F403168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 228 | 266 | 448 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10000148|Ga0157369_1000014877 |
| Length | 499 |
| Sequence | MSTVASVAQPAPLPAVRNRRRWCVAGVAATAACGAAAGYNCVLSSSIDSMSRKNPKVGFVSLGCPKALVDSERILTQLRVEGYEIVPSYGAADVVVVNTCGFIDAAVQESLDAIGEALAENGKVIVTGCLGKRADVIREAHPDVLAITGPQDYASVMSAVHTQLPPKHDPFVDIVPRARSRKSAPSDDIGVKLTPRHYAYLKISEGCNHRCTFCIIPSMRGDLVSRPVDEVLREAERLAKSGVRELLVISQDTSAYGVDVKYAAHEWRGAKYRTRMTELCEGLAQLGTWVRLHYVYPYPHVDEVIPLMAEGRILPYLDIPFQHASPRILKLMKRPAASARTLERIRAWRRVCPELTIRSTFIVGFPGETEAEFDELLAFLDEAQLDRVGAFAYSPVDGAKANELAGGVAEETKQERLERFMARQAGISAAKLKRRVDQVVDALVDHVDADGAVARTSADAPEIDGVLRIRDGQKLKAGQFVKVRVTAAEDHDLAGELAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 5 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 6 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 7 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 8 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 9 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 10 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 11 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 12 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 13 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 14 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 15 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 16 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 17 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 18 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 19 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 20 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 21 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 22 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 23 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 24 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 25 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 26 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 27 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 28 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 29 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 30 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 31 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 32 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 33 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 34 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 35 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 36 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 37 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 38 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 39 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 40 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 41 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 42 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 43 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 44 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 45 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 46 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 47 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 54 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 55 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 57 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 58 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 59 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 61 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 87 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 102 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 143 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 144 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 156 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 157 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 158 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 159 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 160 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 161 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 164 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 167 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 168 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 183 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 184 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 185 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 186 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 187 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 188 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 189 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 190 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 191 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 192 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 193 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 214 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 219 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 223 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 224 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 225 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 226 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 227 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 228 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.44 |
| Metatranscriptomes | 0 |
| Isolates | 15.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.32 |
| Bulb | 0 |
| Endosphere | 16.83 |
| Nodule | 0.32 |
| Rhizoplane | 2.86 |
| Rhizosphere | 63.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2056178 | 2162886007 | Bacteria | 5019 |
