F403168

General Info

Members Datasets Scaffolds Average Seq Length
315 228 266 448

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000148|Ga0157369_1000014877
Length 499
Sequence MSTVASVAQPAPLPAVRNRRRWCVAGVAATAACGAAAGYNCVLSSSIDSMSRKNPKVGFVSLGCPKALVDSERILTQLRVEGYEIVPSYGAADVVVVNTCGFIDAAVQESLDAIGEALAENGKVIVTGCLGKRADVIREAHPDVLAITGPQDYASVMSAVHTQLPPKHDPFVDIVPRARSRKSAPSDDIGVKLTPRHYAYLKISEGCNHRCTFCIIPSMRGDLVSRPVDEVLREAERLAKSGVRELLVISQDTSAYGVDVKYAAHEWRGAKYRTRMTELCEGLAQLGTWVRLHYVYPYPHVDEVIPLMAEGRILPYLDIPFQHASPRILKLMKRPAASARTLERIRAWRRVCPELTIRSTFIVGFPGETEAEFDELLAFLDEAQLDRVGAFAYSPVDGAKANELAGGVAEETKQERLERFMARQAGISAAKLKRRVDQVVDALVDHVDADGAVARTSADAPEIDGVLRIRDGQKLKAGQFVKVRVTAAEDHDLAGELAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221695 Lysobacter sp. Root494 Isolate Unclassified
13 2643221720 Lysobacter sp. Root916 Isolate Unclassified
14 2643221727 Lysobacter sp. Root96 Isolate Unclassified
15 2643221728 Lysobacter sp. Root983 Isolate Unclassified
16 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
17 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
18 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
19 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
20 2818991457 Xanthomonas translucens 569 Isolate Unclassified
21 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
22 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
23 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
24 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
25 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
26 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
27 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
28 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
29 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
30 2919513703 Luteimonas sp. 3794 Isolate Unclassified
31 2919675420 Luteimonas terrae 4099 Isolate Unclassified
32 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
33 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
34 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
35 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
36 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
37 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
38 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
39 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
40 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
41 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
42 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
43 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
44 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
45 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
46 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
53 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
54 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
55 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
56 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
57 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
87 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
143 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
158 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
159 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
174 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
183 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
226 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
227 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
228 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.44
Metatranscriptomes 0
Isolates 15.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 16.83
Nodule 0.32
Rhizoplane 2.86
Rhizosphere 63.17
Stem 0
Stem Tuber 0
Unclassified 16.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2056178 2162886007 Bacteria 5019
2 JGI25157J39369_1000764 3300002741 Bacteria 16694
3 JGI25151J46595_10000258 3300003187 Bacteria 62040
4 JGI25151J46595_10010881 3300003187 Bacteria 4208
5 Ga0055526_1000024 3300003771 Bacteria 158479
6 Ga0055526_1018613 3300003771 Bacteria 2582
7 Ga0055537_1000180 3300003773 Bacteria 47002
8 Ga0055537_1002818 3300003773 Bacteria 5581
9 Ga0055524_1000174 3300003775 Bacteria 73269
10 Ga0055536_1007141 3300003781 Bacteria 5057
11 Ga0055534_1000034 3300003784 Bacteria 114684
12 Ga0055534_1000084 3300003784 Bacteria 73269
13 Ga0055528_1000016 3300003790 Bacteria 158479
14 Ga0055528_1000671 3300003790 Bacteria 24792
15 Ga0055530_10001263 3300003791 Bacteria 19146
16 Ga0058692_1000011 3300003856 Bacteria 321321
17 Ga0065165_1001695 3300005262 Bacteria 22204
18 Ga0065704_10006470 3300005289 Bacteria 4592
19 Ga0065704_10070427 3300005289 Bacteria 25272
20 Ga0065715_10137376 3300005293 Bacteria 1908
21 Ga0068869_100059242 3300005334 Bacteria 2803
22 Ga0070680_100151279 3300005336 Bacteria 1948
23 Ga0068868_100006092 3300005338 Bacteria 8516
24 Ga0070669_100004652 3300005353 Bacteria 9904
25 Ga0070671_100081479 3300005355 Bacteria 2706
26 Ga0070674_100031256 3300005356 Bacteria 3527
27 Ga0070667_100061756 3300005367 Bacteria 3173
28 Ga0070667_100067170 3300005367 Bacteria 3048
29 Ga0070667_100133851 3300005367 Bacteria 2166
30 Ga0070714_100109254 3300005435 Bacteria 2446
31 Ga0070678_100016576 3300005456 Bacteria 4718
32 Ga0070678_100120471 3300005456 Bacteria 2068
33 Ga0068867_100045980 3300005459 Bacteria 3204
34 Ga0068867_100072879 3300005459 Bacteria 2571
35 Ga0068867_100124529 3300005459 Bacteria 1996
36 Ga0070679_100089650 3300005530 Bacteria 3062
