500622_0003800_759_1541 248
66 3300053156 Ga0500622_0017572 Ga0500622_0017572_930_1712 248
67 3300005536 Ga0070697_100003615 Ga0070697_1000036158 249
68 3300003792 Ga0055540_1013851 Ga0055540_10138513 250
69 3300005466 Ga0070685_10081811 Ga0070685_100818113 250
70 3300025228 Ga0209672_106674 Ga0209672_1066743 250
71 3300025272 Ga0209455_1002241 Ga0209455_10022412 250
72 3300025303 Ga0209051_1001539 Ga0209051_100153911 250
73 3300042007 Ga0439449_0017489 Ga0439449_0017489_890_1645 250
74 3300048919 Ga0496116_0015097 Ga0496116_0015097_3890_4654 250
75 3300048920 Ga0496117_0056329 Ga0496117_0056329_88_852 250
76 3300048922 Ga0496119_0002271 Ga0496119_0002271_2452_3216 250
77 3300048924 Ga0496121_0001430 Ga0496121_0001430_7190_7954 250
78 3300048924 Ga0496121_0232427 Ga0496121_0232427_346_1110 250
79 3300048925 Ga0496122_0000484 Ga0496122_0000484_27624_28388 250
80 3300048925 Ga0496122_0044052 Ga0496122_0044052_1523_2287 250
81 3300048926 Ga0496123_0000641 Ga0496123_0000641_28078_28842 250
82 3300048927 Ga0496124_0050942 Ga0496124_0050942_2149_2913 250
83 3300048928 Ga0496125_0000011 Ga0496125_0000011_380600_381364 250
84 3300048928 Ga0496125_0073124 Ga0496125_0073124_141_905 250
85 3300048929 Ga0496126_0162544 Ga0496126_0162544_887_1651 250
86 3300003320 rootH2_10183881 rootH2_101838813 251
87 3300005353 Ga0070669_100115447 Ga0070669_1001154472 251
88 3300005457 Ga0070662_100052590 Ga0070662_1000525901 251
89 3300005543 Ga0070672_100036184 Ga0070672_1000361845 251
90 3300005719 Ga0068861_100008169 Ga0068861_1000081696 251
91 3300005844 Ga0068862_100003804 Ga0068862_10000380411 251
92 3300006844 Ga0075428_100001020 Ga0075428_10000102024 251
93 3300006844 Ga0075428_100055322 Ga0075428_1000553224 251
94 3300006846 Ga0075430_100054711 Ga0075430_1000547113 251
95 3300006847 Ga0075431_100026802 Ga0075431_1000268023 251
96 3300006847 Ga0075431_100042473 Ga0075431_1000424735 251
97 3300006847 Ga0075431_100384633 Ga0075431_1003846332 251
98 3300006880 Ga0075429_100352965 Ga0075429_1003529652 251
99 3300009094 Ga0111539_10017029 Ga0111539_100170295 251
100 3300025907 Ga0207645_10003256 Ga0207645_1000325611 251
101 3300025917 Ga0207660_10064013 Ga0207660_100640134 251
102 3300025923 Ga0207681_10046901 Ga0207681_100469012 251
103 3300025938 Ga0207704_10068501 Ga0207704_100685013 251
104 3300025940 Ga0207691_10002454 Ga0207691_1000245420 251
105 3300026075 Ga0207708_10056553 Ga0207708_100565534 251
106 3300026089 Ga0207648_10003102 Ga0207648_1000310212 251
107 3300026118 Ga0207675_100000205 Ga0207675_10000020536 251
108 3300027552 Ga0209982_1007004 Ga0209982_10070043 251
109 3300027617 Ga0210002_1001501 Ga0210002_10015012 251
110 3300027665 Ga0209983_1000057 Ga0209983_100005715 251
111 3300027682 Ga0209971_1003992 Ga0209971_10039923 251
112 3300027695 Ga0209966_1011181 Ga0209966_10111812 251
113 3300027717 Ga0209998_10000641 Ga0209998_100006415 251
114 3300027876 Ga0209974_10002031 Ga0209974_100020313 251
115 3300039437 Ga0436365_0746130 Ga0436365_0746130_1547_2311 251
116 3300039437 Ga0436365_1074806 Ga0436365_1074806_95_850 251
117 3300042133 Ga0450896_006783 Ga0450896_006783_412_1191 251
118 3300044658 Ga0466972_0020808 Ga0466972_0020808_1332_2162 251