| 2 | JGI25157J39369_1000764 | 3300002741 | Bacteria | 16694 |
| 3 | JGI25151J46595_10000258 | 3300003187 | Bacteria | 62040 |
| 4 | JGI25151J46595_10010881 | 3300003187 | Bacteria | 4208 |
| 5 | Ga0055526_1000024 | 3300003771 | Bacteria | 158479 |
| 6 | Ga0055526_1018613 | 3300003771 | Bacteria | 2582 |
| 7 | Ga0055537_1000180 | 3300003773 | Bacteria | 47002 |
| 8 | Ga0055537_1002818 | 3300003773 | Bacteria | 5581 |
| 9 | Ga0055524_1000174 | 3300003775 | Bacteria | 73269 |
| 10 | Ga0055536_1007141 | 3300003781 | Bacteria | 5057 |
| 11 | Ga0055534_1000034 | 3300003784 | Bacteria | 114684 |
| 12 | Ga0055534_1000084 | 3300003784 | Bacteria | 73269 |
| 13 | Ga0055528_1000016 | 3300003790 | Bacteria | 158479 |
| 14 | Ga0055528_1000671 | 3300003790 | Bacteria | 24792 |
| 15 | Ga0055530_10001263 | 3300003791 | Bacteria | 19146 |
| 16 | Ga0058692_1000011 | 3300003856 | Bacteria | 321321 |
| 17 | Ga0065165_1001695 | 3300005262 | Bacteria | 22204 |
| 18 | Ga0065704_10006470 | 3300005289 | Bacteria | 4592 |
| 19 | Ga0065704_10070427 | 3300005289 | Bacteria | 25272 |
| 20 | Ga0065715_10137376 | 3300005293 | Bacteria | 1908 |
| 21 | Ga0068869_100059242 | 3300005334 | Bacteria | 2803 |
| 22 | Ga0070680_100151279 | 3300005336 | Bacteria | 1948 |
| 23 | Ga0068868_100006092 | 3300005338 | Bacteria | 8516 |
| 24 | Ga0070669_100004652 | 3300005353 | Bacteria | 9904 |
| 25 | Ga0070671_100081479 | 3300005355 | Bacteria | 2706 |
| 26 | Ga0070674_100031256 | 3300005356 | Bacteria | 3527 |
| 27 | Ga0070667_100061756 | 3300005367 | Bacteria | 3173 |
| 28 | Ga0070667_100067170 | 3300005367 | Bacteria | 3048 |
| 29 | Ga0070667_100133851 | 3300005367 | Bacteria | 2166 |
| 30 | Ga0070714_100109254 | 3300005435 | Bacteria | 2446 |
| 31 | Ga0070678_100016576 | 3300005456 | Bacteria | 4718 |
| 32 | Ga0070678_100120471 | 3300005456 | Bacteria | 2068 |
| 33 | Ga0068867_100045980 | 3300005459 | Bacteria | 3204 |
| 34 | Ga0068867_100072879 | 3300005459 | Bacteria | 2571 |
| 35 | Ga0068867_100124529 | 3300005459 | Bacteria | 1996 |
| 36 | Ga0070679_100089650 | 3300005530 | Bacteria | 3062 |
| 37 | Ga0070672_100005520 | 3300005543 | Bacteria | 8391 |
| 38 | Ga0070672_100017070 | 3300005543 | Bacteria | 5215 |
| 39 | Ga0070672_100038756 | 3300005543 | Bacteria | 3645 |
| 40 | Ga0070686_100049701 | 3300005544 | Bacteria | 2662 |
| 41 | Ga0070665_100032373 | 3300005548 | Bacteria | 5262 |
| 42 | Ga0068856_100025522 | 3300005614 | Bacteria | 5763 |
| 43 | Ga0068863_100041628 | 3300005841 | Bacteria | 4369 |
| 44 | Ga0068860_100005745 | 3300005843 | Bacteria | 12514 |
| 45 | Ga0081540_1001580 | 3300005983 | Bacteria | 19463 |
| 46 | Ga0075363_100067516 | 3300006048 | Bacteria | 1938 |
| 47 | Ga0075366_10017998 | 3300006195 | Bacteria | 4077 |
| 48 | Ga0068865_100006430 | 3300006881 | Bacteria | 7165 |
| 49 | Ga0105240_10001191 | 3300009093 | Bacteria | 45336 |
| 50 | Ga0105240_10035926 | 3300009093 | Bacteria | 6380 |
| 51 | Ga0105240_10109214 | 3300009093 | Bacteria | 3350 |
| 52 | Ga0105243_10026315 | 3300009148 | Bacteria | 4453 |
| 53 | Ga0105242_10000996 | 3300009176 | Bacteria | 22202 |
| 54 | Ga0105237_10082411 | 3300009545 | Bacteria | 3207 |
| 55 | Ga0105249_10040629 | 3300009553 | Bacteria | 4226 |
| 56 | Ga0105148_100627 | 3300009978 | Bacteria | 2894 |
| 57 | Ga0105032_100251 | 3300009979 | Bacteria | 5516 |
| 58 | Ga0105239_10012083 | 3300010375 | Bacteria | 9630 |
| 59 | Ga0105239_10042318 | 3300010375 | Bacteria | 4992 |
| 60 | Ga0157371_10031735 | 3300013102 | Bacteria | 3805 |
| 61 | Ga0157371_10038104 | 3300013102 | Bacteria | 3440 |
| 62 | Ga0157370_10005472 | 3300013104 | Bacteria | 14240 |
| 63 | Ga0157369_10000148 | 3300013105 | Bacteria | 100073 |
| 64 | Ga0157369_10027306 | 3300013105 | Bacteria | 6329 |
| 65 | Ga0157369_10412819 | 3300013105 | Bacteria | 1400 |
| 66 | Ga0157378_10000130 | 3300013297 | Bacteria | 72949 |
| 67 | Ga0163162_10034358 | 3300013306 | Bacteria | 5046 |
| 68 | Ga0157372_10022899 | 3300013307 | Bacteria | 6765 |
| 69 | Ga0157372_10149167 | 3300013307 | Bacteria | 2698 |
| 70 | Ga0157375_10000256 | 3300013308 | Bacteria | 48304 |
| 71 | Ga0157375_10070391 | 3300013308 | Bacteria | 3508 |
| 72 | Ga0182008_10000142 | 3300014497 | Bacteria | 55320 |
| 73 | Ga0157379_10124887 | 3300014968 | Bacteria | 2316 |
| 74 | Ga0157376_10000254 | 3300014969 | Bacteria | 36962 |
| 75 | Ga0182006_1047257 | 3300015261 | Bacteria | 1669 |
| 76 | Ga0182007_10000287 | 3300015262 | Bacteria | 33403 |
| 77 | Ga0182005_1000586 | 3300015265 | Bacteria | 17924 |
| 78 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 79 | Ga0207425_1005224 | 3300025245 | Bacteria | 3733 |
| 80 | Ga0209026_1000051 | 3300025250 | Bacteria | 250792 |
| 81 | Ga0209759_1010001 | 3300025256 | Bacteria | 2820 |
| 82 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 83 | Ga0209565_1000022 | 3300025263 | Bacteria | 390888 |
| 84 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 85 | Ga0209673_1000104 | 3300025273 | Bacteria | 186569 |
| 86 | Ga0209673_1005405 | 3300025273 | Bacteria | 6436 |
| 87 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 88 | Ga0209675_1000048 | 3300025291 | Bacteria | 221457 |
| 89 | Ga0209676_1000024 | 3300025292 | Bacteria | 578839 |
| 90 | Ga0209676_1000091 | 3300025292 | Bacteria | 251328 |
| 91 | Ga0209676_1000117 | 3300025292 | Bacteria | 203251 |
| 92 | Ga0209676_1001279 | 3300025292 | Bacteria | 26055 |
| 93 | Ga0209676_1002976 | 3300025292 | Bacteria | 11028 |
| 94 | Ga0209676_1006158 | 3300025292 | Bacteria | 6013 |
| 95 | Ga0209025_1000015 | 3300025294 | Bacteria | 808120 |
| 96 | Ga0209025_1001699 | 3300025294 | Bacteria | 26850 |
| 97 | Ga0209025_1007492 | 3300025294 | Bacteria | 8114 |