37 Ga0070672_100005520 3300005543 Bacteria 8391
38 Ga0070672_100017070 3300005543 Bacteria 5215
39 Ga0070672_100038756 3300005543 Bacteria 3645
40 Ga0070686_100049701 3300005544 Bacteria 2662
41 Ga0070665_100032373 3300005548 Bacteria 5262
42 Ga0068856_100025522 3300005614 Bacteria 5763
43 Ga0068863_100041628 3300005841 Bacteria 4369
44 Ga0068860_100005745 3300005843 Bacteria 12514
45 Ga0081540_1001580 3300005983 Bacteria 19463
46 Ga0075363_100067516 3300006048 Bacteria 1938
47 Ga0075366_10017998 3300006195 Bacteria 4077
48 Ga0068865_100006430 3300006881 Bacteria 7165
49 Ga0105240_10001191 3300009093 Bacteria 45336
50 Ga0105240_10035926 3300009093 Bacteria 6380
51 Ga0105240_10109214 3300009093 Bacteria 3350
52 Ga0105243_10026315 3300009148 Bacteria 4453
53 Ga0105242_10000996 3300009176 Bacteria 22202
54 Ga0105237_10082411 3300009545 Bacteria 3207
55 Ga0105249_10040629 3300009553 Bacteria 4226
56 Ga0105148_100627 3300009978 Bacteria 2894
57 Ga0105032_100251 3300009979 Bacteria 5516
58 Ga0105239_10012083 3300010375 Bacteria 9630
59 Ga0105239_10042318 3300010375 Bacteria 4992
60 Ga0157371_10031735 3300013102 Bacteria 3805
61 Ga0157371_10038104 3300013102 Bacteria 3440
62 Ga0157370_10005472 3300013104 Bacteria 14240
63 Ga0157369_10000148 3300013105 Bacteria 100073
64 Ga0157369_10027306 3300013105 Bacteria 6329
65 Ga0157369_10412819 3300013105 Bacteria 1400
66 Ga0157378_10000130 3300013297 Bacteria 72949
67 Ga0163162_10034358 3300013306 Bacteria 5046
68 Ga0157372_10022899 3300013307 Bacteria 6765
69 Ga0157372_10149167 3300013307 Bacteria 2698
70 Ga0157375_10000256 3300013308 Bacteria 48304
71 Ga0157375_10070391 3300013308 Bacteria 3508
72 Ga0182008_10000142 3300014497 Bacteria 55320
73 Ga0157379_10124887 3300014968 Bacteria 2316
74 Ga0157376_10000254 3300014969 Bacteria 36962
75 Ga0182006_1047257 3300015261 Bacteria 1669
76 Ga0182007_10000287 3300015262 Bacteria 33403
77 Ga0182005_1000586 3300015265 Bacteria 17924
78 Ga0183360_10001 3300015689 Bacteria 3943671
79 Ga0207425_1005224 3300025245 Bacteria 3733
80 Ga0209026_1000051 3300025250 Bacteria 250792
81 Ga0209759_1010001 3300025256 Bacteria 2820
82 Ga0209565_1000001 3300025263 Bacteria 2950419
83 Ga0209565_1000022 3300025263 Bacteria 390888
84 Ga0209673_1000001 3300025273 Bacteria 3176258
85 Ga0209673_1000104 3300025273 Bacteria 186569
86 Ga0209673_1005405 3300025273 Bacteria 6436
87 Ga0209675_1000001 3300025291 Bacteria 2950293
88 Ga0209675_1000048 3300025291 Bacteria 221457
89 Ga0209676_1000024 3300025292 Bacteria 578839
90 Ga0209676_1000091 3300025292 Bacteria 251328
91 Ga0209676_1000117 3300025292 Bacteria 203251
92 Ga0209676_1001279 3300025292 Bacteria 26055
93 Ga0209676_1002976 3300025292 Bacteria 11028
94 Ga0209676_1006158 3300025292 Bacteria 6013
95 Ga0209025_1000015 3300025294 Bacteria 808120
96 Ga0209025_1001699 3300025294 Bacteria 26850
97 Ga0209025_1007492 3300025294 Bacteria 8114
98 Ga0209564_1000001 3300025295 Bacteria 3176258
99 Ga0209564_1000213 3300025295 Bacteria 132985
100 Ga0209758_1013741 3300025297 Bacteria 4383
101 Ga0209758_1018913 3300025297 Bacteria 3351
102 Ga0209050_1000603 3300025298 Bacteria 57120
103 Ga0209050_1001640 3300025298 Bacteria 22906
104 Ga0209256_1000002 3300025299 Bacteria 1906740
105 Ga0209256_1004116 3300025299 Bacteria 9417
106 Ga0209256_1004506 3300025299 Bacteria 8700
107 Ga0209051_1007946 3300025303 Bacteria 5708
108 Ga0209051_1010883 3300025303 Bacteria 4545
109 Ga0209257_1000062 3300025304 Bacteria 362413
110 Ga0209257_1000122 3300025304 Bacteria 219678
111 Ga0209257_1000243 3300025304 Bacteria 126291
112 Ga0209257_1001842 3300025304 Bacteria 23103
113 Ga0209257_1005770 3300025304 Bacteria 8451
114 Ga0209257_1009842 3300025304 Bacteria 4999
115 Ga0207713_1009809 3300025735 Bacteria 5361
116 Ga0207643_10076215 3300025908 Bacteria 1937
117 Ga0207695_10000033 3300025913 Bacteria 507477
118 Ga0207695_10002942 3300025913 Bacteria 24581
119 Ga0207695_10044610 3300025913 Bacteria 4713
120 Ga0207671_10003439 3300025914 Bacteria 15793
121 Ga0207681_10040514 3300025923 Bacteria 3100
122 Ga0207694_10010189 3300025924 Bacteria 7085
123 Ga0207650_10017906 3300025925 Bacteria 4964
124 Ga0207664_10076914 3300025929 Bacteria 2702
125 Ga0207644_10005884 3300025931 Bacteria 7997
126 Ga0207686_10002921 3300025934 Bacteria 9219
127 Ga0207709_10001041 3300025935 Bacteria 20489
128 Ga0207704_10004846 3300025938 Bacteria 6178
129 Ga0207691_10003341 3300025940 Bacteria 15612
130 Ga0207691_10004046 3300025940 Bacteria 14219
131 Ga0207668_10068110 3300025972 Bacteria 2529
132 Ga0207640_10142119 3300025981 Bacteria 1751
133 Ga0207677_10004818 3300026023 Bacteria 7282
134 Ga0207708_10090857 3300026075 Bacteria 2354
135 Ga0207702_10003198 3300026078 Bacteria 15125
136 Ga0207641_10074679 3300026088 Bacteria 2925
137 Ga0207648_10064140 3300026089 Bacteria 3202
138 Ga0207648_10077578 3300026089 Bacteria 2896
139 Ga0207683_10029007 3300026121 Bacteria 4789
140 Ga0207683_10045191 3300026121 Bacteria 3851
141 Ga0209371_1000007 3300027312 Bacteria 1050654
142 Ga0209371_1000016 3300027312 Bacteria 646301
143 Ga0268266_10027764 3300028379 Bacteria 4812
144 Ga0268266_10162211 3300028379 Bacteria 2023
145 Ga0268264_10006637 3300028381 Bacteria 9729
146 Ga0268256_1000008 3300030500 Bacteria 1050654
147 Ga0268256_1000015 3300030500 Bacteria 646300
148 Ga0316176_1198490 3300030732 Bacteria 4083
149 Ga0316182_1149691 3300030745 Bacteria 1957
150 Ga0265331_10026829 3300031250 Bacteria 2892
151 Ga0265331_10059225 3300031250 Bacteria 1811