119 3300049569 Ga0501032_0358313 Ga0501032_0358313_31_798 251
120 3300049570 Ga0501033_0007581 Ga0501033_0007581_2826_3593 251
121 3300049571 Ga0501034_0069214 Ga0501034_0069214_2688_3455 251
122 3300049573 Ga0501037_0173239 Ga0501037_0173239_308_1075 251
123 3300049575 Ga0501039_0121983 Ga0501039_0121983_1128_1895 251
124 3300049581 Ga0501047_0001116 Ga0501047_0001116_15723_16490 251
125 3300049822 Ga0501035_0005194 Ga0501035_0005194_9540_10307 251
126 3300049823 Ga0501044_0001409 Ga0501044_0001409_16470_17237 251
127 3300050510 nmdc:mga06r32_111502_c1 nmdc:mga06r32_111502_c1_882_1676 251
128 3300050510 nmdc:mga06r32_348916_c1 nmdc:mga06r32_348916_c1_557_1312 251
129 3300005445 Ga0070708_100183818 Ga0070708_1001838182 252
130 3300005467 Ga0070706_100094354 Ga0070706_1000943543 252
131 3300005467 Ga0070706_100498370 Ga0070706_1004983702 252
132 3300005518 Ga0070699_100060494 Ga0070699_1000604942 252
133 3300005536 Ga0070697_100102065 Ga0070697_1001020652 252
134 3300005985 Ga0081539_10000161 Ga0081539_10000161134 252
135 3300006028 Ga0070717_10297326 Ga0070717_102973262 252
136 3300006844 Ga0075428_100079542 Ga0075428_1000795424 252
137 3300017792 Ga0163161_10097801 Ga0163161_100978013 252
138 3300025910 Ga0207684_10164571 Ga0207684_101645713 252
139 3300025922 Ga0207646_10016503 Ga0207646_100165034 252
140 3300031456 Ga0307513_10104416 Ga0307513_101044163 252
141 3300036401 Ga0373937_0592053 Ga0373937_0592053_13_783 252
142 3300039438 Ga0436360_1109844 Ga0436360_1109844_323_1114 252
143 3300050511 nmdc:mga08y16_332166_c1 nmdc:mga08y16_332166_c1_85_867 252
144 3300003187 JGI25151J46595_10001702 JGI25151J46595_100017025 253
145 3300003187 JGI25151J46595_10008247 JGI25151J46595_100082474 253
146 3300003771 Ga0055526_1003505 Ga0055526_100350510 253
147 3300003771 Ga0055526_1003534 Ga0055526_10035344 253
148 3300003771 Ga0055526_1009070 Ga0055526_10090704 253
149 3300003773 Ga0055537_1001681 Ga0055537_10016815 253
150 3300003775 Ga0055524_1000402 Ga0055524_100040216 253
151 3300003781 Ga0055536_1000158 Ga0055536_100015820 253
152 3300003784 Ga0055534_1001061 Ga0055534_100106110 253
153 3300003784 Ga0055534_1002288 Ga0055534_10022884 253
154 3300013297 Ga0157378_10024511 Ga0157378_100245114 253
155 3300014325 Ga0163163_10223043 Ga0163163_102230432 253
156 3300021377 Ga0213874_10038515 Ga0213874_100385152 253
157 3300021441 Ga0213871_10000788 Ga0213871_100007882 253
158 3300025263 Ga0209565_1000104 Ga0209565_1000104120 253
159 3300025291 Ga0209675_1000065 Ga0209675_100006588 253
160 3300025291 Ga0209675_1004119 Ga0209675_10041193 253
161 3300025292 Ga0209676_1000044 Ga0209676_100004488 253
162 3300025294 Ga0209025_1000147 Ga0209025_1000147111 253
163 3300025294 Ga0209025_1021183 Ga0209025_10211832 253
164 3300025295 Ga0209564_1000080 Ga0209564_100008088 253
165 3300025295 Ga0209564_1000253 Ga0209564_100025325 253
166 3300025295 Ga0209564_1000923 Ga0209564_100092320 253
167 3300025297 Ga0209758_1015455 Ga0209758_10154553 253
168 3300025299 Ga0209256_1000543 Ga0209256_100054334 253
169 3300037853 Ga0436364_0630663 Ga0436364_0630663_180_944 253
170 3300037853 Ga0436364_0820266 Ga0436364_0820266_162_926 253