| 98 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 99 | Ga0209564_1000213 | 3300025295 | Bacteria | 132985 |
| 100 | Ga0209758_1013741 | 3300025297 | Bacteria | 4383 |
| 101 | Ga0209758_1018913 | 3300025297 | Bacteria | 3351 |
| 102 | Ga0209050_1000603 | 3300025298 | Bacteria | 57120 |
| 103 | Ga0209050_1001640 | 3300025298 | Bacteria | 22906 |
| 104 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 105 | Ga0209256_1004116 | 3300025299 | Bacteria | 9417 |
| 106 | Ga0209256_1004506 | 3300025299 | Bacteria | 8700 |
| 107 | Ga0209051_1007946 | 3300025303 | Bacteria | 5708 |
| 108 | Ga0209051_1010883 | 3300025303 | Bacteria | 4545 |
| 109 | Ga0209257_1000062 | 3300025304 | Bacteria | 362413 |
| 110 | Ga0209257_1000122 | 3300025304 | Bacteria | 219678 |
| 111 | Ga0209257_1000243 | 3300025304 | Bacteria | 126291 |
| 112 | Ga0209257_1001842 | 3300025304 | Bacteria | 23103 |
| 113 | Ga0209257_1005770 | 3300025304 | Bacteria | 8451 |
| 114 | Ga0209257_1009842 | 3300025304 | Bacteria | 4999 |
| 115 | Ga0207713_1009809 | 3300025735 | Bacteria | 5361 |
| 116 | Ga0207643_10076215 | 3300025908 | Bacteria | 1937 |
| 117 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 118 | Ga0207695_10002942 | 3300025913 | Bacteria | 24581 |
| 119 | Ga0207695_10044610 | 3300025913 | Bacteria | 4713 |
| 120 | Ga0207671_10003439 | 3300025914 | Bacteria | 15793 |
| 121 | Ga0207681_10040514 | 3300025923 | Bacteria | 3100 |
| 122 | Ga0207694_10010189 | 3300025924 | Bacteria | 7085 |
| 123 | Ga0207650_10017906 | 3300025925 | Bacteria | 4964 |
| 124 | Ga0207664_10076914 | 3300025929 | Bacteria | 2702 |
| 125 | Ga0207644_10005884 | 3300025931 | Bacteria | 7997 |
| 126 | Ga0207686_10002921 | 3300025934 | Bacteria | 9219 |
| 127 | Ga0207709_10001041 | 3300025935 | Bacteria | 20489 |
| 128 | Ga0207704_10004846 | 3300025938 | Bacteria | 6178 |
| 129 | Ga0207691_10003341 | 3300025940 | Bacteria | 15612 |
| 130 | Ga0207691_10004046 | 3300025940 | Bacteria | 14219 |
| 131 | Ga0207668_10068110 | 3300025972 | Bacteria | 2529 |
| 132 | Ga0207640_10142119 | 3300025981 | Bacteria | 1751 |
| 133 | Ga0207677_10004818 | 3300026023 | Bacteria | 7282 |
| 134 | Ga0207708_10090857 | 3300026075 | Bacteria | 2354 |
| 135 | Ga0207702_10003198 | 3300026078 | Bacteria | 15125 |
| 136 | Ga0207641_10074679 | 3300026088 | Bacteria | 2925 |
| 137 | Ga0207648_10064140 | 3300026089 | Bacteria | 3202 |
| 138 | Ga0207648_10077578 | 3300026089 | Bacteria | 2896 |
| 139 | Ga0207683_10029007 | 3300026121 | Bacteria | 4789 |
| 140 | Ga0207683_10045191 | 3300026121 | Bacteria | 3851 |
| 141 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 142 | Ga0209371_1000016 | 3300027312 | Bacteria | 646301 |
| 143 | Ga0268266_10027764 | 3300028379 | Bacteria | 4812 |
| 144 | Ga0268266_10162211 | 3300028379 | Bacteria | 2023 |
| 145 | Ga0268264_10006637 | 3300028381 | Bacteria | 9729 |
| 146 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 147 | Ga0268256_1000015 | 3300030500 | Bacteria | 646300 |
| 148 | Ga0316176_1198490 | 3300030732 | Bacteria | 4083 |
| 149 | Ga0316182_1149691 | 3300030745 | Bacteria | 1957 |
| 150 | Ga0265331_10026829 | 3300031250 | Bacteria | 2892 |
| 151 | Ga0265331_10059225 | 3300031250 | Bacteria | 1811 |
| 152 | Ga0307408_100024108 | 3300031548 | Bacteria | 4151 |
| 153 | Ga0307516_10115383 | 3300031730 | Bacteria | 2482 |
| 154 | Ga0307413_10002658 | 3300031824 | Bacteria | 7319 |
| 155 | Ga0307406_10110429 | 3300031901 | Bacteria | 1892 |
| 156 | Ga0307414_10033527 | 3300032004 | Bacteria | 3395 |
| 157 | Ga0307414_10137875 | 3300032004 | Bacteria | 1905 |
| 158 | Ga0307414_10144643 | 3300032004 | Bacteria | 1866 |
| 159 | Ga0373925_0129161 | 3300037068 | Bacteria | 1969 |
| 160 | Ga0395899_0016309 | 3300037312 | Bacteria | 5662 |
| 161 | Ga0395900_0002475 | 3300037418 | Bacteria | 20305 |
| 162 | Ga0395900_0023736 | 3300037418 | Bacteria | 6274 |
| 163 | Ga0395900_0025570 | 3300037418 | Bacteria | 6044 |
| 164 | Ga0395905_0000503 | 3300037471 | Bacteria | 53661 |
| 165 | Ga0395905_0053604 | 3300037471 | Bacteria | 3774 |
| 166 | Ga0395901_0002493 | 3300038443 | Bacteria | 18647 |
| 167 | Ga0237819_00151 | 3300038705 | Bacteria | 25521 |
| 168 | Ga0436365_1251902 | 3300039437 | Bacteria | 3291 |
| 169 | Ga0439436_0018837 | 3300041404 | Bacteria | 2063 |
| 170 | Ga0439436_0026735 | 3300041404 | Bacteria | 1690 |
| 171 | Ga0451791_0244412 | 3300041451 | Bacteria | 5929 |
| 172 | Ga0451793_1612891 | 3300041452 | Bacteria | 2870 |
| 173 | Ga0451807_0133933 | 3300041486 | Bacteria | 2670 |
| 174 | Ga0451837_1409641 | 3300041494 | Bacteria | 9774 |
| 175 | Ga0451577_0006259 | 3300042876 | Bacteria | 11926 |
| 176 | Ga0451577_0089734 | 3300042876 | Bacteria | 2743 |
| 177 | Ga0466961_0141255 | 3300044693 | Bacteria | 1507 |
| 178 | Ga0453684_0000069 | 3300044712 | Bacteria | 456439 |
| 179 | Ga0453684_0000468 | 3300044712 | Bacteria | 160571 |
| 180 | Ga0453684_0001003 | 3300044712 | Bacteria | 91525 |
| 181 | Ga0466971_0008618 | 3300044719 | Bacteria | 4448 |
| 182 | Ga0466957_0014324 | 3300044842 | Bacteria | 4616 |
| 183 | Ga0466959_0078167 | 3300045049 | Bacteria | 2386 |
| 184 | Ga0451576_0000177 | 3300045051 | Bacteria | 160589 |
| 185 | Ga0466958_0001437 | 3300045836 | Bacteria | 11290 |
| 186 | Ga0495643_0003677 | 3300046522 | Bacteria | 11123 |
| 187 | Ga0495663_0006930 | 3300046525 | Bacteria | 3126 |
| 188 | Ga0495668_0001124 | 3300046616 | Bacteria | 27580 |
| 189 | Ga0495668_0041554 | 3300046616 | Bacteria | 2561 |
| 190 | Ga0495636_0000567 | 3300047318 | Bacteria | 13609 |
| 191 | Ga0495672_0000073 | 3300047320 | Bacteria | 179398 |
| 192 | Ga0495686_0020538 | 3300047472 | Bacteria | 4402 |
| 193 | Ga0496101_0010319 | 3300048904 | Bacteria | 6168 |