152 Ga0307408_100024108 3300031548 Bacteria 4151
153 Ga0307516_10115383 3300031730 Bacteria 2482
154 Ga0307413_10002658 3300031824 Bacteria 7319
155 Ga0307406_10110429 3300031901 Bacteria 1892
156 Ga0307414_10033527 3300032004 Bacteria 3395
157 Ga0307414_10137875 3300032004 Bacteria 1905
158 Ga0307414_10144643 3300032004 Bacteria 1866
159 Ga0373925_0129161 3300037068 Bacteria 1969
160 Ga0395899_0016309 3300037312 Bacteria 5662
161 Ga0395900_0002475 3300037418 Bacteria 20305
162 Ga0395900_0023736 3300037418 Bacteria 6274
163 Ga0395900_0025570 3300037418 Bacteria 6044
164 Ga0395905_0000503 3300037471 Bacteria 53661
165 Ga0395905_0053604 3300037471 Bacteria 3774
166 Ga0395901_0002493 3300038443 Bacteria 18647
167 Ga0237819_00151 3300038705 Bacteria 25521
168 Ga0436365_1251902 3300039437 Bacteria 3291
169 Ga0439436_0018837 3300041404 Bacteria 2063
170 Ga0439436_0026735 3300041404 Bacteria 1690
171 Ga0451791_0244412 3300041451 Bacteria 5929
172 Ga0451793_1612891 3300041452 Bacteria 2870
173 Ga0451807_0133933 3300041486 Bacteria 2670
174 Ga0451837_1409641 3300041494 Bacteria 9774
175 Ga0451577_0006259 3300042876 Bacteria 11926
176 Ga0451577_0089734 3300042876 Bacteria 2743
177 Ga0466961_0141255 3300044693 Bacteria 1507
178 Ga0453684_0000069 3300044712 Bacteria 456439
179 Ga0453684_0000468 3300044712 Bacteria 160571
180 Ga0453684_0001003 3300044712 Bacteria 91525
181 Ga0466971_0008618 3300044719 Bacteria 4448
182 Ga0466957_0014324 3300044842 Bacteria 4616
183 Ga0466959_0078167 3300045049 Bacteria 2386
184 Ga0451576_0000177 3300045051 Bacteria 160589
185 Ga0466958_0001437 3300045836 Bacteria 11290
186 Ga0495643_0003677 3300046522 Bacteria 11123
187 Ga0495663_0006930 3300046525 Bacteria 3126
188 Ga0495668_0001124 3300046616 Bacteria 27580
189 Ga0495668_0041554 3300046616 Bacteria 2561
190 Ga0495636_0000567 3300047318 Bacteria 13609
191 Ga0495672_0000073 3300047320 Bacteria 179398
192 Ga0495686_0020538 3300047472 Bacteria 4402
193 Ga0496101_0010319 3300048904 Bacteria 6168
194 Ga0496103_0005099 3300048906 Bacteria 7912
195 Ga0496104_0000011 3300048907 Bacteria 459358
196 Ga0496105_0000014 3300048908 Bacteria 220911
197 Ga0496113_0077087 3300048916 Bacteria 2548
198 Ga0496115_0000148 3300048918 Bacteria 64816
199 Ga0496116_0008602 3300048919 Bacteria 8833
200 Ga0496117_0014010 3300048920 Bacteria 6939
201 Ga0496118_0000344 3300048921 Bacteria 78989
202 Ga0496118_0003355 3300048921 Bacteria 20262
203 Ga0496119_0002556 3300048922 Bacteria 19810
204 Ga0496120_0002304 3300048923 Bacteria 19766
205 Ga0496121_0006617 3300048924 Bacteria 14283
206 Ga0496122_0018183 3300048925 Bacteria 6509
207 Ga0496123_0011777 3300048926 Bacteria 7533
208 Ga0496124_0000281 3300048927 Bacteria 97214
209 Ga0496124_0002984 3300048927 Bacteria 21170
210 Ga0496124_0021641 3300048927 Bacteria 5922
211 Ga0496125_0006523 3300048928 Bacteria 12582
212 Ga0496125_0024645 3300048928 Bacteria 5526
213 Ga0496126_0000033 3300048929 Bacteria 368851
214 Ga0496126_0004042 3300048929 Bacteria 17849
215 Ga0496126_0007989 3300048929 Bacteria 11486
216 Ga0501031_0042678 3300049568 Bacteria 2960
217 Ga0501034_0000122 3300049571 Bacteria 144085
218 Ga0501034_0001021 3300049571 Bacteria 40111
219 Ga0501034_0006427 3300049571 Bacteria 12655
220 Ga0501034_0043390 3300049571 Bacteria 4551
221 Ga0501034_0089984 3300049571 Bacteria 3067
222 Ga0501036_0035387 3300049572 Bacteria 4227
223 Ga0501037_0003999 3300049573 Bacteria 10688
224 Ga0501037_0129623 3300049573 Bacteria 1809
225 Ga0501037_0130915 3300049573 Bacteria 1799
226 Ga0501039_0022764 3300049575 Bacteria 4806
227 Ga0501039_0031426 3300049575 Bacteria 4093
228 Ga0501040_0015341 3300049576 Bacteria 5067
229 Ga0501040_0044739 3300049576 Bacteria 3019
230 Ga0501041_0024872 3300049577 Bacteria 3597
231 Ga0501043_0011429 3300049579 Bacteria 6951
232 Ga0501043_0089173 3300049579 Bacteria 2424
233 Ga0501043_0175383 3300049579 Bacteria 1671
234 Ga0501046_0081907 3300049580 Bacteria 2493
235 Ga0501047_0000533 3300049581 Bacteria 41217
236 Ga0501048_0096536 3300049582 Bacteria 2084
237 Ga0501067_0000630 3300049583 Bacteria 18924
238 Ga0501067_0014578 3300049583 Bacteria 4351
239 Ga0501068_0018053 3300049584 Bacteria 4085
240 Ga0501069_0011289 3300049585 Bacteria 4737
241 Ga0501070_0006690 3300049586 Bacteria 9818
242 Ga0501070_0008704 3300049586 Bacteria 8581
243 Ga0501071_0042207 3300049587 Bacteria 3267
244 Ga0501071_0058740 3300049587 Bacteria 2781
245 Ga0501072_0002457 3300049588 Bacteria 13872
246 Ga0501072_0041196 3300049588 Bacteria 3627
247 Ga0501074_0016708 3300049590 Bacteria 5325
248 Ga0501075_0036183 3300049591 Bacteria 3684
249 Ga0501076_0003796 3300049592 Bacteria 10640
250 Ga0501209_000265 3300049656 Bacteria 6327
251 Ga0501079_0001417 3300049741 Bacteria 16920
252 Ga0501079_0028322 3300049741 Bacteria 4297
253 Ga0501080_0004234 3300049742 Bacteria 12728
254 Ga0501080_0050371 3300049742 Bacteria 3876
255 Ga0501081_0005745 3300049743 Bacteria 8034
256 Ga0501083_0001373 3300049744 Bacteria 16526
257 Ga0501275_000264 3300049772 Bacteria 6020
258 Ga0501035_0081182 3300049822 Bacteria 2862
259 Ga0501035_0112804 3300049822 Bacteria 2381
260 Ga0501044_0055759 3300049823 Bacteria 4058
261 Ga0501044_0056249 3300049823 Bacteria 4038
262 Ga0501044_0210759 3300049823 Bacteria 1897
263 nmdc:mga00v17_33402_c1 3300050491 Bacteria 3048
264 Ga0500651_0000788 3300053093 Bacteria 15475
265 Ga0500566_0057469 3300053094 Bacteria 2210
266 Ga0466962_0053161 3300061719 Bacteria 1935