171 3300039437 Ga0436365_0387253 Ga0436365_0387253_58_822 253
172 3300039438 Ga0436360_1309412 Ga0436360_1309412_197_961 253
173 3300039453 Ga0436362_0267176 Ga0436362_0267176_130_894 253
174 3300046471 Ga0495650_0003612 Ga0495650_0003612_5209_6012 253
175 3300048923 Ga0496120_0066204 Ga0496120_0066204_823_1626 253
176 3300049570 Ga0501033_0235885 Ga0501033_0235885_420_1208 253
177 3300049571 Ga0501034_0033987 Ga0501034_0033987_2257_3045 253
178 3300049571 Ga0501034_0055343 Ga0501034_0055343_1479_2267 253
179 3300049573 Ga0501037_0380840 Ga0501037_0380840_14_802 253
180 3300049822 Ga0501035_0394965 Ga0501035_0394965_83_871 253
181 3300049823 Ga0501044_0091922 Ga0501044_0091922_582_1370 253
182 3300006844 Ga0075428_100340080 Ga0075428_1003400802 254
183 3300013297 Ga0157378_10806229 Ga0157378_108062291 254
184 3300039447 Ga0436361_0304034 Ga0436361_0304034_3378_4142 254
185 3300049823 Ga0501044_0029505 Ga0501044_0029505_2729_3541 254
186 3300003771 Ga0055526_1000303 Ga0055526_100030321 255
187 3300005614 Ga0068856_100168599 Ga0068856_1001685993 255
188 3300006186 Ga0075369_10068110 Ga0075369_100681101 255
189 3300009093 Ga0105240_10896138 Ga0105240_108961382 255
190 3300026078 Ga0207702_10403034 Ga0207702_104030342 255
191 3300048925 Ga0496122_0056012 Ga0496122_0056012_108_875 255
192 3300050516 nmdc:mga0sz30_158841_c1 nmdc:mga0sz30_158841_c1_71_838 255
193 iso_pu_bacteria 2510917028 2511185949 255
194 iso_pu_bacteria 2513237088 2513595795 255
195 iso_pu_bacteria 2513237138 2513870465 255
196 iso_pu_bacteria 2516143018 2516207721 255
197 iso_pu_bacteria 2524023209 2524463213 255
198 iso_pu_bacteria 2534681796 2535519903 255
199 iso_pu_bacteria 2582581294 2585204741 255
200 iso_pu_bacteria 2582581867 2585401339 255
201 iso_pu_bacteria 2585427590 2585821516 255
202 iso_pu_bacteria 2643221599 2644003546 255
203 iso_pu_bacteria 2751185821 2753463786 255
204 iso_pu_bacteria 2841859092 2841863021 255
205 iso_pu_bacteria 2842298080 2842303923 255
206 iso_pu_bacteria 2842515876 2842519462 255
207 iso_pu_bacteria 2923556063 2923560396 255
208 iso_pu_bacteria 2933011516 2933016667 255
209 iso_pu_bacteria 2996887358 2996891267 255
210 iso_pu_bacteria 3005452660 3005458433 255
211 iso_pu_bacteria 8005258706 8005263816 255
212 iso_pu_bacteria 8005321885 8005325794 255
213 iso_pu_bacteria 8005542996 8005547627 255
214 3300026121 Ga0207683_10110322 Ga0207683_101103222 256
215 iso_pu_bacteria 2582581306 2585268662 256
216 iso_pu_bacteria 2582581316 2585334901 256
217 iso_pu_bacteria 2615840698 2616552760 256
218 iso_pu_bacteria 2667528174 2671114288 256
219 iso_pu_bacteria 2775506902 2776267814 256
220 iso_pu_bacteria 2775506904 2776281785 256
221 iso_pu_bacteria 2791355082 2792583553 256
222 iso_pu_bacteria 2808606387 2808990096 256
223 iso_pu_bacteria 2818991448 2819608073 256
224 iso_pu_bacteria 2838029111 2838030606 256
225 iso_pu_bacteria 2842475841 2842477113 256
226 iso_pu_bacteria 2842482326 2842485976 256
227 iso_pu_bacteria 2842502639 2842503910 256
228 iso_pu_bacteria 2919408235 2919412385 256
229 iso_pu_bacteria 2989349275 2989354522 256
230 iso_pu_bacteria 3005416602 3005420579 256
231 iso_pu_bacteria 8005314921 8005318000 256