| 194 | Ga0496103_0005099 | 3300048906 | Bacteria | 7912 |
| 195 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 196 | Ga0496105_0000014 | 3300048908 | Bacteria | 220911 |
| 197 | Ga0496113_0077087 | 3300048916 | Bacteria | 2548 |
| 198 | Ga0496115_0000148 | 3300048918 | Bacteria | 64816 |
| 199 | Ga0496116_0008602 | 3300048919 | Bacteria | 8833 |
| 200 | Ga0496117_0014010 | 3300048920 | Bacteria | 6939 |
| 201 | Ga0496118_0000344 | 3300048921 | Bacteria | 78989 |
| 202 | Ga0496118_0003355 | 3300048921 | Bacteria | 20262 |
| 203 | Ga0496119_0002556 | 3300048922 | Bacteria | 19810 |
| 204 | Ga0496120_0002304 | 3300048923 | Bacteria | 19766 |
| 205 | Ga0496121_0006617 | 3300048924 | Bacteria | 14283 |
| 206 | Ga0496122_0018183 | 3300048925 | Bacteria | 6509 |
| 207 | Ga0496123_0011777 | 3300048926 | Bacteria | 7533 |
| 208 | Ga0496124_0000281 | 3300048927 | Bacteria | 97214 |
| 209 | Ga0496124_0002984 | 3300048927 | Bacteria | 21170 |
| 210 | Ga0496124_0021641 | 3300048927 | Bacteria | 5922 |
| 211 | Ga0496125_0006523 | 3300048928 | Bacteria | 12582 |
| 212 | Ga0496125_0024645 | 3300048928 | Bacteria | 5526 |
| 213 | Ga0496126_0000033 | 3300048929 | Bacteria | 368851 |
| 214 | Ga0496126_0004042 | 3300048929 | Bacteria | 17849 |
| 215 | Ga0496126_0007989 | 3300048929 | Bacteria | 11486 |
| 216 | Ga0501031_0042678 | 3300049568 | Bacteria | 2960 |
| 217 | Ga0501034_0000122 | 3300049571 | Bacteria | 144085 |
| 218 | Ga0501034_0001021 | 3300049571 | Bacteria | 40111 |
| 219 | Ga0501034_0006427 | 3300049571 | Bacteria | 12655 |
| 220 | Ga0501034_0043390 | 3300049571 | Bacteria | 4551 |
| 221 | Ga0501034_0089984 | 3300049571 | Bacteria | 3067 |
| 222 | Ga0501036_0035387 | 3300049572 | Bacteria | 4227 |
| 223 | Ga0501037_0003999 | 3300049573 | Bacteria | 10688 |
| 224 | Ga0501037_0129623 | 3300049573 | Bacteria | 1809 |
| 225 | Ga0501037_0130915 | 3300049573 | Bacteria | 1799 |
| 226 | Ga0501039_0022764 | 3300049575 | Bacteria | 4806 |
| 227 | Ga0501039_0031426 | 3300049575 | Bacteria | 4093 |
| 228 | Ga0501040_0015341 | 3300049576 | Bacteria | 5067 |
| 229 | Ga0501040_0044739 | 3300049576 | Bacteria | 3019 |
| 230 | Ga0501041_0024872 | 3300049577 | Bacteria | 3597 |
| 231 | Ga0501043_0011429 | 3300049579 | Bacteria | 6951 |
| 232 | Ga0501043_0089173 | 3300049579 | Bacteria | 2424 |
| 233 | Ga0501043_0175383 | 3300049579 | Bacteria | 1671 |
| 234 | Ga0501046_0081907 | 3300049580 | Bacteria | 2493 |
| 235 | Ga0501047_0000533 | 3300049581 | Bacteria | 41217 |
| 236 | Ga0501048_0096536 | 3300049582 | Bacteria | 2084 |
| 237 | Ga0501067_0000630 | 3300049583 | Bacteria | 18924 |
| 238 | Ga0501067_0014578 | 3300049583 | Bacteria | 4351 |
| 239 | Ga0501068_0018053 | 3300049584 | Bacteria | 4085 |
| 240 | Ga0501069_0011289 | 3300049585 | Bacteria | 4737 |
| 241 | Ga0501070_0006690 | 3300049586 | Bacteria | 9818 |
| 242 | Ga0501070_0008704 | 3300049586 | Bacteria | 8581 |
| 243 | Ga0501071_0042207 | 3300049587 | Bacteria | 3267 |
| 244 | Ga0501071_0058740 | 3300049587 | Bacteria | 2781 |
| 245 | Ga0501072_0002457 | 3300049588 | Bacteria | 13872 |
| 246 | Ga0501072_0041196 | 3300049588 | Bacteria | 3627 |
| 247 | Ga0501074_0016708 | 3300049590 | Bacteria | 5325 |
| 248 | Ga0501075_0036183 | 3300049591 | Bacteria | 3684 |
| 249 | Ga0501076_0003796 | 3300049592 | Bacteria | 10640 |
| 250 | Ga0501209_000265 | 3300049656 | Bacteria | 6327 |
| 251 | Ga0501079_0001417 | 3300049741 | Bacteria | 16920 |
| 252 | Ga0501079_0028322 | 3300049741 | Bacteria | 4297 |
| 253 | Ga0501080_0004234 | 3300049742 | Bacteria | 12728 |
| 254 | Ga0501080_0050371 | 3300049742 | Bacteria | 3876 |
| 255 | Ga0501081_0005745 | 3300049743 | Bacteria | 8034 |
| 256 | Ga0501083_0001373 | 3300049744 | Bacteria | 16526 |
| 257 | Ga0501275_000264 | 3300049772 | Bacteria | 6020 |
| 258 | Ga0501035_0081182 | 3300049822 | Bacteria | 2862 |
| 259 | Ga0501035_0112804 | 3300049822 | Bacteria | 2381 |
| 260 | Ga0501044_0055759 | 3300049823 | Bacteria | 4058 |
| 261 | Ga0501044_0056249 | 3300049823 | Bacteria | 4038 |
| 262 | Ga0501044_0210759 | 3300049823 | Bacteria | 1897 |
| 263 | nmdc:mga00v17_33402_c1 | 3300050491 | Bacteria | 3048 |
| 264 | Ga0500651_0000788 | 3300053093 | Bacteria | 15475 |
| 265 | Ga0500566_0057469 | 3300053094 | Bacteria | 2210 |
| 266 | Ga0466962_0053161 | 3300061719 | Bacteria | 1935 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0018183 | Ga0496122_0018183_19_1134 | 361 |
| 2 | 3300025972 | Ga0207668_10068110 | Ga0207668_100681102 | 386 |
| 3 | 3300025908 | Ga0207643_10076215 | Ga0207643_100762152 | 387 |
| 4 | 3300041452 | Ga0451793_1612891 | Ga0451793_1612891_1668_2846 | 390 |
| 5 | 3300037418 | Ga0395900_0002475 | Ga0395900_0002475_15078_16259 | 392 |
| 6 | 3300049571 | Ga0501034_0043390 | Ga0501034_0043390_2791_4143 | 407 |
| 7 | 3300049575 | Ga0501039_0022764 | Ga0501039_0022764_744_2096 | 407 |
| 8 | 3300049576 | Ga0501040_0015341 | Ga0501040_0015341_2544_3896 | 407 |
| 9 | 3300049582 | Ga0501048_0096536 | Ga0501048_0096536_536_1888 | 407 |
| 10 | 3300049583 | Ga0501067_0014578 | Ga0501067_0014578_400_1752 | 407 |
| 11 | 3300049587 | Ga0501071_0058740 | Ga0501071_0058740_605_1957 | 407 |
| 12 | 3300049588 | Ga0501072_0041196 | Ga0501072_0041196_478_1830 | 407 |
| 13 | 3300049590 | Ga0501074_0016708 | Ga0501074_0016708_2565_3917 | 407 |
| 14 | 3300049741 | Ga0501079_0028322 | Ga0501079_0028322_197_1549 | 407 |
| 15 | 3300049822 | Ga0501035_0112804 | Ga0501035_0112804_239_1591 | 407 |
| 16 | 3300049823 | Ga0501044_0056249 | Ga0501044_0056249_391_1743 | 407 |
| 17 | 3300005983 | Ga0081540_1001580 | Ga0081540_100158014 | 414 |
| 18 | 3300026075 | Ga0207708_10090857 | Ga0207708_100908573 | 414 |