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0018183 Ga0496122_0018183_19_1134 361
2 3300025972 Ga0207668_10068110 Ga0207668_100681102 386
3 3300025908 Ga0207643_10076215 Ga0207643_100762152 387
4 3300041452 Ga0451793_1612891 Ga0451793_1612891_1668_2846 390
5 3300037418 Ga0395900_0002475 Ga0395900_0002475_15078_16259 392
6 3300049571 Ga0501034_0043390 Ga0501034_0043390_2791_4143 407
7 3300049575 Ga0501039_0022764 Ga0501039_0022764_744_2096 407
8 3300049576 Ga0501040_0015341 Ga0501040_0015341_2544_3896 407
9 3300049582 Ga0501048_0096536 Ga0501048_0096536_536_1888 407
10 3300049583 Ga0501067_0014578 Ga0501067_0014578_400_1752 407
11 3300049587 Ga0501071_0058740 Ga0501071_0058740_605_1957 407
12 3300049588 Ga0501072_0041196 Ga0501072_0041196_478_1830 407
13 3300049590 Ga0501074_0016708 Ga0501074_0016708_2565_3917 407
14 3300049741 Ga0501079_0028322 Ga0501079_0028322_197_1549 407
15 3300049822 Ga0501035_0112804 Ga0501035_0112804_239_1591 407
16 3300049823 Ga0501044_0056249 Ga0501044_0056249_391_1743 407
17 3300005983 Ga0081540_1001580 Ga0081540_100158014 414
18 3300026075 Ga0207708_10090857 Ga0207708_100908573 414
19 3300047472 Ga0495686_0020538 Ga0495686_0020538_212_1492 416
20 3300049579 Ga0501043_0175383 Ga0501043_0175383_272_1624 416
21 3300049822 Ga0501035_0081182 Ga0501035_0081182_28_1470 416
22 3300049823 Ga0501044_0055759 Ga0501044_0055759_88_1440 416
23 3300009979 Ga0105032_100251 Ga0105032_1002513 423
24 3300031730 Ga0307516_10115383 Ga0307516_101153831 427
25 3300005262 Ga0065165_1001695 Ga0065165_10016958 430
26 3300025297 Ga0209758_1018913 Ga0209758_10189132 430
27 3300049572 Ga0501036_0035387 Ga0501036_0035387_2190_3485 430
28 3300049573 Ga0501037_0130915 Ga0501037_0130915_274_1569 430
29 3300049575 Ga0501039_0031426 Ga0501039_0031426_770_2065 430
30 3300049576 Ga0501040_0044739 Ga0501040_0044739_440_1735 430
31 3300049577 Ga0501041_0024872 Ga0501041_0024872_2174_3469 430
32 3300049579 Ga0501043_0089173 Ga0501043_0089173_541_1836 430
33 3300049580 Ga0501046_0081907 Ga0501046_0081907_683_1978 430
34 3300049587 Ga0501071_0042207 Ga0501071_0042207_1917_3212 430
35 3300049591 Ga0501075_0036183 Ga0501075_0036183_583_1878 430
36 3300049592 Ga0501076_0003796 Ga0501076_0003796_2124_3419 430
37 3300049742 Ga0501080_0050371 Ga0501080_0050371_679_1974 430
38 3300049743 Ga0501081_0005745 Ga0501081_0005745_4239_5534 430
39 3300049571 Ga0501034_0089984 Ga0501034_0089984_1496_2827 432
40 3300049573 Ga0501037_0003999 Ga0501037_0003999_2131_3462 432
41 3300049823 Ga0501044_0210759 Ga0501044_0210759_52_1383 432
42 3300005356 Ga0070674_100031256 Ga0070674_1000312562 434
43 3300005459 Ga0068867_100124529 Ga0068867_1001245292 434
44 3300005543 Ga0070672_100005520 Ga0070672_1000055206 434
45 3300009093 Ga0105240_10001191 Ga0105240_1000119120 434
46 3300025913 Ga0207695_10000033 Ga0207695_10000033270 434
47 3300025925 Ga0207650_10017906 Ga0207650_100179065 434
48 3300025940 Ga0207691_10003341 Ga0207691_1000334114 434
49 3300026089 Ga0207648_10077578 Ga0207648_100775783 434
50 3300042876 Ga0451577_0006259 Ga0451577_0006259_5893_7230 434
51 3300044712 Ga0453684_0001003 Ga0453684_0001003_13292_14605 435
52 3300006195 Ga0075366_10017998 Ga0075366_100179982 437
53 3300025299 Ga0209256_1004116 Ga0209256_10041162 437
54 3300031250 Ga0265331_10026829 Ga0265331_100268292 437
55 3300031250 Ga0265331_10059225 Ga0265331_100592252 437
56 3300042876 Ga0451577_0089734 Ga0451577_0089734_376_1707 437
57 3300044712 Ga0453684_0000069 Ga0453684_0000069_35585_36952 437
58 3300049571 Ga0501034_0006427 Ga0501034_0006427_10141_11460 437
59 3300049573 Ga0501037_0129623 Ga0501037_0129623_98_1417 437
60 3300049581 Ga0501047_0000533 Ga0501047_0000533_1311_2630 437
61 3300049583 Ga0501067_0000630 Ga0501067_0000630_7906_9225 437
62 3300049584 Ga0501068_0018053 Ga0501068_0018053_516_1835 437
63 3300049585 Ga0501069_0011289 Ga0501069_0011289_2233_3552 437
64 3300049586 Ga0501070_0008704 Ga0501070_0008704_3480_4799 437
65 3300049588 Ga0501072_0002457 Ga0501072_0002457_19_1338 437