232 iso_pu_bacteria 8005484373 8005487703 256
233 iso_pu_bacteria 8005645114 8005650350 256
234 iso_pu_bacteria 8005682033 8005683799 256
235 iso_pu_bacteria 8049293176 8049297933 256
236 iso_pu_bacteria 8055431914 8055436156 256
237 iso_pu_bacteria 2524023207 2524451245 257
238 iso_pu_bacteria 2916000859 2916004518 257
239 iso_pu_bacteria 2924179722 2924179830 257
240 iso_pu_bacteria 2970095765 2970096066 257
241 3300009763 Ga0123340_1051829 Ga0123340_10518293 258
242 3300009765 Ga0123341_1070096 Ga0123341_10700963 258
243 3300003771 Ga0055526_1027977 Ga0055526_10279773 259
244 3300003775 Ga0055524_1007404 Ga0055524_10074042 259
245 3300003790 Ga0055528_1012178 Ga0055528_10121784 259
246 3300003792 Ga0055540_1011084 Ga0055540_10110844 259
247 3300005355 Ga0070671_100052708 Ga0070671_1000527084 259
248 3300005367 Ga0070667_100697888 Ga0070667_1006978881 259
249 3300005985 Ga0081539_10043493 Ga0081539_100434933 259
250 3300006038 Ga0075365_10000188 Ga0075365_100001889 259
251 3300006048 Ga0075363_100099552 Ga0075363_1000995523 259
252 3300006177 Ga0075362_10211394 Ga0075362_102113942 259
253 3300006178 Ga0075367_10000065 Ga0075367_100000657 259
254 3300006186 Ga0075369_10000260 Ga0075369_100002607 259
255 3300009092 Ga0105250_10071593 Ga0105250_100715932 259
256 3300009177 Ga0105248_10070539 Ga0105248_100705394 259
257 3300025258 Ga0209129_1004779 Ga0209129_10047795 259
258 3300025273 Ga0209673_1036273 Ga0209673_10362732 259
259 3300025294 Ga0209025_1035598 Ga0209025_10355983 259
260 3300025297 Ga0209758_1032847 Ga0209758_10328473 259
261 3300025302 Ga0207426_1001794 Ga0207426_100179410 259
262 3300025303 Ga0209051_1000909 Ga0209051_100090922 259
263 3300025931 Ga0207644_10102252 Ga0207644_101022523 259
264 3300048908 Ga0496105_0181334 Ga0496105_0181334_84_863 259
265 3300048911 Ga0496108_0478840 Ga0496108_0478840_94_873 259
266 3300048913 Ga0496110_0315266 Ga0496110_0315266_481_1260 259
267 3300048914 Ga0496111_0268394 Ga0496111_0268394_271_1050 259
268 3300048923 Ga0496120_0104267 Ga0496120_0104267_538_1317 259
269 3300048927 Ga0496124_0070659 Ga0496124_0070659_501_1280 259
270 iso_pu_bacteria 2837651117 2837654380 259
271 iso_pu_bacteria 3003665799 3003672004 259
272 iso_pu_bacteria 643348564 643601036 259
273 3300001979 JGI24740J21852_10029556 JGI24740J21852_100295562 260
274 3300001979 JGI24740J21852_10050565 JGI24740J21852_100505652 260
275 3300002704 JGI25155J39150_1000020 JGI25155J39150_100002022 260
276 3300002705 JGI25156J39149_1000021 JGI25156J39149_1000021126 260
277 3300002737 JGI25162J39368_1000476 JGI25162J39368_10004766 260
278 3300002737 JGI25162J39368_1001403 JGI25162J39368_100140313 260
279 3300002738 JGI25154J39366_1000039 JGI25154J39366_100003922 260
280 3300002741 JGI25157J39369_1000019 JGI25157J39369_1000019126 260
281 3300003214 JGI25165J46597_1000068 JGI25165J46597_100006841 260
282 3300003214 JGI25165J46597_1000537 JGI25165J46597_100053714 260
283 3300003323 rootH1_10034734 rootH1_100347343 260
284 3300021320 Ga0214544_1000029 Ga0214544_1000029119 260
285 3300021321 Ga0214542_1000092 Ga0214542_100009287 260
286 3300021327 Ga0214543_1000045 Ga0214543_1000045119 260
287 3300025206 Ga0209435_100025 Ga0209435_10002546 260