| 19 | 3300047472 | Ga0495686_0020538 | Ga0495686_0020538_212_1492 | 416 |
| 20 | 3300049579 | Ga0501043_0175383 | Ga0501043_0175383_272_1624 | 416 |
| 21 | 3300049822 | Ga0501035_0081182 | Ga0501035_0081182_28_1470 | 416 |
| 22 | 3300049823 | Ga0501044_0055759 | Ga0501044_0055759_88_1440 | 416 |
| 23 | 3300009979 | Ga0105032_100251 | Ga0105032_1002513 | 423 |
| 24 | 3300031730 | Ga0307516_10115383 | Ga0307516_101153831 | 427 |
| 25 | 3300005262 | Ga0065165_1001695 | Ga0065165_10016958 | 430 |
| 26 | 3300025297 | Ga0209758_1018913 | Ga0209758_10189132 | 430 |
| 27 | 3300049572 | Ga0501036_0035387 | Ga0501036_0035387_2190_3485 | 430 |
| 28 | 3300049573 | Ga0501037_0130915 | Ga0501037_0130915_274_1569 | 430 |
| 29 | 3300049575 | Ga0501039_0031426 | Ga0501039_0031426_770_2065 | 430 |
| 30 | 3300049576 | Ga0501040_0044739 | Ga0501040_0044739_440_1735 | 430 |
| 31 | 3300049577 | Ga0501041_0024872 | Ga0501041_0024872_2174_3469 | 430 |
| 32 | 3300049579 | Ga0501043_0089173 | Ga0501043_0089173_541_1836 | 430 |
| 33 | 3300049580 | Ga0501046_0081907 | Ga0501046_0081907_683_1978 | 430 |
| 34 | 3300049587 | Ga0501071_0042207 | Ga0501071_0042207_1917_3212 | 430 |
| 35 | 3300049591 | Ga0501075_0036183 | Ga0501075_0036183_583_1878 | 430 |
| 36 | 3300049592 | Ga0501076_0003796 | Ga0501076_0003796_2124_3419 | 430 |
| 37 | 3300049742 | Ga0501080_0050371 | Ga0501080_0050371_679_1974 | 430 |
| 38 | 3300049743 | Ga0501081_0005745 | Ga0501081_0005745_4239_5534 | 430 |
| 39 | 3300049571 | Ga0501034_0089984 | Ga0501034_0089984_1496_2827 | 432 |
| 40 | 3300049573 | Ga0501037_0003999 | Ga0501037_0003999_2131_3462 | 432 |
| 41 | 3300049823 | Ga0501044_0210759 | Ga0501044_0210759_52_1383 | 432 |
| 42 | 3300005356 | Ga0070674_100031256 | Ga0070674_1000312562 | 434 |
| 43 | 3300005459 | Ga0068867_100124529 | Ga0068867_1001245292 | 434 |
| 44 | 3300005543 | Ga0070672_100005520 | Ga0070672_1000055206 | 434 |
| 45 | 3300009093 | Ga0105240_10001191 | Ga0105240_1000119120 | 434 |
| 46 | 3300025913 | Ga0207695_10000033 | Ga0207695_10000033270 | 434 |
| 47 | 3300025925 | Ga0207650_10017906 | Ga0207650_100179065 | 434 |
| 48 | 3300025940 | Ga0207691_10003341 | Ga0207691_1000334114 | 434 |
| 49 | 3300026089 | Ga0207648_10077578 | Ga0207648_100775783 | 434 |
| 50 | 3300042876 | Ga0451577_0006259 | Ga0451577_0006259_5893_7230 | 434 |
| 51 | 3300044712 | Ga0453684_0001003 | Ga0453684_0001003_13292_14605 | 435 |
| 52 | 3300006195 | Ga0075366_10017998 | Ga0075366_100179982 | 437 |
| 53 | 3300025299 | Ga0209256_1004116 | Ga0209256_10041162 | 437 |
| 54 | 3300031250 | Ga0265331_10026829 | Ga0265331_100268292 | 437 |
| 55 | 3300031250 | Ga0265331_10059225 | Ga0265331_100592252 | 437 |
| 56 | 3300042876 | Ga0451577_0089734 | Ga0451577_0089734_376_1707 | 437 |
| 57 | 3300044712 | Ga0453684_0000069 | Ga0453684_0000069_35585_36952 | 437 |
| 58 | 3300049571 | Ga0501034_0006427 | Ga0501034_0006427_10141_11460 | 437 |
| 59 | 3300049573 | Ga0501037_0129623 | Ga0501037_0129623_98_1417 | 437 |
| 60 | 3300049581 | Ga0501047_0000533 | Ga0501047_0000533_1311_2630 | 437 |
| 61 | 3300049583 | Ga0501067_0000630 | Ga0501067_0000630_7906_9225 | 437 |
| 62 | 3300049584 | Ga0501068_0018053 | Ga0501068_0018053_516_1835 | 437 |
| 63 | 3300049585 | Ga0501069_0011289 | Ga0501069_0011289_2233_3552 | 437 |
| 64 | 3300049586 | Ga0501070_0008704 | Ga0501070_0008704_3480_4799 | 437 |
| 65 | 3300049588 | Ga0501072_0002457 | Ga0501072_0002457_19_1338 | 437 |
| 66 | 3300049741 | Ga0501079_0001417 | Ga0501079_0001417_5620_6936 | 437 |
| 67 | 3300049742 | Ga0501080_0004234 | Ga0501080_0004234_11350_12669 | 437 |
| 68 | 3300049744 | Ga0501083_0001373 | Ga0501083_0001373_7049_8368 | 437 |
| 69 | 3300050491 | nmdc:mga00v17_33402_c1 | nmdc:mga00v17_33402_c1_599_1969 | 437 |
| 70 | 3300013297 | Ga0157378_10000130 | Ga0157378_1000013059 | 438 |
| 71 | 3300049656 | Ga0501209_000265 | Ga0501209_000265_3534_4877 | 438 |
| 72 | 3300002741 | JGI25157J39369_1000764 | JGI25157J39369_10007647 | 439 |
| 73 | 3300005334 | Ga0068869_100059242 | Ga0068869_1000592422 | 439 |
| 74 | 3300005336 | Ga0070680_100151279 | Ga0070680_1001512792 | 439 |
| 75 | 3300005338 | Ga0068868_100006092 | Ga0068868_1000060922 | 439 |
| 76 | 3300005353 | Ga0070669_100004652 | Ga0070669_1000046522 | 439 |
| 77 | 3300005355 | Ga0070671_100081479 | Ga0070671_1000814791 | 439 |
| 78 | 3300005367 | Ga0070667_100061756 | Ga0070667_1000617562 | 439 |
| 79 | 3300005367 | Ga0070667_100067170 | Ga0070667_1000671704 | 439 |
| 80 | 3300005367 | Ga0070667_100133851 | Ga0070667_1001338512 | 439 |
| 81 | 3300005435 | Ga0070714_100109254 | Ga0070714_1001092542 | 439 |
| 82 | 3300005456 | Ga0070678_100016576 | Ga0070678_1000165763 | 439 |
| 83 | 3300005456 | Ga0070678_100120471 | Ga0070678_1001204712 | 439 |
| 84 | 3300005459 | Ga0068867_100045980 | Ga0068867_1000459802 | 439 |
| 85 | 3300005459 | Ga0068867_100072879 | Ga0068867_1000728792 | 439 |
| 86 | 3300005543 | Ga0070672_100017070 | Ga0070672_1000170704 | 439 |
| 87 | 3300005543 | Ga0070672_100038756 | Ga0070672_1000387562 | 439 |
| 88 | 3300005544 | Ga0070686_100049701 | Ga0070686_1000497012 | 439 |
| 89 | 3300005548 | Ga0070665_100032373 | Ga0070665_1000323733 | 439 |
| 90 | 3300005614 | Ga0068856_100025522 | Ga0068856_1000255225 | 439 |
| 91 | 3300005841 | Ga0068863_100041628 | Ga0068863_1000416283 | 439 |
| 92 | 3300005843 | Ga0068860_100005745 | Ga0068860_1000057457 | 439 |
| 93 | 3300006881 | Ga0068865_100006430 | Ga0068865_1000064307 | 439 |
| 94 | 3300009093 | Ga0105240_10035926 | Ga0105240_100359261 | 439 |
| 95 | 3300009093 | Ga0105240_10109214 | Ga0105240_101092142 | 439 |
| 96 | 3300009176 | Ga0105242_10000996 | Ga0105242_100009965 | 439 |
| 97 | 3300009545 | Ga0105237_10082411 | Ga0105237_100824111 | 439 |