66 3300049741 Ga0501079_0001417 Ga0501079_0001417_5620_6936 437
67 3300049742 Ga0501080_0004234 Ga0501080_0004234_11350_12669 437
68 3300049744 Ga0501083_0001373 Ga0501083_0001373_7049_8368 437
69 3300050491 nmdc:mga00v17_33402_c1 nmdc:mga00v17_33402_c1_599_1969 437
70 3300013297 Ga0157378_10000130 Ga0157378_1000013059 438
71 3300049656 Ga0501209_000265 Ga0501209_000265_3534_4877 438
72 3300002741 JGI25157J39369_1000764 JGI25157J39369_10007647 439
73 3300005334 Ga0068869_100059242 Ga0068869_1000592422 439
74 3300005336 Ga0070680_100151279 Ga0070680_1001512792 439
75 3300005338 Ga0068868_100006092 Ga0068868_1000060922 439
76 3300005353 Ga0070669_100004652 Ga0070669_1000046522 439
77 3300005355 Ga0070671_100081479 Ga0070671_1000814791 439
78 3300005367 Ga0070667_100061756 Ga0070667_1000617562 439
79 3300005367 Ga0070667_100067170 Ga0070667_1000671704 439
80 3300005367 Ga0070667_100133851 Ga0070667_1001338512 439
81 3300005435 Ga0070714_100109254 Ga0070714_1001092542 439
82 3300005456 Ga0070678_100016576 Ga0070678_1000165763 439
83 3300005456 Ga0070678_100120471 Ga0070678_1001204712 439
84 3300005459 Ga0068867_100045980 Ga0068867_1000459802 439
85 3300005459 Ga0068867_100072879 Ga0068867_1000728792 439
86 3300005543 Ga0070672_100017070 Ga0070672_1000170704 439
87 3300005543 Ga0070672_100038756 Ga0070672_1000387562 439
88 3300005544 Ga0070686_100049701 Ga0070686_1000497012 439
89 3300005548 Ga0070665_100032373 Ga0070665_1000323733 439
90 3300005614 Ga0068856_100025522 Ga0068856_1000255225 439
91 3300005841 Ga0068863_100041628 Ga0068863_1000416283 439
92 3300005843 Ga0068860_100005745 Ga0068860_1000057457 439
93 3300006881 Ga0068865_100006430 Ga0068865_1000064307 439
94 3300009093 Ga0105240_10035926 Ga0105240_100359261 439
95 3300009093 Ga0105240_10109214 Ga0105240_101092142 439
96 3300009176 Ga0105242_10000996 Ga0105242_100009965 439
97 3300009545 Ga0105237_10082411 Ga0105237_100824111 439
98 3300009553 Ga0105249_10040629 Ga0105249_100406293 439
99 3300010375 Ga0105239_10012083 Ga0105239_100120836 439
100 3300010375 Ga0105239_10042318 Ga0105239_100423184 439
101 3300013105 Ga0157369_10000148 Ga0157369_1000014877 439
102 3300013306 Ga0163162_10034358 Ga0163162_100343583 439
103 3300013308 Ga0157375_10000256 Ga0157375_1000025611 439
104 3300013308 Ga0157375_10070391 Ga0157375_100703912 439
105 3300014968 Ga0157379_10124887 Ga0157379_101248871 439
106 3300014969 Ga0157376_10000254 Ga0157376_1000025410 439
107 3300025250 Ga0209026_1000051 Ga0209026_100005192 439
108 3300025256 Ga0209759_1010001 Ga0209759_10100012 439
109 3300025913 Ga0207695_10002942 Ga0207695_100029425 439
110 3300025913 Ga0207695_10044610 Ga0207695_100446103 439
111 3300025914 Ga0207671_10003439 Ga0207671_1000343913 439
112 3300025923 Ga0207681_10040514 Ga0207681_100405142 439
113 3300025924 Ga0207694_10010189 Ga0207694_100101895 439
114 3300025929 Ga0207664_10076914 Ga0207664_100769143 439
115 3300025934 Ga0207686_10002921 Ga0207686_100029217 439
116 3300025938 Ga0207704_10004846 Ga0207704_100048464 439
117 3300025940 Ga0207691_10004046 Ga0207691_100040462 439
118 3300026023 Ga0207677_10004818 Ga0207677_100048185 439
119 3300026078 Ga0207702_10003198 Ga0207702_1000319813 439
120 3300026088 Ga0207641_10074679 Ga0207641_100746793 439
121 3300026089 Ga0207648_10064140 Ga0207648_100641402 439
122 3300026121 Ga0207683_10029007 Ga0207683_100290073 439
123 3300026121 Ga0207683_10045191 Ga0207683_100451913 439
124 3300028379 Ga0268266_10027764 Ga0268266_100277643 439
125 3300028381 Ga0268264_10006637 Ga0268264_100066375 439
126 3300037068 Ga0373925_0129161 Ga0373925_0129161_85_1470 439
127 3300039437 Ga0436365_1251902 Ga0436365_1251902_1291_2631 439
128 3300041451 Ga0451791_0244412 Ga0451791_0244412_723_2075 439
129 3300041486 Ga0451807_0133933 Ga0451807_0133933_344_1696 439
130 3300041494 Ga0451837_1409641 Ga0451837_1409641_1987_3339 439
131 3300044693 Ga0466961_0141255 Ga0466961_0141255_65_1444 439
132 3300044719 Ga0466971_0008618 Ga0466971_0008618_2530_3909 439
133 3300044842 Ga0466957_0014324 Ga0466957_0014324_103_1482 439