288 3300025233 Ga0209437_100023 Ga0209437_10002377 260
289 3300025233 Ga0209437_100067 Ga0209437_100067119 260
290 3300025246 Ga0209646_1000083 Ga0209646_100008346 260
291 3300025250 Ga0209026_1000078 Ga0209026_100007846 260
292 3300025256 Ga0209759_1000060 Ga0209759_100006046 260
293 3300025256 Ga0209759_1020250 Ga0209759_10202502 260
294 3300025261 Ga0209233_1000088 Ga0209233_1000088119 260
295 3300025261 Ga0209233_1000219 Ga0209233_100021977 260
296 3300025303 Ga0209051_1013339 Ga0209051_10133393 260
297 3300026078 Ga0207702_10018453 Ga0207702_100184535 260
298 3300028794 Ga0307515_10007099 Ga0307515_1000709910 260
299 3300028794 Ga0307515_10055819 Ga0307515_100558195 260
300 3300030500 Ga0268256_1001086 Ga0268256_100108610 260
301 3300031456 Ga0307513_10042369 Ga0307513_100423695 260
302 3300031852 Ga0307410_10157125 Ga0307410_101571252 260
303 3300044684 Ga0466966_0122023 Ga0466966_0122023_608_1390 260
304 3300044765 Ga0466970_0000741 Ga0466970_0000741_10896_11678 260
305 3300044842 Ga0466957_0002063 Ga0466957_0002063_1268_2050 260
306 3300045836 Ga0466958_0031809 Ga0466958_0031809_583_1365 260
307 3300048912 Ga0496109_0179539 Ga0496109_0179539_232_1083 260
308 3300048922 Ga0496119_0022631 Ga0496119_0022631_730_1512 260
309 3300048923 Ga0496120_0019298 Ga0496120_0019298_1450_2232 260
310 3300048928 Ga0496125_0053529 Ga0496125_0053529_1553_2335 260
311 3300049570 Ga0501033_0000942 Ga0501033_0000942_24637_25488 260
312 3300049570 Ga0501033_0255414 Ga0501033_0255414_236_1087 260
313 3300049571 Ga0501034_0158480 Ga0501034_0158480_513_1364 260
314 3300049571 Ga0501034_0548817 Ga0501034_0548817_114_965 260
315 3300049573 Ga0501037_0014354 Ga0501037_0014354_772_1623 260
316 3300053125 Ga0500618_001473 Ga0500618_001473_2262_3044 260
317 3300061719 Ga0466962_0030014 Ga0466962_0030014_369_1151 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

1

249

0.98

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

244

315

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9944 17 249
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9875 14 260
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.987 13 260
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.9817 17 249
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.9796 14 260
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9873 13 260 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9794 13 260 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8602 12 224 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8444 8 254 1.20.1260.10
4mudC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8128 12 224 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A519PAS0-F1-model_v4 deleted 0.9987 12 115
AF-A0A533J113-F1-model_v4 deleted 0.9967 15 160
AF-A0A699WU94-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9961 50 170 GO:0005829
GO:0010124
AF-A0A2N2ZBI9-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9958 11 167 GO:0005829
GO:0010124
AF-A0A3D3K2S3-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9951 15 119 GO:0005829
GO:0010124

Feature Viewer

pLDDT pTM Quality
94.32 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map