| 98 | 3300009553 | Ga0105249_10040629 | Ga0105249_100406293 | 439 |
| 99 | 3300010375 | Ga0105239_10012083 | Ga0105239_100120836 | 439 |
| 100 | 3300010375 | Ga0105239_10042318 | Ga0105239_100423184 | 439 |
| 101 | 3300013105 | Ga0157369_10000148 | Ga0157369_1000014877 | 439 |
| 102 | 3300013306 | Ga0163162_10034358 | Ga0163162_100343583 | 439 |
| 103 | 3300013308 | Ga0157375_10000256 | Ga0157375_1000025611 | 439 |
| 104 | 3300013308 | Ga0157375_10070391 | Ga0157375_100703912 | 439 |
| 105 | 3300014968 | Ga0157379_10124887 | Ga0157379_101248871 | 439 |
| 106 | 3300014969 | Ga0157376_10000254 | Ga0157376_1000025410 | 439 |
| 107 | 3300025250 | Ga0209026_1000051 | Ga0209026_100005192 | 439 |
| 108 | 3300025256 | Ga0209759_1010001 | Ga0209759_10100012 | 439 |
| 109 | 3300025913 | Ga0207695_10002942 | Ga0207695_100029425 | 439 |
| 110 | 3300025913 | Ga0207695_10044610 | Ga0207695_100446103 | 439 |
| 111 | 3300025914 | Ga0207671_10003439 | Ga0207671_1000343913 | 439 |
| 112 | 3300025923 | Ga0207681_10040514 | Ga0207681_100405142 | 439 |
| 113 | 3300025924 | Ga0207694_10010189 | Ga0207694_100101895 | 439 |
| 114 | 3300025929 | Ga0207664_10076914 | Ga0207664_100769143 | 439 |
| 115 | 3300025934 | Ga0207686_10002921 | Ga0207686_100029217 | 439 |
| 116 | 3300025938 | Ga0207704_10004846 | Ga0207704_100048464 | 439 |
| 117 | 3300025940 | Ga0207691_10004046 | Ga0207691_100040462 | 439 |
| 118 | 3300026023 | Ga0207677_10004818 | Ga0207677_100048185 | 439 |
| 119 | 3300026078 | Ga0207702_10003198 | Ga0207702_1000319813 | 439 |
| 120 | 3300026088 | Ga0207641_10074679 | Ga0207641_100746793 | 439 |
| 121 | 3300026089 | Ga0207648_10064140 | Ga0207648_100641402 | 439 |
| 122 | 3300026121 | Ga0207683_10029007 | Ga0207683_100290073 | 439 |
| 123 | 3300026121 | Ga0207683_10045191 | Ga0207683_100451913 | 439 |
| 124 | 3300028379 | Ga0268266_10027764 | Ga0268266_100277643 | 439 |
| 125 | 3300028381 | Ga0268264_10006637 | Ga0268264_100066375 | 439 |
| 126 | 3300037068 | Ga0373925_0129161 | Ga0373925_0129161_85_1470 | 439 |
| 127 | 3300039437 | Ga0436365_1251902 | Ga0436365_1251902_1291_2631 | 439 |
| 128 | 3300041451 | Ga0451791_0244412 | Ga0451791_0244412_723_2075 | 439 |
| 129 | 3300041486 | Ga0451807_0133933 | Ga0451807_0133933_344_1696 | 439 |
| 130 | 3300041494 | Ga0451837_1409641 | Ga0451837_1409641_1987_3339 | 439 |
| 131 | 3300044693 | Ga0466961_0141255 | Ga0466961_0141255_65_1444 | 439 |
| 132 | 3300044719 | Ga0466971_0008618 | Ga0466971_0008618_2530_3909 | 439 |
| 133 | 3300044842 | Ga0466957_0014324 | Ga0466957_0014324_103_1482 | 439 |
| 134 | 3300045049 | Ga0466959_0078167 | Ga0466959_0078167_260_1639 | 439 |
| 135 | 3300045836 | Ga0466958_0001437 | Ga0466958_0001437_2931_4310 | 439 |
| 136 | 3300048906 | Ga0496103_0005099 | Ga0496103_0005099_4525_5862 | 439 |
| 137 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_56360_57712 | 439 |
| 138 | 3300048908 | Ga0496105_0000014 | Ga0496105_0000014_56387_57739 | 439 |
| 139 | 3300048918 | Ga0496115_0000148 | Ga0496115_0000148_243_1580 | 439 |
| 140 | 3300048929 | Ga0496126_0000033 | Ga0496126_0000033_243042_244379 | 439 |
| 141 | 3300053093 | Ga0500651_0000788 | Ga0500651_0000788_11677_12999 | 439 |
| 142 | 3300053094 | Ga0500566_0057469 | Ga0500566_0057469_25_1410 | 439 |
| 143 | 3300061719 | Ga0466962_0053161 | Ga0466962_0053161_340_1719 | 439 |
| 144 | iso_pu_bacteria | 2571042365 | 2572253542 | 439 |
| 145 | iso_pu_bacteria | 2643221559 | 2643815293 | 439 |
| 146 | iso_pu_bacteria | 2643221573 | 2643879337 | 439 |
| 147 | iso_pu_bacteria | 2643221586 | 2643939970 | 439 |
| 148 | iso_pu_bacteria | 2643221612 | 2644077026 | 439 |
| 149 | iso_pu_bacteria | 2643221695 | 2644528880 | 439 |
| 150 | iso_pu_bacteria | 2643221720 | 2644660636 | 439 |
| 151 | iso_pu_bacteria | 2643221727 | 2644695340 | 439 |
| 152 | iso_pu_bacteria | 2643221728 | 2644697996 | 439 |
| 153 | iso_pu_bacteria | 2894414249 | 2894415914 | 439 |
| 154 | iso_pu_bacteria | 8003014200 | 8003014599 | 439 |
| 155 | 3300013307 | Ga0157372_10022899 | Ga0157372_100228993 | 440 |
| 156 | iso_pu_bacteria | 2919513703 | 2919516141 | 440 |
| 157 | iso_pu_bacteria | 2919675420 | 2919677975 | 440 |
| 158 | iso_pu_bacteria | 2939611941 | 2939612391 | 440 |
| 159 | iso_pu_bacteria | 8021622325 | 8021624489 | 440 |
| 160 | 3300015689 | Ga0183360_10001 | Ga0183360_100012094 | 441 |
| 161 | 3300005293 | Ga0065715_10137376 | Ga0065715_101373761 | 442 |
| 162 | 3300025931 | Ga0207644_10005884 | Ga0207644_100058845 | 442 |
| 163 | 3300037312 | Ga0395899_0016309 | Ga0395899_0016309_1110_2477 | 442 |
| 164 | 3300037418 | Ga0395900_0023736 | Ga0395900_0023736_1178_2545 | 442 |
| 165 | 3300037471 | Ga0395905_0000503 | Ga0395905_0000503_19142_20509 | 442 |
| 166 | 3300037471 | Ga0395905_0053604 | Ga0395905_0053604_2031_3491 | 442 |
| 167 | 3300038443 | Ga0395901_0002493 | Ga0395901_0002493_9793_11160 | 442 |
| 168 | 3300048904 | Ga0496101_0010319 | Ga0496101_0010319_990_2357 | 442 |
| 169 | 3300049586 | Ga0501070_0006690 | Ga0501070_0006690_3348_4715 | 442 |
| 170 | iso_pu_bacteria | 2941489479 | 2941493783 | 442 |
| 171 | 3300003187 | JGI25151J46595_10000258 | JGI25151J46595_1000025852 | 443 |
| 172 | 3300003187 | JGI25151J46595_10010881 | JGI25151J46595_100108815 | 443 |
| 173 | 3300003771 | Ga0055526_1000024 | Ga0055526_100002429 | 443 |
| 174 | 3300003771 | Ga0055526_1018613 | Ga0055526_10186132 | 443 |
| 175 | 3300003773 | Ga0055537_1000180 | Ga0055537_100018014 | 443 |
| 176 | 3300003775 | Ga0055524_1000174 | Ga0055524_100017436 | 443 |
| 177 | 3300003784 | Ga0055534_1000084 | Ga0055534_100008436 | 443 |
| 178 | 3300003790 | Ga0055528_1000016 | Ga0055528_100001629 | 443 |