134 3300045049 Ga0466959_0078167 Ga0466959_0078167_260_1639 439
135 3300045836 Ga0466958_0001437 Ga0466958_0001437_2931_4310 439
136 3300048906 Ga0496103_0005099 Ga0496103_0005099_4525_5862 439
137 3300048907 Ga0496104_0000011 Ga0496104_0000011_56360_57712 439
138 3300048908 Ga0496105_0000014 Ga0496105_0000014_56387_57739 439
139 3300048918 Ga0496115_0000148 Ga0496115_0000148_243_1580 439
140 3300048929 Ga0496126_0000033 Ga0496126_0000033_243042_244379 439
141 3300053093 Ga0500651_0000788 Ga0500651_0000788_11677_12999 439
142 3300053094 Ga0500566_0057469 Ga0500566_0057469_25_1410 439
143 3300061719 Ga0466962_0053161 Ga0466962_0053161_340_1719 439
144 iso_pu_bacteria 2571042365 2572253542 439
145 iso_pu_bacteria 2643221559 2643815293 439
146 iso_pu_bacteria 2643221573 2643879337 439
147 iso_pu_bacteria 2643221586 2643939970 439
148 iso_pu_bacteria 2643221612 2644077026 439
149 iso_pu_bacteria 2643221695 2644528880 439
150 iso_pu_bacteria 2643221720 2644660636 439
151 iso_pu_bacteria 2643221727 2644695340 439
152 iso_pu_bacteria 2643221728 2644697996 439
153 iso_pu_bacteria 2894414249 2894415914 439
154 iso_pu_bacteria 8003014200 8003014599 439
155 3300013307 Ga0157372_10022899 Ga0157372_100228993 440
156 iso_pu_bacteria 2919513703 2919516141 440
157 iso_pu_bacteria 2919675420 2919677975 440
158 iso_pu_bacteria 2939611941 2939612391 440
159 iso_pu_bacteria 8021622325 8021624489 440
160 3300015689 Ga0183360_10001 Ga0183360_100012094 441
161 3300005293 Ga0065715_10137376 Ga0065715_101373761 442
162 3300025931 Ga0207644_10005884 Ga0207644_100058845 442
163 3300037312 Ga0395899_0016309 Ga0395899_0016309_1110_2477 442
164 3300037418 Ga0395900_0023736 Ga0395900_0023736_1178_2545 442
165 3300037471 Ga0395905_0000503 Ga0395905_0000503_19142_20509 442
166 3300037471 Ga0395905_0053604 Ga0395905_0053604_2031_3491 442
167 3300038443 Ga0395901_0002493 Ga0395901_0002493_9793_11160 442
168 3300048904 Ga0496101_0010319 Ga0496101_0010319_990_2357 442
169 3300049586 Ga0501070_0006690 Ga0501070_0006690_3348_4715 442
170 iso_pu_bacteria 2941489479 2941493783 442
171 3300003187 JGI25151J46595_10000258 JGI25151J46595_1000025852 443
172 3300003187 JGI25151J46595_10010881 JGI25151J46595_100108815 443
173 3300003771 Ga0055526_1000024 Ga0055526_100002429 443
174 3300003771 Ga0055526_1018613 Ga0055526_10186132 443
175 3300003773 Ga0055537_1000180 Ga0055537_100018014 443
176 3300003775 Ga0055524_1000174 Ga0055524_100017436 443
177 3300003784 Ga0055534_1000084 Ga0055534_100008436 443
178 3300003790 Ga0055528_1000016 Ga0055528_100001629 443
179 3300003791 Ga0055530_10001263 Ga0055530_1000126312 443
180 3300009978 Ga0105148_100627 Ga0105148_1006272 443
181 3300025245 Ga0207425_1005224 Ga0207425_10052242 443
182 3300025263 Ga0209565_1000001 Ga0209565_10000011725 443
183 3300025273 Ga0209673_1000001 Ga0209673_10000011725 443
184 3300025273 Ga0209673_1005405 Ga0209673_10054058 443
185 3300025291 Ga0209675_1000001 Ga0209675_1000001807 443
186 3300025292 Ga0209676_1001279 Ga0209676_100127921 443
187 3300025292 Ga0209676_1002976 Ga0209676_10029764 443
188 3300025292 Ga0209676_1006158 Ga0209676_10061586 443
189 3300025294 Ga0209025_1000015 Ga0209025_1000015341 443
190 3300025294 Ga0209025_1001699 Ga0209025_100169916 443
191 3300025294 Ga0209025_1007492 Ga0209025_10074922 443
192 3300025295 Ga0209564_1000001 Ga0209564_1000001969 443
193 3300025297 Ga0209758_1013741 Ga0209758_10137411 443
194 3300025298 Ga0209050_1000603 Ga0209050_100060334 443
195 3300025299 Ga0209256_1000002 Ga0209256_1000002583 443
196 3300025303 Ga0209051_1007946 Ga0209051_10079463 443
197 3300025304 Ga0209257_1000243 Ga0209257_100024329 443
198 3300025304 Ga0209257_1001842 Ga0209257_100184211 443
199 3300031548 Ga0307408_100024108 Ga0307408_1000241085 443
200 3300031824 Ga0307413_10002658 Ga0307413_100026582 443
201 3300031901 Ga0307406_10110429 Ga0307406_101104291 443
202 3300032004 Ga0307414_10144643 Ga0307414_101446431 443
203 3300041404 Ga0439436_0018837 Ga0439436_0018837_232_1605 443
204 3300041404 Ga0439436_0026735 Ga0439436_0026735_73_1449 443