| 179 | 3300003791 | Ga0055530_10001263 | Ga0055530_1000126312 | 443 |
| 180 | 3300009978 | Ga0105148_100627 | Ga0105148_1006272 | 443 |
| 181 | 3300025245 | Ga0207425_1005224 | Ga0207425_10052242 | 443 |
| 182 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011725 | 443 |
| 183 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011725 | 443 |
| 184 | 3300025273 | Ga0209673_1005405 | Ga0209673_10054058 | 443 |
| 185 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001807 | 443 |
| 186 | 3300025292 | Ga0209676_1001279 | Ga0209676_100127921 | 443 |
| 187 | 3300025292 | Ga0209676_1002976 | Ga0209676_10029764 | 443 |
| 188 | 3300025292 | Ga0209676_1006158 | Ga0209676_10061586 | 443 |
| 189 | 3300025294 | Ga0209025_1000015 | Ga0209025_1000015341 | 443 |
| 190 | 3300025294 | Ga0209025_1001699 | Ga0209025_100169916 | 443 |
| 191 | 3300025294 | Ga0209025_1007492 | Ga0209025_10074922 | 443 |
| 192 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001969 | 443 |
| 193 | 3300025297 | Ga0209758_1013741 | Ga0209758_10137411 | 443 |
| 194 | 3300025298 | Ga0209050_1000603 | Ga0209050_100060334 | 443 |
| 195 | 3300025299 | Ga0209256_1000002 | Ga0209256_1000002583 | 443 |
| 196 | 3300025303 | Ga0209051_1007946 | Ga0209051_10079463 | 443 |
| 197 | 3300025304 | Ga0209257_1000243 | Ga0209257_100024329 | 443 |
| 198 | 3300025304 | Ga0209257_1001842 | Ga0209257_100184211 | 443 |
| 199 | 3300031548 | Ga0307408_100024108 | Ga0307408_1000241085 | 443 |
| 200 | 3300031824 | Ga0307413_10002658 | Ga0307413_100026582 | 443 |
| 201 | 3300031901 | Ga0307406_10110429 | Ga0307406_101104291 | 443 |
| 202 | 3300032004 | Ga0307414_10144643 | Ga0307414_101446431 | 443 |
| 203 | 3300041404 | Ga0439436_0018837 | Ga0439436_0018837_232_1605 | 443 |
| 204 | 3300041404 | Ga0439436_0026735 | Ga0439436_0026735_73_1449 | 443 |
| 205 | 3300046616 | Ga0495668_0001124 | Ga0495668_0001124_12981_14339 | 443 |
| 206 | 3300046616 | Ga0495668_0041554 | Ga0495668_0041554_586_1941 | 443 |
| 207 | 3300047318 | Ga0495636_0000567 | Ga0495636_0000567_11225_12676 | 443 |
| 208 | 3300048916 | Ga0496113_0077087 | Ga0496113_0077087_174_1556 | 443 |
| 209 | 3300048924 | Ga0496121_0006617 | Ga0496121_0006617_253_1623 | 443 |
| 210 | 3300049568 | Ga0501031_0042678 | Ga0501031_0042678_252_1583 | 443 |
| 211 | 3300049571 | Ga0501034_0001021 | Ga0501034_0001021_3397_4779 | 443 |
| 212 | 3300049579 | Ga0501043_0011429 | Ga0501043_0011429_1040_2389 | 443 |
| 213 | 3300049772 | Ga0501275_000264 | Ga0501275_000264_47_1408 | 443 |
| 214 | iso_pu_bacteria | 2643221593 | 2643974240 | 443 |
| 215 | 3300005530 | Ga0070679_100089650 | Ga0070679_1000896503 | 444 |
| 216 | 3300013102 | Ga0157371_10031735 | Ga0157371_100317353 | 444 |
| 217 | 3300013102 | Ga0157371_10038104 | Ga0157371_100381042 | 444 |
| 218 | 3300013105 | Ga0157369_10027306 | Ga0157369_100273061 | 444 |
| 219 | 3300013307 | Ga0157372_10149167 | Ga0157372_101491672 | 444 |
| 220 | 3300037418 | Ga0395900_0025570 | Ga0395900_0025570_676_2064 | 444 |
| 221 | 3300044712 | Ga0453684_0000468 | Ga0453684_0000468_29891_31237 | 444 |
| 222 | 3300045051 | Ga0451576_0000177 | Ga0451576_0000177_129353_130699 | 444 |
| 223 | 3300025981 | Ga0207640_10142119 | Ga0207640_101421191 | 445 |
| 224 | 3300025304 | Ga0209257_1000122 | Ga0209257_100012254 | 447 |
| 225 | 3300032004 | Ga0307414_10137875 | Ga0307414_101378752 | 447 |
| 226 | 3300048926 | Ga0496123_0011777 | Ga0496123_0011777_4029_5402 | 447 |
| 227 | 3300048929 | Ga0496126_0004042 | Ga0496126_0004042_9791_11164 | 447 |
| 228 | iso_pu_bacteria | 2547132130 | 2547503188 | 449 |
| 229 | iso_pu_bacteria | 2576861471 | 2578457568 | 449 |
| 230 | iso_pu_bacteria | 2643221579 | 2643908731 | 449 |
| 231 | iso_pu_bacteria | 2643221581 | 2643916162 | 449 |
| 232 | iso_pu_bacteria | 2747842428 | 2747948078 | 449 |
| 233 | iso_pu_bacteria | 2747842501 | 2748018313 | 449 |
| 234 | iso_pu_bacteria | 2765235840 | 2765579914 | 449 |
| 235 | iso_pu_bacteria | 2816332141 | 2816519043 | 449 |
| 236 | iso_pu_bacteria | 2818991457 | 2819660102 | 449 |
| 237 | iso_pu_bacteria | 2842391507 | 2842394872 | 449 |
| 238 | iso_pu_bacteria | 2842757796 | 2842760569 | 449 |
| 239 | iso_pu_bacteria | 2852649853 | 2852649989 | 449 |
| 240 | iso_pu_bacteria | 2852684882 | 2852685082 | 449 |
| 241 | iso_pu_bacteria | 2857442823 | 2857444766 | 449 |
| 242 | iso_pu_bacteria | 2874220319 | 2874222598 | 449 |
| 243 | iso_pu_bacteria | 2919089067 | 2919090539 | 449 |
| 244 | iso_pu_bacteria | 2919134579 | 2919137532 | 449 |
| 245 | iso_pu_bacteria | 2923516293 | 2923517943 | 449 |
| 246 | iso_pu_bacteria | 2928496128 | 2928498374 | 449 |
| 247 | iso_pu_bacteria | 2931380184 | 2931383945 | 449 |
| 248 | iso_pu_bacteria | 2937610967 | 2937614494 | 449 |
| 249 | iso_pu_bacteria | 2939589442 | 2939591140 | 449 |
| 250 | iso_pu_bacteria | 2939622612 | 2939624635 | 449 |
| 251 | iso_pu_bacteria | 2939626828 | 2939628291 | 449 |
| 252 | iso_pu_bacteria | 2941475908 | 2941476666 | 449 |
| 253 | iso_pu_bacteria | 2961047084 | 2961049363 | 449 |
| 254 | iso_pu_bacteria | 2961064222 | 2961065949 | 449 |
| 255 | iso_pu_bacteria | 2974307012 | 2974308194 | 449 |
| 256 | iso_pu_bacteria | 2977247770 | 2977248946 | 449 |
| 257 | iso_pu_bacteria | 2984514374 | 2984516597 | 449 |
| 258 | iso_pu_bacteria | 8021626552 | 8021627643 | 449 |
| 259 | iso_pu_bacteria | 8021648035 | 8021650766 | 449 |
| 260 | 3300038705 | Ga0237819_00151 | Ga0237819_00151_13424_14782 | 452 |
| 261 | 2162886007 | SwRhRL2b_contig_2056178 | SwRhRL2b_0579.00006300 | 453 |
| 262 | 3300003773 | Ga0055537_1002818 | Ga0055537_10028183 | 453 |
| 263 | 3300003781 | Ga0055536_1007141 | Ga0055536_10071414 | 453 |
| 264 | 3300003784 | Ga0055534_1000034 | Ga0055534_100003422 | 453 |