205 3300046616 Ga0495668_0001124 Ga0495668_0001124_12981_14339 443
206 3300046616 Ga0495668_0041554 Ga0495668_0041554_586_1941 443
207 3300047318 Ga0495636_0000567 Ga0495636_0000567_11225_12676 443
208 3300048916 Ga0496113_0077087 Ga0496113_0077087_174_1556 443
209 3300048924 Ga0496121_0006617 Ga0496121_0006617_253_1623 443
210 3300049568 Ga0501031_0042678 Ga0501031_0042678_252_1583 443
211 3300049571 Ga0501034_0001021 Ga0501034_0001021_3397_4779 443
212 3300049579 Ga0501043_0011429 Ga0501043_0011429_1040_2389 443
213 3300049772 Ga0501275_000264 Ga0501275_000264_47_1408 443
214 iso_pu_bacteria 2643221593 2643974240 443
215 3300005530 Ga0070679_100089650 Ga0070679_1000896503 444
216 3300013102 Ga0157371_10031735 Ga0157371_100317353 444
217 3300013102 Ga0157371_10038104 Ga0157371_100381042 444
218 3300013105 Ga0157369_10027306 Ga0157369_100273061 444
219 3300013307 Ga0157372_10149167 Ga0157372_101491672 444
220 3300037418 Ga0395900_0025570 Ga0395900_0025570_676_2064 444
221 3300044712 Ga0453684_0000468 Ga0453684_0000468_29891_31237 444
222 3300045051 Ga0451576_0000177 Ga0451576_0000177_129353_130699 444
223 3300025981 Ga0207640_10142119 Ga0207640_101421191 445
224 3300025304 Ga0209257_1000122 Ga0209257_100012254 447
225 3300032004 Ga0307414_10137875 Ga0307414_101378752 447
226 3300048926 Ga0496123_0011777 Ga0496123_0011777_4029_5402 447
227 3300048929 Ga0496126_0004042 Ga0496126_0004042_9791_11164 447
228 iso_pu_bacteria 2547132130 2547503188 449
229 iso_pu_bacteria 2576861471 2578457568 449
230 iso_pu_bacteria 2643221579 2643908731 449
231 iso_pu_bacteria 2643221581 2643916162 449
232 iso_pu_bacteria 2747842428 2747948078 449
233 iso_pu_bacteria 2747842501 2748018313 449
234 iso_pu_bacteria 2765235840 2765579914 449
235 iso_pu_bacteria 2816332141 2816519043 449
236 iso_pu_bacteria 2818991457 2819660102 449
237 iso_pu_bacteria 2842391507 2842394872 449
238 iso_pu_bacteria 2842757796 2842760569 449
239 iso_pu_bacteria 2852649853 2852649989 449
240 iso_pu_bacteria 2852684882 2852685082 449
241 iso_pu_bacteria 2857442823 2857444766 449
242 iso_pu_bacteria 2874220319 2874222598 449
243 iso_pu_bacteria 2919089067 2919090539 449
244 iso_pu_bacteria 2919134579 2919137532 449
245 iso_pu_bacteria 2923516293 2923517943 449
246 iso_pu_bacteria 2928496128 2928498374 449
247 iso_pu_bacteria 2931380184 2931383945 449
248 iso_pu_bacteria 2937610967 2937614494 449
249 iso_pu_bacteria 2939589442 2939591140 449
250 iso_pu_bacteria 2939622612 2939624635 449
251 iso_pu_bacteria 2939626828 2939628291 449
252 iso_pu_bacteria 2941475908 2941476666 449
253 iso_pu_bacteria 2961047084 2961049363 449
254 iso_pu_bacteria 2961064222 2961065949 449
255 iso_pu_bacteria 2974307012 2974308194 449
256 iso_pu_bacteria 2977247770 2977248946 449
257 iso_pu_bacteria 2984514374 2984516597 449
258 iso_pu_bacteria 8021626552 8021627643 449
259 iso_pu_bacteria 8021648035 8021650766 449
260 3300038705 Ga0237819_00151 Ga0237819_00151_13424_14782 452
261 2162886007 SwRhRL2b_contig_2056178 SwRhRL2b_0579.00006300 453
262 3300003773 Ga0055537_1002818 Ga0055537_10028183 453
263 3300003781 Ga0055536_1007141 Ga0055536_10071414 453
264 3300003784 Ga0055534_1000034 Ga0055534_100003422 453
265 3300003790 Ga0055528_1000671 Ga0055528_100067110 453
266 3300003856 Ga0058692_1000011 Ga0058692_100001127 453
267 3300005289 Ga0065704_10006470 Ga0065704_100064702 453
268 3300005289 Ga0065704_10070427 Ga0065704_1007042713 453
269 3300006048 Ga0075363_100067516 Ga0075363_1000675162 453
270 3300009148 Ga0105243_10026315 Ga0105243_100263155 453
271 3300013104 Ga0157370_10005472 Ga0157370_100054722 453
272 3300013105 Ga0157369_10412819 Ga0157369_104128191 453
273 3300014497 Ga0182008_10000142 Ga0182008_1000014238 453
274 3300015261 Ga0182006_1047257 Ga0182006_10472572 453
275 3300015262 Ga0182007_10000287 Ga0182007_1000028732 453
276 3300015265 Ga0182005_1000586 Ga0182005_10005864 453
277 3300025263 Ga0209565_1000022 Ga0209565_1000022330 453
278 3300025273 Ga0209673_1000104 Ga0209673_100010477 453
279 3300025291 Ga0209675_1000048 Ga0209675_1000048167 453
280 3300025292 Ga0209676_1000024 Ga0209676_1000024293 453
281 3300025292 Ga0209676_1000091 Ga0209676_1000091157 453
282 3300025292 Ga0209676_1000117 Ga0209676_1000117137 453
283 3300025295 Ga0209564_1000213 Ga0209564_100021343 453
284 3300025298 Ga0209050_1001640 Ga0209050_10016408 453
285 3300025299 Ga0209256_1004506 Ga0209256_10045062 453
286 3300025303 Ga0209051_1010883 Ga0209051_10108834 453
287 3300025304 Ga0209257_1000062 Ga0209257_100006250 453
288 3300025304 Ga0209257_1005770 Ga0209257_10057701 453
289 3300025304 Ga0209257_1009842 Ga0209257_10098425 453
290 3300025735 Ga0207713_1009809 Ga0207713_10098097 453
291 3300025935 Ga0207709_10001041 Ga0207709_1000104113 453
292 3300027312 Ga0209371_1000007 Ga0209371_1000007422 453
293 3300027312 Ga0209371_1000016 Ga0209371_1000016401 453
294 3300028379 Ga0268266_10162211 Ga0268266_101622112 453
295 3300030500 Ga0268256_1000008 Ga0268256_1000008528 453
296 3300030500 Ga0268256_1000015 Ga0268256_1000015169 453
297 3300030732 Ga0316176_1198490 Ga0316176_11984905 453
298 3300030745 Ga0316182_1149691 Ga0316182_11496911 453
299 3300032004 Ga0307414_10033527 Ga0307414_100335274 453
300 3300046522 Ga0495643_0003677 Ga0495643_0003677_2429_3796 453
301 3300046525 Ga0495663_0006930 Ga0495663_0006930_678_2042 453
302 3300047320 Ga0495672_0000073 Ga0495672_0000073_142783_144150 453
303 3300048919 Ga0496116_0008602 Ga0496116_0008602_37_1398 453
304 3300048920 Ga0496117_0014010 Ga0496117_0014010_2244_3611 453
305 3300048921 Ga0496118_0000344 Ga0496118_0000344_26597_27964 453
306 3300048921 Ga0496118_0003355 Ga0496118_0003355_7336_8700 453
307 3300048922 Ga0496119_0002556 Ga0496119_0002556_11360_12724 453
308 3300048923 Ga0496120_0002304 Ga0496120_0002304_11362_12726 453
309 3300048927 Ga0496124_0000281 Ga0496124_0000281_94718_96085 453
310 3300048927 Ga0496124_0002984 Ga0496124_0002984_5621_6985 453
311 3300048927 Ga0496124_0021641 Ga0496124_0021641_3170_4534 453
312 3300048928 Ga0496125_0006523 Ga0496125_0006523_7371_8735 453
313 3300048928 Ga0496125_0024645 Ga0496125_0024645_917_2281 453
314 3300048929 Ga0496126_0007989 Ga0496126_0007989_2643_4007 453
315 3300049571 Ga0501034_0000122 Ga0501034_0000122_121418_122779 453

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18693

TRAM_2

TRAM domain

436

498

0.96

PF00919

UPF0004

Uncharacterized protein family UPF0004

56

149

0.9

PF04055

Radical_SAM

Radical SAM superfamily

201

380

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9309 138 440
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9244 138 440
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9175 138 440
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9081 138 440
4jc0-assembly2.cif.gz_B crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 0.7763 9 440
ID Description Score Start End Superfamily
af_P0AEI4_9_125_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9617 8 122 3.40.50.12160
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9555 256 374 3.30.750.200
af_P0AEI4_138_379_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9529 135 376 3.80.30.20
af_P0AEI4_138_379_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.949 135 376 3.80.30.20
2qgqA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9431 377 440 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3D2NQ02-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9854 297 440 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539
AF-A0A4Q3SKC5-F1-model_v4 deleted 0.9788 298 440
AF-A0A3D2NQ02-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9785 297 440 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539
AF-A0A349Z8I5-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.977 303 440 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539
AF-A0A7V6SSJ9-F1-model_v4 30S ribosomal protein S12 methylthiotransferase RimO 0.9761 302 442 GO:0005829
GO:0005840
GO:0035599
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
82.92 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map