| 265 | 3300003790 | Ga0055528_1000671 | Ga0055528_100067110 | 453 |
| 266 | 3300003856 | Ga0058692_1000011 | Ga0058692_100001127 | 453 |
| 267 | 3300005289 | Ga0065704_10006470 | Ga0065704_100064702 | 453 |
| 268 | 3300005289 | Ga0065704_10070427 | Ga0065704_1007042713 | 453 |
| 269 | 3300006048 | Ga0075363_100067516 | Ga0075363_1000675162 | 453 |
| 270 | 3300009148 | Ga0105243_10026315 | Ga0105243_100263155 | 453 |
| 271 | 3300013104 | Ga0157370_10005472 | Ga0157370_100054722 | 453 |
| 272 | 3300013105 | Ga0157369_10412819 | Ga0157369_104128191 | 453 |
| 273 | 3300014497 | Ga0182008_10000142 | Ga0182008_1000014238 | 453 |
| 274 | 3300015261 | Ga0182006_1047257 | Ga0182006_10472572 | 453 |
| 275 | 3300015262 | Ga0182007_10000287 | Ga0182007_1000028732 | 453 |
| 276 | 3300015265 | Ga0182005_1000586 | Ga0182005_10005864 | 453 |
| 277 | 3300025263 | Ga0209565_1000022 | Ga0209565_1000022330 | 453 |
| 278 | 3300025273 | Ga0209673_1000104 | Ga0209673_100010477 | 453 |
| 279 | 3300025291 | Ga0209675_1000048 | Ga0209675_1000048167 | 453 |
| 280 | 3300025292 | Ga0209676_1000024 | Ga0209676_1000024293 | 453 |
| 281 | 3300025292 | Ga0209676_1000091 | Ga0209676_1000091157 | 453 |
| 282 | 3300025292 | Ga0209676_1000117 | Ga0209676_1000117137 | 453 |
| 283 | 3300025295 | Ga0209564_1000213 | Ga0209564_100021343 | 453 |
| 284 | 3300025298 | Ga0209050_1001640 | Ga0209050_10016408 | 453 |
| 285 | 3300025299 | Ga0209256_1004506 | Ga0209256_10045062 | 453 |
| 286 | 3300025303 | Ga0209051_1010883 | Ga0209051_10108834 | 453 |
| 287 | 3300025304 | Ga0209257_1000062 | Ga0209257_100006250 | 453 |
| 288 | 3300025304 | Ga0209257_1005770 | Ga0209257_10057701 | 453 |
| 289 | 3300025304 | Ga0209257_1009842 | Ga0209257_10098425 | 453 |
| 290 | 3300025735 | Ga0207713_1009809 | Ga0207713_10098097 | 453 |
| 291 | 3300025935 | Ga0207709_10001041 | Ga0207709_1000104113 | 453 |
| 292 | 3300027312 | Ga0209371_1000007 | Ga0209371_1000007422 | 453 |
| 293 | 3300027312 | Ga0209371_1000016 | Ga0209371_1000016401 | 453 |
| 294 | 3300028379 | Ga0268266_10162211 | Ga0268266_101622112 | 453 |
| 295 | 3300030500 | Ga0268256_1000008 | Ga0268256_1000008528 | 453 |
| 296 | 3300030500 | Ga0268256_1000015 | Ga0268256_1000015169 | 453 |
| 297 | 3300030732 | Ga0316176_1198490 | Ga0316176_11984905 | 453 |
| 298 | 3300030745 | Ga0316182_1149691 | Ga0316182_11496911 | 453 |
| 299 | 3300032004 | Ga0307414_10033527 | Ga0307414_100335274 | 453 |
| 300 | 3300046522 | Ga0495643_0003677 | Ga0495643_0003677_2429_3796 | 453 |
| 301 | 3300046525 | Ga0495663_0006930 | Ga0495663_0006930_678_2042 | 453 |
| 302 | 3300047320 | Ga0495672_0000073 | Ga0495672_0000073_142783_144150 | 453 |
| 303 | 3300048919 | Ga0496116_0008602 | Ga0496116_0008602_37_1398 | 453 |
| 304 | 3300048920 | Ga0496117_0014010 | Ga0496117_0014010_2244_3611 | 453 |
| 305 | 3300048921 | Ga0496118_0000344 | Ga0496118_0000344_26597_27964 | 453 |
| 306 | 3300048921 | Ga0496118_0003355 | Ga0496118_0003355_7336_8700 | 453 |
| 307 | 3300048922 | Ga0496119_0002556 | Ga0496119_0002556_11360_12724 | 453 |
| 308 | 3300048923 | Ga0496120_0002304 | Ga0496120_0002304_11362_12726 | 453 |
| 309 | 3300048927 | Ga0496124_0000281 | Ga0496124_0000281_94718_96085 | 453 |
| 310 | 3300048927 | Ga0496124_0002984 | Ga0496124_0002984_5621_6985 | 453 |
| 311 | 3300048927 | Ga0496124_0021641 | Ga0496124_0021641_3170_4534 | 453 |
| 312 | 3300048928 | Ga0496125_0006523 | Ga0496125_0006523_7371_8735 | 453 |
| 313 | 3300048928 | Ga0496125_0024645 | Ga0496125_0024645_917_2281 | 453 |
| 314 | 3300048929 | Ga0496126_0007989 | Ga0496126_0007989_2643_4007 | 453 |
| 315 | 3300049571 | Ga0501034_0000122 | Ga0501034_0000122_121418_122779 | 453 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qgq-assembly4.cif.gz_D | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.9309 | 138 | 440 |
| 2qgq-assembly1.cif.gz_A | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.9244 | 138 | 440 |
| 2qgq-assembly4.cif.gz_D | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.9175 | 138 | 440 |
| 2qgq-assembly1.cif.gz_A | crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 | 0.9081 | 138 | 440 |
| 4jc0-assembly2.cif.gz_B | crystal structure of thermotoga maritima holo rimo in complex with pentasulfide, northeast structural genomics consortium target vr77 | 0.7763 | 9 | 440 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEI4_9_125_3.40.50.12160 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain | 0.9617 | 8 | 122 | 3.40.50.12160 |
| 4jc0B03 | Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; | 0.9555 | 256 | 374 | 3.30.750.200 |
| af_P0AEI4_138_379_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.9529 | 135 | 376 | 3.80.30.20 |
| af_P0AEI4_138_379_3.80.30.20 | Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain | 0.949 | 135 | 376 | 3.80.30.20 |
| 2qgqA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9431 | 377 | 440 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2NQ02-F1-model_v4 | 30S ribosomal protein S12 methylthiotransferase RimO | 0.9854 | 297 | 440 |
GO:0005829
GO:0005840 GO:0035599 GO:0046872 GO:0051539 |
| AF-A0A4Q3SKC5-F1-model_v4 | deleted | 0.9788 | 298 | 440 |
|
| AF-A0A3D2NQ02-F1-model_v4 | 30S ribosomal protein S12 methylthiotransferase RimO | 0.9785 | 297 | 440 |
GO:0005829
GO:0005840 GO:0035599 GO:0046872 GO:0051539 |
| AF-A0A349Z8I5-F1-model_v4 | 30S ribosomal protein S12 methylthiotransferase RimO | 0.977 | 303 | 440 |
GO:0005829
GO:0005840 GO:0035599 GO:0046872 GO:0051539 |
| AF-A0A7V6SSJ9-F1-model_v4 | 30S ribosomal protein S12 methylthiotransferase RimO | 0.9761 | 302 | 442 |
GO:0005829
GO:0005840 GO:0035599 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar